Fcnb (ficolin B) - Rat Genome Database

Name: Fcnb
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

Advanced Search (OLGA)

Gene: Fcnb (ficolin B) Rattus norvegicus

Analyze

Symbol:

Fcnb

Name:

ficolin B

RGD ID:

621222

Description:

Predicted to enable several functions, including antigen binding activity; pattern recognition receptor activity; and sialic acid binding activity. Predicted to be involved in several processes, including activation of immune response; positive regulation of interleukin-8 production; and positive regulation of opsonization. Predicted to be located in plasma membrane. Predicted to be part of serine-type endopeptidase complex. Predicted to be active in collagen-containing extracellular matrix and extracellular space. Orthologous to several human genes including FCN1 (ficolin 1); INTERACTS WITH 17alpha-ethynylestradiol; 17beta-estradiol; 17beta-estradiol 3-benzoate.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

collagen/fibrinogen domain-containing protein 2; Fcn2; ficolin-2; ficolin-B; ficolin-beta; L-ficolin

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	FCN1 (ficolin 1)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Fcnb (ficolin B)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Fcn1 (ficolin 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	LOC100994951 (ficolin-1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	FCN2 (ficolin 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	FCN2 (ficolin (collagen/fibrinogen domain containing lectin) 2 (hucolin))	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	FCN1 (ficolin 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Fcn1 (ficolin 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	FCN2 (ficolin 2)	HGNC	OrthoDB, Panther, PhylomeDB, Treefam
Alliance orthologs ³
Mus musculus (house mouse):	Fcnb (ficolin B)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	FCN2 (ficolin 2)	Alliance	DIOPT (OMA\|OrthoFinder\|PANTHER)
Homo sapiens (human):	FCN1 (ficolin 1)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	T15B7.1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG30280	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoInspector)
Drosophila melanogaster (fruit fly):	CG30281	Alliance	DIOPT (Hieranoid\|OMA\|OrthoInspector)
Drosophila melanogaster (fruit fly):	CG5550	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OrthoInspector)
Drosophila melanogaster (fruit fly):	CG9500	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoInspector)
Xenopus tropicalis (tropical clawed frog):	fcn2	Alliance	DIOPT (OMA\|OrthoFinder\|PANTHER\|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):	fcn1	Alliance	DIOPT (OMA\|OrthoFinder\|PANTHER\|PhylomeDB)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	31,791,750 - 31,800,188 (-)	NCBI		GRCr8
mRatBN7.2	3	11,393,713 - 11,402,198 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	11,393,739 - 11,402,151 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	3	14,461,657 - 14,470,038 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	23,046,811 - 23,055,192 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	21,301,038 - 21,309,419 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	6,617,816 - 6,626,193 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	6,617,751 - 6,626,284 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	3	11,974,691 - 11,983,068 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	3	7,010,989 - 7,019,366 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	3	7,011,288 - 7,019,666 (-)	NCBI
Celera	3	6,185,644 - 6,194,021 (-)	NCBI		Celera
Cytogenetic Map	3	p12	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Adams-Oliver Syndrome 5 (ISO)

developmental and epileptic encephalopathy 14 (ISO)

Ehlers-Danlos syndrome classic type 1 (ISO)

Experimental Liver Cirrhosis (ISO)

Kleefstra syndrome 1 (ISO)

Leigh disease (ISO)

Monoclonal B-Cell Lymphocytosis (ISO)

primary coenzyme Q10 deficiency 7 (ISO)

Rafiq syndrome (ISO)

tuberous sclerosis 1 (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dichloroethane (ISO)

17alpha-ethynylestradiol (EXP)

17beta-estradiol (EXP)

17beta-estradiol 3-benzoate (EXP)

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4,6-tribromophenol (ISO)

2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO)

3,3',5,5'-tetrabromobisphenol A (ISO)

3,7-dihydropurine-6-thione (EXP)

4,4'-diaminodiphenylmethane (EXP)

6-propyl-2-thiouracil (EXP)

acetamide (EXP)

acrylamide (EXP)

aflatoxin B1 (EXP)

ammonium chloride (EXP)

amphetamine (EXP)

antirheumatic drug (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP,ISO)

butanal (ISO)

C60 fullerene (EXP)

cadmium dichloride (EXP)

cefaloridine (EXP)

copper atom (EXP)

copper(0) (EXP)

copper(II) sulfate (ISO)

