Advanced Search (OLGA)

Gene: Egr4 (early growth response 4) Rattus norvegicus

Analyze

Symbol:

Egr4

Name:

early growth response 4

RGD ID:

2546

Description:

Enables RNA polymerase II transcription regulatory region sequence-specific DNA binding activity. Involved in cellular response to growth factor stimulus and positive regulation of transcription by RNA polymerase II. Predicted to be located in nucleus. Biomarker of middle cerebral artery infarction. Orthologous to human EGR4 (early growth response 4); INTERACTS WITH 1,2,4-trimethylbenzene; 1-naphthyl isothiocyanate; 2,2',4,4'-Tetrabromodiphenyl ether.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

early growth response protein 4; early response protein NGFI-C; EGR-4; Egr4l1; nerve growth factor-induced protein C; NGFI-C; zinc-finger transcription factor NGFI-C; zinc-finger transcription factor NGFI-C (early response gene); Zinc-finger transcription factor NGFI-C (early response gene) member of the GCGGGGGCG (GSG) element-binding protein family see D4Arb6; Zinc-finger transcription factor NGFI-C (early response gene), member of the GCGGGGGCG (GSG) element-binding protein family, see D4Arb6

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	EGR4 (early growth response 4)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Treefam
Mus musculus (house mouse):	Egr4 (early growth response 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Egr4 (early growth response 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	EGR4 (early growth response 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	EGR4 (early growth response 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Egr4 (early growth response 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	EGR4 (early growth response 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	EGR4 (early growth response 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Egr4 (early growth response 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Egr4 (early growth response 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	EGR4 (early growth response 4)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Egr4 (early growth response 4)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	egr4 (early growth response 4)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoInspector\|PANTHER\|PhylomeDB)
Danio rerio (zebrafish):	egr4 (early growth response 4)	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OrthoInspector\|PANTHER\|PhylomeDB)
Caenorhabditis elegans (roundworm):	egrh-3	Alliance	DIOPT (PANTHER\|PhylomeDB)
Saccharomyces cerevisiae (baker's yeast):	STP4	Alliance	DIOPT (Ensembl Compara\|InParanoid)
Saccharomyces cerevisiae (baker's yeast):	STP3	Alliance	DIOPT (Ensembl Compara\|InParanoid)
Xenopus tropicalis (tropical clawed frog):	egr4	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	4	119,605,358 - 119,607,817 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	4	119,605,357 - 119,608,368 (-)	Ensembl				GRCr8
mRatBN7.2	4	118,047,869 - 118,050,328 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	4	118,047,869 - 118,050,328 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	4	123,529,269 - 123,531,728 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	4	119,304,376 - 119,306,835 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	4	117,917,863 - 117,920,322 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	4	117,293,620 - 117,296,082 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	4	117,293,620 - 117,296,082 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	4	181,870,041 - 181,872,503 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	4	119,765,289 - 119,767,612 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	4	107,029,479 - 107,031,938 (-)	NCBI		Celera
RGSC_v3.1	4	120,009,769 - 120,012,093 (-)	NCBI
RH 3.4 Map	4	690.8	RGD
Cytogenetic Map	4	q34	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

middle cerebral artery infarction (IEP)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2,4-trimethylbenzene (EXP)

1-naphthyl isothiocyanate (EXP)

17beta-estradiol (ISO)

2,2',4,4'-Tetrabromodiphenyl ether (EXP)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

3,4-methylenedioxymethamphetamine (ISO)

6-propyl-2-thiouracil (EXP)

acetylsalicylic acid (ISO)

aflatoxin B1 (ISO)

all-trans-retinoic acid (ISO)

amitrole (EXP)

ammonium chloride (EXP)

aripiprazole (EXP)

benzo[a]pyrene (ISO)

benzo[a]pyrene diol epoxide I (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

butanal (ISO)

cadmium dichloride (EXP,ISO)

carbon nanotube (ISO)

carbonyl sulfide (EXP)

CGP 52608 (ISO)

cocaine (EXP)

copper(II) sulfate (ISO)

crocidolite asbestos (ISO)