D-penicillamine (EXP)

decabromodiphenyl ether (ISO)

dibutyl phthalate (EXP)

fenvalerate (EXP)

folic acid (ISO)

genistein (EXP)

indole-3-methanol (EXP)

mercaptopurine (EXP)

methotrexate (ISO)

methoxychlor (EXP)

methylmercury chloride (EXP)

N-acetyl-beta-D-glucosamine (ISO)

N-acetyl-D-glucosamine (ISO)

nickel atom (ISO)

oxaliplatin (EXP)

ozone (EXP)

purine-6-thiol (EXP)

sodium dichromate (ISO)

testosterone (EXP)

thioacetamide (EXP)

titanium dioxide (EXP)

topotecan (EXP)

trichloroethene (EXP)

triphenyl phosphate (EXP,ISO)

tungsten (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

blocking of symbiont entry into host cell (IEA)

cell surface pattern recognition receptor signaling pathway (ISO)

complement activation, lectin pathway (IBA,ISO)

G protein-coupled receptor signaling pathway (ISO)

innate immune response (IEA)

positive regulation of interleukin-8 production (ISO)

positive regulation of opsonization (ISO)

protein localization to cell surface (ISO)

proteolysis (ISO)

recognition of apoptotic cell (ISO)

Cellular Component

collagen trimer (IEA)

collagen-containing extracellular matrix (IBA)

extracellular region (IEA)

extracellular space (IBA)

plasma membrane (ISO)

serine-type endopeptidase complex (ISO)

Molecular Function

antigen binding (IBA)

carbohydrate binding (IEA)

carbohydrate derivative binding (IBA,ISO)

G protein-coupled receptor binding (ISO)

metal ion binding (IEA)

pattern recognition receptor activity (ISO)

protein binding (ISO)

sialic acid binding (ISO)

signaling receptor binding (IBA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
3.	GOA pipeline	RGD automated data pipeline
4.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
5.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:12477932	PMID:15489334	PMID:15804047	PMID:16328467	PMID:20400674	PMID:21037097	PMID:21182092	PMID:22851708

Genomics

Comparative Map Data

Fcnb
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	31,791,750 - 31,800,188 (-)	NCBI		GRCr8
mRatBN7.2	3	11,393,713 - 11,402,198 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	11,393,739 - 11,402,151 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	3	14,461,657 - 14,470,038 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	23,046,811 - 23,055,192 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	21,301,038 - 21,309,419 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	6,617,816 - 6,626,193 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	6,617,751 - 6,626,284 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	3	11,974,691 - 11,983,068 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	3	7,010,989 - 7,019,366 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	3	7,011,288 - 7,019,666 (-)	NCBI
Celera	3	6,185,644 - 6,194,021 (-)	NCBI		Celera
Cytogenetic Map	3	p12	NCBI

FCN1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	9	134,903,232 - 134,917,912 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	9	134,903,232 - 134,917,912 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	9	137,795,078 - 137,809,758 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	9	136,941,253 - 136,949,630 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	9	135,027,380 - 135,035,754	NCBI
Celera	9	108,315,253 - 108,323,628 (-)	NCBI		Celera
Cytogenetic Map	9	q34.3	NCBI
HuRef	9	107,265,062 - 107,273,437 (-)	NCBI		HuRef
CHM1_1	9	137,950,267 - 137,958,642 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	9	147,124,901 - 147,139,590 (-)	NCBI		T2T-CHM13v2.0

Fcnb
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	2	27,966,491 - 27,974,921 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	2	27,966,390 - 27,974,897 (-)	Ensembl		GRCm39 Ensembl
GRCm38	2	28,076,479 - 28,084,910 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	2	28,076,378 - 28,084,885 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	2	27,931,999 - 27,940,398 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	2	27,898,488 - 27,906,887 (-)	NCBI		MGSCv36	mm8
Celera	2	27,779,281 - 27,787,680 (-)	NCBI		Celera
Cytogenetic Map	2	A3	NCBI
cM Map	2	19.38	NCBI

Fcn1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955513	3,687,232 - 3,698,673 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955513	3,690,550 - 3,697,785 (-)	NCBI	ChiLan1.0	ChiLan1.0