Cuprizon (EXP)

cyclophosphamide (EXP)

cyclosporin A (ISO)

cylindrospermopsin (ISO)

decabromodiphenyl ether (EXP)

disodium selenite (ISO)

dorsomorphin (ISO)

entinostat (ISO)

ethanol (ISO)

fenvalerate (EXP)

fluoxetine (EXP)

fulvestrant (ISO)

gentamycin (EXP)

glycidol (EXP)

hydrogen peroxide (ISO)

hydrogen sulfide (ISO)

ketamine (EXP)

lead(0) (ISO)

leflunomide (ISO)

maneb (ISO)

methamphetamine (EXP)

methimazole (EXP)

methotrexate (ISO)

methyl methanesulfonate (ISO)

methylmercury chloride (ISO)

mono(2-ethylhexyl) phthalate (EXP,ISO)

morphine (EXP,ISO)

naphthalenes (EXP)

p-chloromercuribenzoic acid (ISO)

paracetamol (EXP,ISO)

paraquat (ISO)

pentanal (ISO)

phorbol 13-acetate 12-myristate (ISO)

potassium bromate (ISO)

Ptaquiloside (ISO)

pyridaben (ISO)

quercetin (ISO)

resveratrol (ISO)

rifampicin (ISO)

SB 431542 (ISO)

SCH 23390 (EXP)

silicon dioxide (ISO)

silver atom (ISO)

silver(0) (ISO)

sodium arsenite (ISO)

Soman (EXP)

sulfadimethoxine (EXP)

thiram (ISO)

tributylstannane (EXP)

trichloroethene (EXP)

trimellitic anhydride (ISO)

triptonide (ISO)

undecane (EXP)

valproic acid (EXP,ISO)

vinclozolin (EXP)

zinc atom (ISO)

zinc(0) (ISO)

zoledronic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

cellular response to growth factor stimulus (IEP)

positive regulation of transcription by RNA polymerase II (IDA,ISO)

regulation of transcription by RNA polymerase II (IBA,IEA)

Cellular Component

nucleus (IBA,IEA)

Molecular Function

DNA binding (IEA)

DNA-binding transcription activator activity, RNA polymerase II-specific (ISO)

DNA-binding transcription factor activity, RNA polymerase II-specific (IBA)

metal ion binding (IEA)

protein binding (ISO)

RNA polymerase II cis-regulatory region sequence-specific DNA binding (IBA)

RNA polymerase II transcription regulatory region sequence-specific DNA binding (IDA)

sequence-specific DNA binding (ISO)

sequence-specific double-stranded DNA binding (ISO)

zinc ion binding (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	The early response gene NGFI-C encodes a zinc finger transcriptional activator and is a member of the GCGGGGGCG (GSG) element-binding protein family.	Crosby SD, etal., Mol Cell Biol 1991 Aug;11(8):3835-41.
2.	Neural-specific expression, genomic structure, and chromosomal localization of the gene encoding the zinc-finger transcription factor NGFI-C.	Crosby SD, etal., Proc Natl Acad Sci U S A 1992 May 15;89(10):4739-43.
3.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
4.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
5.	High-density rat radiation hybrid maps containing over 24,000 SSLPs, genes, and ESTs provide a direct link to the rat genome sequence.	Kwitek AE, etal., Genome Res. 2004 Apr;14(4):750-7
6.	Erythropoietin-induced changes in brain gene expression reveal induction of synaptic plasticity genes in experimental stroke.	Mengozzi M, etal., Proc Natl Acad Sci U S A. 2012 Jun 12;109(24):9617-22. doi: 10.1073/pnas.1200554109. Epub 2012 May 29.
7.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
8.	GOA pipeline	RGD automated data pipeline
9.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
10.	Tentative Sequence Identification Numbers	Tentative Sequence Data IDs. TIGR Gene Index, Rat Data

Additional References at PubMed

PMID:12560487	PMID:23332764	PMID:29580816

Genomics

Comparative Map Data

Egr4
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	4	119,605,358 - 119,607,817 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	4	119,605,357 - 119,608,368 (-)	Ensembl				GRCr8
mRatBN7.2	4	118,047,869 - 118,050,328 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	4	118,047,869 - 118,050,328 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	4	123,529,269 - 123,531,728 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	4	119,304,376 - 119,306,835 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	4	117,917,863 - 117,920,322 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	4	117,293,620 - 117,296,082 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	4	117,293,620 - 117,296,082 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	4	181,870,041 - 181,872,503 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	4	119,765,289 - 119,767,612 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	4	107,029,479 - 107,031,938 (-)	NCBI		Celera
RGSC_v3.1	4	120,009,769 - 120,012,093 (-)	NCBI
RH 3.4 Map	4	690.8	RGD
Cytogenetic Map	4	q34	NCBI

EGR4
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	2	73,290,929 - 73,293,548 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	2	73,290,927 - 73,293,721 (-)	Ensembl			hg38	GRCh38
GRCh37	2	73,518,057 - 73,520,676 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	2	73,371,565 - 73,374,181 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	2	73,429,720 - 73,432,265	NCBI
Celera	2	73,368,884 - 73,371,656 (-)	NCBI		Celera
Cytogenetic Map	2	p13.2	NCBI
HuRef	2	73,253,506 - 73,256,278 (-)	NCBI		HuRef
CHM1_1	2	73,448,863 - 73,451,635 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	2	73,300,923 - 73,306,546 (-)	NCBI		T2T-CHM13v2.0

Egr4
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	6	85,488,103 - 85,490,571 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	6	85,488,103 - 85,490,571 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	6	85,511,121 - 85,513,589 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	6	85,511,121 - 85,513,589 (-)	Ensembl			mm10	GRCm38
MGSCv37	6	85,461,116 - 85,463,536 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	6	85,476,780 - 85,479,200 (-)	NCBI		MGSCv36	mm8
Celera	6	87,483,061 - 87,485,363 (-)	NCBI		Celera
Cytogenetic Map	6	C3	NCBI
cM Map	6	37.48	NCBI

Egr4
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955424	12,338,979 - 12,342,078 (+)	Ensembl
ChiLan1.0	NW_004955424	12,339,152 - 12,341,925 (+)	NCBI	ChiLan1.0	ChiLan1.0

EGR4
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	12	53,087,182 - 53,089,822 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	2A	53,089,935 - 53,092,572 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	2A	73,343,705 - 73,346,476 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	2A	74,831,326 - 74,834,246 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	2A	74,831,326 - 74,834,246 (-)	Ensembl			panPan2	panpan1.1

EGR4
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	17	49,575,964 - 49,580,697 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	17	49,575,466 - 49,578,251 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	17	49,222,642 - 49,225,616 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	17	50,441,901 - 50,444,875 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	17	50,441,953 - 50,444,182 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	17	49,458,229 - 49,461,203 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	17	49,524,903 - 49,527,877 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	17	50,084,062 - 50,087,036 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Egr4
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024406292	11,499,683 - 11,502,500 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936491	17,069,325 - 17,071,226 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936491	17,068,797 - 17,071,608 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

EGR4
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	3	69,485,949 - 69,488,975 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	3	69,485,919 - 69,488,788 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	3	72,688,741 - 72,691,610 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