LOC100994951
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	11	4,413,958 - 4,422,270 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	9	4,416,291 - 4,424,603 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	9	106,039,315 - 106,047,648 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	9	135,040,722 - 135,049,105 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	9	135,040,310 - 135,049,111 (-)	Ensembl	panpan1.1		panPan2

FCN2
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	9	50,868,942 - 50,876,001 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	9	50,868,973 - 50,875,792 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	9	50,152,289 - 50,159,350 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	9	51,746,147 - 51,753,208 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	9	51,746,180 - 51,752,999 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	9	50,506,401 - 50,513,474 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	9	50,850,289 - 50,857,359 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	9	50,927,946 - 50,935,059 (+)	NCBI		UU_Cfam_GSD_1.0

FCN2
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	1	274,103,877 - 274,111,970 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	1	274,106,276 - 274,111,970 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	1	308,195,158 - 308,203,079 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

FCN1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	12	3,227,790 - 3,236,161 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666058	1,894,000 - 1,902,427 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Fcn1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624760	2,743,996 - 2,751,110 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624760	2,743,996 - 2,751,116 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Fcnb
28 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	95
Count of miRNA genes:	72
Interacting mature miRNAs:	76
Transcripts:	ENSRNOT00000012494
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1558647	Cm46	Cardiac mass QTL 46	5.4	0.0000055	heart mass (VT:0007028)	heart wet weight (CMO:0000069)	3	10778823	30356773	Rat
1358357	Srcrtb1	Stress Responsive Cort Basal QTL 1	6.36	0.002	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	3	8658162	27494778	Rat
6893355	Bw101	Body weight QTL 101	0.4	0.38	body mass (VT:0001259)	body weight (CMO:0000012)	3	10778704	30357018	Rat
4889966	Bss95	Bone structure and strength QTL 95	4.4		tibia area (VT:1000281)	tibia-fibula cross-sectional area (CMO:0001718)	3	1	36847613	Rat
1558654	Bw56	Body weight QTL 56	4.5	0.0000171	body mass (VT:0001259)	body weight (CMO:0000012)	3	10778704	30357018	Rat
10401810	Kidm53	Kidney mass QTL 53			kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	3	8227194	47233430	Rat
1298526	Arunc3	Aerobic running capacity QTL 3	2.2		exercise endurance trait (VT:0002332)	maximum distance run on treadmill (CMO:0001406)	3	8227194	33703538	Rat
8693641	Alc30	Alcohol consumption QTL 30	2	0.739	drinking behavior trait (VT:0001422)	calculated ethanol drink intake rate (CMO:0001615)	3	10434306	24512004	Rat
1558650	Cm48	Cardiac mass QTL 48	4	0.0001	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	3	10778823	30356773	Rat
1358905	Hrtrt17	Heart rate QTL 17	5.9	0.000014	heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	3	10861912	89878372	Rat
70191	BpQTLcluster4	Blood pressure QTL cluster 4	3		arterial blood pressure trait (VT:2000000)	absolute change in systolic blood pressure (CMO:0000607)	3	10778704	50302886	Rat
631545	Bp85	Blood pressure QTL 85	3.1		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	3	1	33278763	Rat
631679	Cm10	Cardiac mass QTL 10	7.34	0.0001	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	3	1	31158234	Rat
2290452	Scl56	Serum cholesterol level QTL 56	2.26		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	3	1	91609953	Rat
1558657	Cm43	Cardiac mass QTL 43	6.6	3e-08	heart mass (VT:0007028)	heart wet weight (CMO:0000069)	3	10778823	30356773	Rat
631568	Bp92	Blood pressure QTL 92	2.2	0.005	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	3	1	39874793	Rat
70203	Gcr2	Gastric cancer resistance QTL 2	2.6		stomach morphology trait (VT:0000470)	stomach tumor susceptibility score (CMO:0002043)	3	8658162	27494778	Rat
6893363	Bw105	Body weight QTL 105	2.6	0.0036	body mass (VT:0001259)	body weight (CMO:0000012)	3	10778704	30357018	Rat
70202	Alc19	Alcohol consumption QTL 19	2.5		drinking behavior trait (VT:0001422)	ethanol intake volume to total fluid intake volume ratio (CMO:0001591)	3	1	27494778	Rat
2312664	Scl62	Serum cholesterol level QTL 62		0.05	blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	3	1	38710544	Rat
61468	Bp15	Blood pressure QTL 15	4.4		blood pressure trait (VT:0000183)	pulse pressure (CMO:0000292)	3	1	33278763	Rat
631831	Alc8	Alcohol consumption QTL 8	2.7		consumption behavior trait (VT:0002069)	calculated ethanol drink intake rate (CMO:0001615)	3	1	33230976	Rat

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	10	45	113	91	90	59	25	59	6	213	92	93	45	59	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_053634	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AB036792	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC088123	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474001	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ220557	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ233041	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ234176	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000003	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000012494 ⟹ ENSRNOP00000012494

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	3	11,393,739 - 11,402,151 (-)	Ensembl
Rnor_6.0 Ensembl	3	6,617,751 - 6,626,284 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000102462 ⟹ ENSRNOP00000091036

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	3	11,393,739 - 11,402,151 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000110782 ⟹ ENSRNOP00000093251

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	3	11,395,390 - 11,402,151 (-)	Ensembl

RefSeq Acc Id:

NM_053634 ⟹ NP_446086

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	31,791,750 - 31,800,188 (-)	NCBI
mRatBN7.2	3	11,393,713 - 11,402,151 (-)	NCBI
Rnor_6.0	3	6,617,816 - 6,626,193 (-)	NCBI
Rnor_5.0	3	11,974,691 - 11,983,068 (-)	NCBI
RGSC_v3.4	3	7,010,989 - 7,019,366 (-)	RGD
Celera	3	6,185,644 - 6,194,021 (-)	RGD

Sequence:

show sequence

GAGGGGCTGCGAGCTGAGCAGTTGCCATGGTCCTGGGATCTGCTGCACTATTCGTCTTGAGCCT
GTGTGTCACTGAGCTGACCCTCCATGCTGCTGACACCTGCCCAGAGGTGAAGGTCCTGGATCTG
GAGGGCTCCAACAAACTCACCATCCTTCAAGGCTGCCCTGGCTTGCCTGGAGCCCTGGGGCCCA
AGGGAGAGGCTGGTGCCAAAGGAGATAGAGGAGAGAGTGGCCTTCCTGGACACCCTGGAAAGGC
GGGGCCAACTGGACCCAAAGGAGACCGAGGAGAGAAGGGAGTGCGTGGAGAAAAAGGAGACACC
GGGCCCTCCCAGTCATGTGCTACAGGACCTCGGACCTGCAAGGAGTTGCTCACCCGGGGCTACT
TTCTCACTGGCTGGTATACCATCTACCTGCCAGACTGCAGGCCCCTGACCGTGCTGTGTGATAT
GGACACAGATGGTGGAGGCTGGACCGTCTTTCAGAGAAGGATCGACGGCACGGTGGACTTCTTT
CGGGACTGGACCTCATACAAGCAAGGCTTCGGCAGCCAGCTGGGGGAGTTCTGGCTGGGGAACG
ATAACATCCATGCTTTAACCACCCAGGGAACCAATGAGCTGCGGGTGGATCTTGCAGACTTCGA
CGGCAACCATGACTTTGCCAAGTACAGCTCCTTCCAGATCCAGGGAGAGGCCGAGAAATACAAG
CTCATTCTGGGGAACTTCCTCGGTGGTGGTGCTGGTGACTCCCTGACTTCCCAAAACAACATGC
TTTTCTCCACCAAAGACCAAGACAACGACCAGGGATCCTCCAACTGTGCCGTGCGTTACCATGG
AGCCTGGTGGTACTCTGATTGTCACACTTCCAACCTGAATGGCCTCTACCTTAGGGGTCTCCAT
AAGAGCTATGCAAACGGTGTCAATTGGAAGTCATGGAAAGGGTACAACTACAGCTACAAGGTTT
CTGAAATGAAGGTGCGCCTCATCTAGCTCCCCACAAAGAGAGTGCCCCTCCCAAACTCTAGCAT
ACCAGCAACAGGAGTCTTCTATCTTTCTTCAGCCAAGGAAGGAGTGTGCCACCCCGCCCGGCTC
TGCTCATTGCCCACATTCCACACAGCCCATGACCTCTGA