EGR4
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	14	33,879,707 - 33,882,669 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	14	33,879,904 - 33,882,663 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666045	78,196,090 - 78,203,083 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Egr4
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624762	351,600 - 353,449 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624762	351,190 - 354,004 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Egr4
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	6	60,690,005 - 60,692,475 (+)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Egr4
18 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	73
Count of miRNA genes:	60
Interacting mature miRNAs:	68
Transcripts:	ENSRNOT00000021097
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
631689	Scl4	Serum cholesterol level QTL 4	1.9	0.008	blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	4	96731383	141731383	Rat
1582232	Gluco25	Glucose level QTL 25	3.6	0.0023	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	4	86583980	149763391	Rat
2302049	Pia32	Pristane induced arthritis QTL 32	5.1	0.001	blood autoantibody amount (VT:0003725)	serum immunoglobulin G-type rheumatoid factor level relative to an arbitrary reference serum (CMO:0002112)	4	107346299	152346299	Rat
1358352	Srcrt3	Stress Responsive Cort QTL 3	2.29		blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	4	39431983	123203361	Rat
1578655	Bmd11	Bone mineral density QTL 11	11		femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	4	92406430	137406430	Rat
1300116	Hrtrt5	Heart rate QTL 5	3.76		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	4	117737142	152833657	Rat
6478763	Anxrr46	Anxiety related response QTL 46		0.07428	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	112427331	157427331	Rat
10755501	Bp390	Blood pressure QTL 390	2.5		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	4	27730518	170099664	Rat
6478760	Anxrr45	Anxiety related response QTL 45		0.06717	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	112427331	157427331	Rat
1331802	Srn5	Serum renin concentration QTL 5	3.045		renin activity (VT:0005581)	plasma renin activity level (CMO:0000116)	4	117559384	162559384	Rat
738009	Sach4	Saccharine consumption QTL 4	4.9	0.000016	consumption behavior trait (VT:0002069)	saccharin intake volume to total fluid intake volume ratio (CMO:0001601)	4	60916264	184426481	Rat
2306545	Iddm39	Insulin dependent diabetes mellitus QTL 39			blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	4	78687630	123687630	Rat
61330	Eau1	Experimental allergic uveoretinitis QTL 1		0.0003	uvea integrity trait (VT:0010551)	experimental autoimmune uveitis score (CMO:0001504)	4	26234499	134199155	Rat
7207480	Bss105	Bone structure and strength QTL 105	8.1		femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	4	111383604	156383604	Rat
731165	Uae21	Urinary albumin excretion QTL 21	2.4	0.0001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	4	108206096	153206096	Rat
737821	Hcar9	Hepatocarcinoma resistance QTL 9	3.7		liver integrity trait (VT:0010547)	volume of individual liver tumorous lesion (CMO:0001078)	4	106848959	168870974	Rat
634335	Anxrr16	Anxiety related response QTL 16	7.22		locomotor behavior trait (VT:0001392)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	4	94638356	168870820	Rat
631646	Stl4	Serum triglyceride level QTL 4	6.5	0.0001	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	4	74169813	134199155	Rat
634334	Xhs3	X-ray hypersensitivity QTL 3	10		intestine integrity trait (VT:0010554)	post-insult time to onset of moribundity (CMO:0001896)	4	86058928	131411333	Rat
61406	Scwia1	Streptococcal cell wall induced arthritis QTL 1	2.3		joint integrity trait (VT:0010548)	experimental arthritis severity measurement (CMO:0001459)	4	75939858	140508796	Rat
1549832	Bss3	Bone structure and strength QTL 3	11		femur morphology trait (VT:0000559)	femur midshaft cortical cross-sectional area (CMO:0001663)	4	111383604	156383604	Rat
70177	Xhs1	X-ray hypersensitivity QTL 1	25.1		intestine integrity trait (VT:0010554)	post-insult time to onset of moribundity (CMO:0001896)	4	82944895	154403548	Rat
1354612	Foco1	Food consumption QTL 1	8.87		eating behavior trait (VT:0001431)	food intake rate (CMO:0000427)	4	45429897	149763204	Rat
6909128	Pancm4	Pancreatic morphology QTL 4	11.35		pancreas mass (VT:0010144)	pancreas wet weight (CMO:0000626)	4	27862204	126119996	Rat
2303168	Bp330	Blood pressure QTL 330	4.25	0.017	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	4	5889999	148002343	Rat
61476	Aia3	Adjuvant induced arthritis QTL 3	3.9		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	75939858	140508796	Rat
738031	Alc14	Alcohol consumption QTL 14	7.6	0.00003	consumption behavior trait (VT:0002069)	ethanol drink intake rate to body weight ratio (CMO:0001616)	4	60916264	174095838	Rat
1576316	Ept5	Estrogen-induced pituitary tumorigenesis QTL 5	3.8		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	4	100752691	179366077	Rat
1641919	Alc22	Alcohol consumption QTL 22		0.0005	drinking behavior trait (VT:0001422)	ethanol drink intake rate (CMO:0001407)	4	65060960	127749483	Rat
631662	Hcar2	Hepatocarcinoma resistance QTL 2	3.1	0.0003	liver integrity trait (VT:0010547)	volume of individual liver tumorous lesion (CMO:0001078)	4	84349032	129349032	Rat
1576305	Emca6	Estrogen-induced mammary cancer QTL 6	5.8		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	4	45429709	157555683	Rat
61418	Pia5	Pristane induced arthritis QTL 5	4.5		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	63245026	129846354	Rat
738016	Alc16	Alcohol consumption QTL 16	3.6	0.00015	consumption behavior trait (VT:0002069)	ethanol drink intake rate to body weight ratio (CMO:0001616)	4	60916264	184426481	Rat
1358202	Gluco11	Glucose level QTL 11	2.4	0.02	adipocyte glucose uptake trait (VT:0004185)	absolute change in adipocyte glucose uptake (CMO:0000873)	4	86709649	168870974	Rat
1641833	Alc21	Alcohol consumption QTL 21	8.6	0.0001	drinking behavior trait (VT:0001422)	ethanol drink intake rate (CMO:0001407)	4	57664252	127749483	Rat
1354660	Salc1	Saline consumption QTL 1	11.26		drinking behavior trait (VT:0001422)	saline drink intake rate (CMO:0001627)	4	45429897	149763204	Rat
2306899	Bp338	Blood pressure QTL 338		0.071	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	4	82336765	127336765	Rat
2293840	Kiddil9	Kidney dilation QTL 9	2.9		kidney pelvis morphology trait (VT:0004194)	hydronephrosis severity score (CMO:0001208)	4	113634167	149763391	Rat
631674	Iddm14	Insulin dependent diabetes mellitus QTL 14			blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	4	65495851	159259805	Rat
12798519	Anxrr54	Anxiety related response QTL 54	2.54	0.05	locomotor behavior trait (VT:0001392)	distance moved per unit of time into, out of or within a discrete space in an experimental apparatus (CMO:0001493)	4	116184844	161184844	Rat
1578670	Bss14	Bone structure and strength QTL 14	16.4		femur morphology trait (VT:0000559)	bone trabecular cross-sectional area (CMO:0002311)	4	88883695	133883695	Rat
70201	Gcr1	Gastric cancer resistance QTL 1	2.7		stomach morphology trait (VT:0000470)	stomach tumor susceptibility score (CMO:0002043)	4	103834277	148834277	Rat
12798523	Anxrr56	Anxiety related response QTL 56	2.83	0.05	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	86583980	131583980	Rat
70200	Alc18	Alcohol consumption QTL 18	9.2		drinking behavior trait (VT:0001422)	ethanol intake volume to total fluid intake volume ratio (CMO:0001591)	4	57613339	151163960	Rat
2316958	Gluco58	Glucose level QTL 58	10		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	4	12212457	182430611	Rat
1578662	Bss15	Bone structure and strength QTL 15	19.6		femur width (VT:1000666)	femoral neck width (CMO:0001695)	4	88883695	133883695	Rat

Markers in Region

D4Arb6

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	4	118,050,728 - 118,051,034 (+)	MAPPER	mRatBN7.2
Rnor_6.0	4	117,296,483 - 117,296,788	NCBI	Rnor6.0
Rnor_5.0	4	181,872,904 - 181,873,209	UniSTS	Rnor5.0
RGSC_v3.4	4	119,769,041 - 119,769,346	UniSTS	RGSC3.4
Celera	4	107,032,339 - 107,032,644	UniSTS
Cytogenetic Map	4	q34	UniSTS

RH94566

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	4	118,047,907 - 118,048,058 (+)	MAPPER	mRatBN7.2
Rnor_6.0	4	117,293,659 - 117,293,809	NCBI	Rnor6.0
Rnor_5.0	4	181,870,080 - 181,870,230	UniSTS	Rnor5.0
RGSC_v3.4	4	119,765,328 - 119,765,478	UniSTS	RGSC3.4
Celera	4	107,029,518 - 107,029,668	UniSTS
RH 3.4 Map	4	690.8	UniSTS
Cytogenetic Map	4	q34	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
6	2	15	107	19	13	4	10	4	4	52	32	98	8	58	9	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_019137	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH473957	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000004	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	M65008	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	M92433	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000021097 ⟹ ENSRNOP00000021097

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	4	119,605,357 - 119,608,368 (-)	Ensembl
mRatBN7.2 Ensembl	4	118,047,869 - 118,050,328 (-)	Ensembl
Rnor_6.0 Ensembl	4	117,293,620 - 117,296,082 (-)	Ensembl

RefSeq Acc Id:

NM_019137 ⟹ NP_062010

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	119,605,358 - 119,607,817 (-)	NCBI
mRatBN7.2	4	118,047,869 - 118,050,328 (-)	NCBI
Rnor_6.0	4	117,293,620 - 117,296,082 (-)	NCBI
Rnor_5.0	4	181,870,041 - 181,872,503 (-)	NCBI
RGSC_v3.4	4	119,765,289 - 119,767,612 (-)	RGD
Celera	4	107,029,479 - 107,031,938 (-)	RGD

Sequence:

show sequence

AGCCCGGTTGCACTTTGGAGAAACCAGGAGCCGCCGCCCGAGGCAGGTGCGGGCGAGCCAGGGC
GCCGCGGCCCCCCAACCCTCGTCCCCGAGCCAAGCGCCGGGAGCCTGGAGCTGGGGCGCCCGGA
TTCCCTGCCAGCCACGCGCGCCCCAGCCCAGCGAGGCCCCGGGCGCCCCGCCGCCACCACGCCA
TGCTCCACCTGAGCGACTTCTCCGGCCCCGACGCGCTCCTCTCCAAGCCCACCGAAGGCTGCGC
CCACACCAGCCCCGAGCTGCCCCGGCTGCCTGCTAGGGACGCTCCCTCGGCCGCCGCGTATCCT
GGAGGCGACTTCTTGAGCTGGGCTCTGAGCACCTGCGGCGCCGGGGGGGACTTAACAGACTCCT
GCTTCCTGGAGGGCCCTGCACCCACGCCCCCTTCGGGCCTCAGCTACAGCGGCAGCTTCTTCAT
CCAGGCGGTTCCCGAACACCCGCACGACCCGGAGGCCCTCTTCAACCTCATGTCTGGCATCTTG
GGCTTGGCACCCTTCCCTAGCCCCGAGGCGGCAGCGTCTCGGTCCCCCCTGGATGTCCCTTTCC
CCGCGGGTCCCGATGCCTTGTTGCCGGACCTTTACTCCCCGGATCTGAGTTCGGCCGCCTTCCC
GGAGGCGTTTTGGGAGGCCGCGCCTTCGGCGGGCGCTCCCTCGCAGTGCCTGTTCGAGCCCCAG
CTCTCCCCGCCCGACGTCAAGCCCGGGCTGAGGGCGCCTCCCGCTTCGCCAGCGCTGGACGCTG
CTGCTTCGGCCTTCAAAGGGCCCTACGCCCCCTGGGAGCTGCTGTCGGCCGGGGCTCCGGGGAA
CTGTGGGTCGCAGGGAAGCTTCCAGACCACCCCGGAGGCACGCTTTTCCGCCGTGGGGACCAAG
GTCGAGGACCTGCTGTCCATCAGCTGCCCCGCCGAGCTGCCCGGTCCGGCTAGCAGACTCTACC
CGCCAGGGGCCTACGATGCCTTCTCGCTGGCCCCAGGTGACTTAGGGGAGGGGACCGAGGGCCT
CCCGGCGCTGCTGACCCCTCCGGGCGGGGAGGGAGGGAGCGGCGGCGAAGGCGGAGAGTTCCTG
GCCGTCCCTCAAGCGCAGCTGTCCCCGCTGGGCCTGCGCGGCGCCGCCACGGCAGACTTCTCCA
AAGCCCTGGTGGCCGACCTCCCGGGGGGCAGCGGAGTGGCGGCGCCTTCATCCCCCGCCACCTC
CTTCCCCGCGGCCAAAGCCCGGCGCAAGGGACGCCGGGGCGGCAAGTGCAGCGCGCGCTGCTTC
TGCCCGCGGCCGCACGTCAAGGCCTTCGCCTGCCCCGTGGAGAGCTGCGTGCGGACGTTCGCGC
GCTCCGACGAGCTCAACCGCCACCTGCGCATCCACACGGGCCACAAGCCCTTCCAGTGCCGCAT
CTGCCTGCGCAACTTCAGCCGCAGCGACCACCTCACCACGCACGTGCGCACCCACACCGGCGAG
AAGCCCTTCGCCTGCGACGTGTGCGGCCGCCGCTTCGCGCGCAGCGACGAGAAGAAGCGACACA
GCAAGGTGCACCTCAAGCAGAAGGCGCGCGCCGAGGAGCGCCTCAAGGGCCTGGGCTTCTACTC
GCTGGGCCTCTCTTTCGCCGCGCTGTAGCCGGAGCTGGCTCCGTAGGTCGGCGCCGCCGGCCGT
CGGCGCACGCGACACGGTCCTGCCGCTCCCTCGTCCCTGCTGCCTTCCCTGCCTCTTCCACGCA
CGTCCGGGGCCACCCGCAGCCCAGCTCCAGTTCCCCCGAAGCGCCCGCCGCTCACGCCCTTCAG
CACGGGCTCCGCGGACAGCGCCCGCTGTTTTCGGAGCCGCCTTCCTCTAGCCACCCGCTCTGGG
GACTGTCCTCTCGGTCCACCCACAGAGCAGGCGATACCTTAGGACTGAAGAGAGTTTTTGTAAC
TGGCGTACGCCCCACGCCTTCCTCTTTATCCCTTCCCAGAGTCAAGCTGGGGATGTACCGAGCC
GGTCTCTCAAGAACTTTGTACAGCAAGTCCAGCAAGCCTTTGGATGTGATGTCTTTGCTTTGGG
GTTATTTCCTTTTTGTTGTCGTTCATTTTTTGTAAAGCAGACGCTACTCTCAAGCATTTGACAA
AACTGTTTATTTTTGCAATTAAAATTATTGTGC

hide sequence

Protein Sequences


Protein RefSeqs	NP_062010	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAA41698	(Get FASTA)	NCBI Sequence Viewer
	AAA41699	(Get FASTA)	NCBI Sequence Viewer
	EDL91196	(Get FASTA)	NCBI Sequence Viewer
	Q00911	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_062010 ⟸ NM_019137

- UniProtKB:

Q00911 (UniProtKB/Swiss-Prot), A6IAS8 (UniProtKB/TrEMBL), G3V7Z9 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MLHLSDFSGPDALLSKPTEGCAHTSPELPRLPARDAPSAAAYPGGDFLSWALSTCGAGGDLTDS
CFLEGPAPTPPSGLSYSGSFFIQAVPEHPHDPEALFNLMSGILGLAPFPSPEAAASRSPLDVPF
PAGPDALLPDLYSPDLSSAAFPEAFWEAAPSAGAPSQCLFEPQLSPPDVKPGLRAPPASPALDA
AASAFKGPYAPWELLSAGAPGNCGSQGSFQTTPEARFSAVGTKVEDLLSISCPAELPGPASRLY
PPGAYDAFSLAPGDLGEGTEGLPALLTPPGGEGGSGGEGGEFLAVPQAQLSPLGLRGAATADFS
KALVADLPGGSGVAAPSSPATSFPAAKARRKGRRGGKCSARCFCPRPHVKAFACPVESCVRTFA
RSDELNRHLRIHTGHKPFQCRICLRNFSRSDHLTTHVRTHTGEKPFACDVCGRRFARSDEKKRH
SKVHLKQKARAEERLKGLGFYSLGLSFAAL

hide sequence

Ensembl Acc Id:

ENSRNOP00000021097 ⟸ ENSRNOT00000021097

Protein Domains

C2H2-type

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q00911-F1-model_v2	AlphaFold	Q00911	1-478	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:2546	AgrOrtholog
BioCyc Gene	G2FUF-43938	BioCyc
Ensembl Genes	ENSRNOG00000015719	Ensembl
Gene3D-CATH	Classic Zinc Finger	UniProtKB/Swiss-Prot
InterPro	Znf_C2H2_sf	UniProtKB/Swiss-Prot
	Znf_C2H2_type	UniProtKB/Swiss-Prot
KEGG Report	rno:25129	UniProtKB/Swiss-Prot
NCBI Gene	25129	ENTREZGENE
PANTHER	EARLY GROWTH RESPONSE PROTEIN 4	UniProtKB/Swiss-Prot
	KRUEPPEL-LIKE TRANSCRIPTION FACTOR	UniProtKB/Swiss-Prot
Pfam	zf-C2H2	UniProtKB/Swiss-Prot
PhenoGen	Egr4	PhenoGen
PROSITE	ZINC_FINGER_C2H2_1	UniProtKB/Swiss-Prot
	ZINC_FINGER_C2H2_2	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000015719	RatGTEx
SMART	ZnF_C2H2	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF57667	UniProtKB/Swiss-Prot
TIGR	TC219481
UniProt	A6IAS8	ENTREZGENE, UniProtKB/TrEMBL
	EGR4_RAT	UniProtKB/Swiss-Prot
	G3V7Z9	ENTREZGENE, UniProtKB/TrEMBL
	Q00911	ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2001-06-26	Egr4	early growth response 4			Symbol and Name updated to reflect Human and Mouse nomenclature	67952	APPROVED
2001-06-26	Egr4l1	Zinc-finger transcription factor NGFI-C (early response gene)			Symbol and Name withdrawn	67952	WITHDRAWN

RGD Curation Notes

Note Type	Note	Reference
gene_disease	expression in brain increases after Metrazol-induced seizure	728433
gene_product	member of the GCGGGGGCG (GSG) element-binding protein family	728433

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message