hide sequence

Protein Sequences


Protein RefSeqs	NP_446086	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH88123	(Get FASTA)	NCBI Sequence Viewer
	BAB20440	(Get FASTA)	NCBI Sequence Viewer
	EDL93425	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000012494.3
	ENSRNOP00000091036.1
	ENSRNOP00000093251.1
	ENSRNOP00055007923
	ENSRNOP00060040376
	ENSRNOP00065028631
GenBank Protein	P57756	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_446086 ⟸ NM_053634
- Peptide Label:	precursor
- UniProtKB:	P57756 (UniProtKB/Swiss-Prot), A6JTM2 (UniProtKB/TrEMBL), A0A8I6AEL8 (UniProtKB/TrEMBL)
- Sequence:	show sequence MVLGSAALFVLSLCVTELTLHAADTCPEVKVLDLEGSNKLTILQGCPGLPGALGPKGEAGAKGD RGESGLPGHPGKAGPTGPKGDRGEKGVRGEKGDTGPSQSCATGPRTCKELLTRGYFLTGWYTIY LPDCRPLTVLCDMDTDGGGWTVFQRRIDGTVDFFRDWTSYKQGFGSQLGEFWLGNDNIHALTTQ GTNELRVDLADFDGNHDFAKYSSFQIQGEAEKYKLILGNFLGGGAGDSLTSQNNMLFSTKDQDN DQGSSNCAVRYHGAWWYSDCHTSNLNGLYLRGLHKSYANGVNWKSWKGYNYSYKVSEMKVRLI hide sequence

Ensembl Acc Id:

ENSRNOP00000012494 ⟸ ENSRNOT00000012494

Ensembl Acc Id:

ENSRNOP00000093251 ⟸ ENSRNOT00000110782

Ensembl Acc Id:

ENSRNOP00000091036 ⟸ ENSRNOT00000102462

Protein Domains

Collagen-like Fibrinogen C-terminal

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P57756-F1-model_v2	AlphaFold	P57756	1-319	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13691930

Promoter ID:

EPDNEW_R2454

Type:

single initiation site

Name:

Fcnb_1

Description:

ficolin B

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	3	6,626,196 - 6,626,256	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:621222	AgrOrtholog
BioCyc Gene	G2FUF-50286	BioCyc
Ensembl Genes	ENSRNOG00000009342	Ensembl, UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	ENSRNOG00055006306	UniProtKB/Swiss-Prot
	ENSRNOG00060027892	UniProtKB/Swiss-Prot
	ENSRNOG00065020913	UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000012494.7	UniProtKB/Swiss-Prot
	ENSRNOT00000102462.1	UniProtKB/TrEMBL
	ENSRNOT00000110782.1	UniProtKB/TrEMBL
	ENSRNOT00055010239	UniProtKB/Swiss-Prot
	ENSRNOT00060048461	UniProtKB/Swiss-Prot
	ENSRNOT00065035530	UniProtKB/Swiss-Prot
Gene3D-CATH	3.90.215.10	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7376834	IMAGE-MGC_LOAD
InterPro	Collagen	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Fibrinogen-like_C	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Fibrinogen_a/b/g_C_1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Fibrinogen_a/b/g_C_dom	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Fibrinogen_C-term_domain	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Fibrinogen_CS	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:114091	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
MGC_CLONE	MGC:108632	IMAGE-MGC_LOAD
NCBI Gene	114091	ENTREZGENE
PANTHER	FIBRINOGEN/TENASCIN/ANGIOPOEITIN	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	FICOLIN-2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	Collagen	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Fibrinogen_C	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Fcnb	PhenoGen
PROSITE	FIBRINOGEN_C_1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	FIBRINOGEN_C_2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000009342	RatGTEx
	ENSRNOG00055006306	RatGTEx
	ENSRNOG00060027892	RatGTEx
	ENSRNOG00065020913	RatGTEx
SMART	FBG	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	SSF56496	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A0A8I6AEL8	ENTREZGENE, UniProtKB/TrEMBL
	A0A8I6GK74_RAT	UniProtKB/TrEMBL
	A6JTM2	ENTREZGENE, UniProtKB/TrEMBL
	FCN2_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2005-01-20	Fcnb	ficolin B			Symbol and Name status set to approved	1299863	APPROVED
2002-08-07	Fcnb	ficolin B			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD