Symbol:
Lce1m
Name:
late cornified envelope 1M
RGD ID:
1588875
Description:
Predicted to enable identical protein binding activity. Predicted to be involved in keratinization; INTERACTS WITH 6-propyl-2-thiouracil; endosulfan; 2-hydroxypropanoic acid (ortholog).
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
hypothetical protein LOC688413; LOC688413
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 2 181,333,098 - 181,334,300 (-) NCBI GRCr8 mRatBN7.2 2 178,637,495 - 178,638,697 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 2 178,637,495 - 178,638,697 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHRSP_BbbUtx_1.0 2 184,187,027 - 184,188,214 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 Rnor_6.0 2 193,333,799 - 193,336,789 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 2 193,333,800 - 193,335,002 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 2 211,534,988 - 211,536,190 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 2 186,053,050 - 186,054,252 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 2 171,622,444 - 171,623,646 (+) NCBI Celera Cytogenetic Map 2 q34 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Lce1m (Rattus norvegicus - Norway rat)
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 2 181,333,098 - 181,334,300 (-) NCBI GRCr8 mRatBN7.2 2 178,637,495 - 178,638,697 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 2 178,637,495 - 178,638,697 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHRSP_BbbUtx_1.0 2 184,187,027 - 184,188,214 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 Rnor_6.0 2 193,333,799 - 193,336,789 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 2 193,333,800 - 193,335,002 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 2 211,534,988 - 211,536,190 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 2 186,053,050 - 186,054,252 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 2 171,622,444 - 171,623,646 (+) NCBI Celera Cytogenetic Map 2 q34 NCBI
LCE5A (Homo sapiens - human)
Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 1 152,510,803 - 152,512,177 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 1 152,510,803 - 152,512,177 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 1 152,483,279 - 152,484,653 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 1 150,749,944 - 150,751,277 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 1 149,296,392 - 149,297,725 NCBI Celera 1 125,594,141 - 125,595,474 (+) NCBI Celera Cytogenetic Map 1 q21.3 NCBI HuRef 1 123,856,808 - 123,858,141 (+) NCBI HuRef CHM1_1 1 153,878,669 - 153,880,002 (+) NCBI CHM1_1 T2T-CHM13v2.0 1 151,647,352 - 151,648,726 (+) NCBI T2T-CHM13v2.0
Lce1m (Mus musculus - house mouse)
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 3 92,925,114 - 92,926,368 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 3 92,925,117 - 92,926,367 (-) Ensembl GRCm39 Ensembl GRCm38 3 93,017,807 - 93,019,061 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 3 93,017,810 - 93,019,060 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 3 92,821,729 - 92,822,982 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 3 93,103,213 - 93,104,463 (-) NCBI MGSCv36 mm8 Celera 3 94,059,933 - 94,061,186 (+) NCBI Celera Cytogenetic Map 3 F1 NCBI cM Map 3 40.14 NCBI
.
Predicted Target Of
Count of predictions: 33 Count of miRNA genes: 30 Interacting mature miRNAs: 33 Transcripts: ENSRNOT00000012691 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1578648 Bss11 Bone structure and strength QTL 11 4.7 femur morphology trait (VT:0000559) femoral neck cortical cross-sectional area (CMO:0001702) 2 114837527 211674221 Rat 1358356 Srcrt1 Stress Responsive Cort QTL1 3.66 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 2 161699179 222436696 Rat 1331734 Bp204 Blood pressure QTL 204 3.61192 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 168358098 223265385 Rat 1298074 Bp164 Blood pressure QTL 164 0.003 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 42804607 202447032 Rat 1354648 Bp239 Blood pressure QTL 239 0.001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 66118463 226797303 Rat 1354649 Kidm17 Kidney mass QTL 17 2.9 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 2 81754530 227146641 Rat 10755499 Bp389 Blood pressure QTL 389 2.61 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 2 18960362 228801039 Rat 1298076 Bp166 Blood pressure QTL 166 0.0009 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 136445150 202447032 Rat 152025245 Scl81 Serum cholesterol level QTL 81 3.49 blood cholesterol amount (VT:0000180) 2 122609194 206936711 Rat 70162 Bp63 Blood pressure QTL 63 5.64 arterial blood pressure trait (VT:2000000) blood pressure measurement (CMO:0000003) 2 169745596 214745596 Rat 1554319 Bmd2 Bone mineral density QTL 2 13.4 0.0001 lumbar vertebra area (VT:0010570) lumbar vertebra cross-sectional area (CMO:0001689) 2 114837675 212549332 Rat 12879836 Kidm61 Kidney mass QTL 61 0.001 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 2 152413072 185122374 Rat 1581569 Uae32 Urinary albumin excretion QTL 32 0.0001 urine protein amount (VT:0005160) urine albumin excretion rate (CMO:0000757) 2 78665619 219826953 Rat 10043136 Iddm54 Insulin dependent diabetes mellitus QTL 54 3.4 0.0001 blood glucose amount (VT:0000188) age at onset/diagnosis of type 1 diabetes mellitus (CMO:0001140) 2 143657411 190602963 Rat 12879837 Am2 Aortic mass QTL 2 0.001 aorta mass (VT:0002845) aorta weight to aorta length to body weight ratio (CMO:0002722) 2 152413072 185122374 Rat 12879838 Cm86 Cardiac mass QTL 86 0.002 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 2 152413072 185122374 Rat 1302793 Bw16 Body weight QTL 16 5 0.0001 body mass (VT:0001259) body weight (CMO:0000012) 2 157142209 202446871 Rat 61467 Bp14 Blood pressure QTL 14 2.2 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 43154682 202446871 Rat 12879839 Cm85 Cardiac mass QTL 85 0.001 heart mass (VT:0007028) heart wet weight to body weight ratio (CMO:0002408) 2 152413072 185122374 Rat 61469 Bp16 Blood pressure QTL 16 5.64 arterial blood pressure trait (VT:2000000) blood pressure measurement (CMO:0000003) 2 169745596 214745596 Rat 70175 BpQTLCluster3 Blood pressure QTL cluster 3 4.128 arterial blood pressure trait (VT:2000000) absolute change in systolic blood pressure (CMO:0000607) 2 135552573 202446871 Rat 1549833 Bp257 Blood pressure QTL 257 0.003 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 168354880 185122374 Rat 1358900 Bw48 Body weight QTL 48 4.88 body mass (VT:0001259) body weight (CMO:0000012) 2 157142078 211086598 Rat 1359030 Bp277 Blood pressure QTL 277 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 2 114837527 185876470 Rat 1331760 Bp206 Blood pressure QTL 206 3.62454 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 56043031 202447032 Rat 12879840 Bw179 Body weight QTL 179 0.005 body mass (VT:0001259) body weight (CMO:0000012) 2 152413072 185122374 Rat 1581502 Esta3 Estrogen-induced thymic atrophy QTL 3 thymus mass (VT:0004954) thymus wet weight (CMO:0000855) 2 136916935 189599348 Rat 1359032 Hrtrt18 Heart rate QTL 18 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 2 157142078 192625452 Rat 2301966 Bp322 Blood pressure QTL 322 3.58 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 150540301 202447032 Rat 1298080 Bp163 Blood pressure QTL 163 0.02 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 66118275 202447032 Rat 8662832 Vetf7 Vascular elastic tissue fragility QTL 7 3.5 aorta elastin amount (VT:0003905) aorta wall extracellular elastin dry weight to aorta wall dry weight ratio (CMO:0002002) 2 81689826 221035911 Rat 1298085 Bp165 Blood pressure QTL 165 0.0006 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 42804607 202447032 Rat 1359022 Ppulsi1 Prepulse inhibition QTL 1 3.63 prepulse inhibition trait (VT:0003088) acoustic startle response measurement (CMO:0001519) 2 136916935 213594495 Rat 1641891 Alcrsp17 Alcohol response QTL 17 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 2 149559561 249053267 Rat 724534 Uae6 Urinary albumin excretion QTL 6 10 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 2 78665619 249053267 Rat 61374 Edpm2 Estrogen-dependent pituitary mass QTL 2 4.42 0.86 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 2 76539322 202447032 Rat 8662843 Vetf9 Vascular elastic tissue fragility QTL 9 2.05 thoracic aorta molecular composition trait (VT:0010568) aorta wall extracellular elastin dry weight to aorta wall extracellular collagen weight ratio (CMO:0002003) 2 157142078 226277316 Rat 631501 Bp101 Blood pressure QTL 101 2.4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 150341684 202446871 Rat 2307174 Activ3 Activity QTL 3 4.83 0.000058 locomotor behavior trait (VT:0001392) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 2 168594495 213594495 Rat 1331794 Bp202 Blood pressure QTL 202 3.66819 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 141194931 223265385 Rat 71113 Cari2 Carrageenan-induced inflammation QTL 2 2.7 0.009 hypodermis integrity trait (VT:0010550) inflammatory exudate volume (CMO:0001429) 2 141596551 202447032 Rat 1331805 Cm29 Cardiac mass QTL 29 3.50746 heart mass (VT:0007028) heart wet weight (CMO:0000069) 2 141194931 223265385 Rat 634308 Sach6 Saccharin preference QTL 6 4.9 taste sensitivity trait (VT:0001986) saccharin intake volume to total fluid intake volume ratio (CMO:0001601) 2 112456140 212696837 Rat 1598805 Memor8 Memory QTL 8 3 exploratory behavior trait (VT:0010471) average horizontal distance between subject and target during voluntary locomotion in an experimental apparatus (CMO:0002674) 2 150341585 189039377 Rat 1358917 Cm42 Cardiac mass QTL 42 2.82 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 2 25413423 203928301 Rat 724568 Uae13 Urinary albumin excretion QTL 13 4.4 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 2 143157029 210020885 Rat 1358913 Cm41 Cardiac mass QTL 41 2.73 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 2 25413423 203928301 Rat 1300165 Rf9 Renal function QTL 9 3.28 kidney glomerulus integrity trait (VT:0010546) index of glomerular damage (CMO:0001135) 2 133914684 202447032 Rat 61401 Niddm2 Non-insulin dependent diabetes mellitus QTL 2 4.54 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 2 144599348 189599348 Rat 631507 Bp105 Blood pressure QTL 105 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 112456140 212696837 Rat 1641925 Alcrsp2 Alcohol response QTL 2 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 2 149559561 221167075 Rat 1354609 Niddm62 Non-insulin dependent diabetes mellitus QTL 62 4.72 0.000006 insulin secretion trait (VT:0003564) plasma insulin level (CMO:0000342) 2 150540301 202447032 Rat 1598833 Bp295 Blood pressure QTL 295 3.5 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 147798556 192798556 Rat 1354622 Kidm16 Kidney mass QTL 16 3 kidney mass (VT:0002707) left kidney wet weight (CMO:0000083) 2 81754530 222436696 Rat 631266 Bp132 Blood pressure QTL 132 0.0005 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 46123260 202447032 Rat 631522 Bp74 Blood pressure QTL 74 0.05 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 172710921 184114403 Rat 7488927 Bp365 Blood pressure QTL 365 0.008 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 162765032 207765032 Rat 1598838 Bp290 Blood pressure QTL 290 1.9 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 166539266 211539266 Rat 7488925 Bp364 Blood pressure QTL 364 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 160564068 205564068 Rat 2293843 Kiddil6 Kidney dilation QTL 6 3.1 kidney pelvis morphology trait (VT:0004194) hydronephrosis severity score (CMO:0001208) 2 42804607 182042367 Rat 2306901 Bp337 Blood pressure QTL 337 0.01 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 164073756 227146641 Rat 1354605 Rf48 Renal function QTL 48 2.9 blood creatinine amount (VT:0005328) plasma creatinine level (CMO:0000537) 2 74786664 206665859 Rat 6903312 Bw112 Body weight QTL 112 3.2 0.0013 body mass (VT:0001259) body weight (CMO:0000012) 2 143657569 184114274 Rat 1354601 Slep1 Serum leptin concentration QTL 1 5.39 blood leptin amount (VT:0005667) serum leptin level (CMO:0000780) 2 43171017 184114403 Rat 2293084 Iddm26 Insulin dependent diabetes mellitus QTL 26 2.9 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 2 174930955 213594495 Rat
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
6
2
6
24
26
28
6
10
6
6
42
28
12
28
22
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000012691 ⟹ ENSRNOP00000012692
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 2 178,637,495 - 178,638,697 (-) Ensembl Rnor_6.0 Ensembl 2 193,333,800 - 193,335,002 (-) Ensembl
RefSeq Acc Id:
NM_001109500 ⟹ NP_001102970
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 181,333,098 - 181,334,300 (-) NCBI mRatBN7.2 2 178,637,495 - 178,638,697 (-) NCBI Rnor_6.0 2 193,333,800 - 193,335,002 (-) NCBI Rnor_5.0 2 211,534,988 - 211,536,190 (+) NCBI RGSC_v3.4 2 186,053,050 - 186,054,252 (-) RGD Celera 2 171,622,444 - 171,623,646 (+) RGD
Sequence:
CACTCCATTACTTGCTGAGTGATCTACTCCTGTGCCTGAGGCAGTTCCTTTTGAGATGTCGTGCCAGCAGAGCCAGCAACAGTGCCAGCCCCCTCCCAAATGCAAGATCCCAAAGTGCCCTCCTTCTT CTTGCTGTAGCCTGGGTTCTGGGGGCTGCTGTGGCTCCAGTTCTGGGGGCTGCTGCAGCTCTGGGGGTGGCAGCTGCTGCCTGAGCCACCACAAGCCCCGATTCTCTCTCCGTCGCCGACGTCACAGC TCTGGATGCTGTAGCAGTGGTGGCAGCAGCTGCTGTGGCAGCAGCGGTGGCAGCAGCGGTGGCAGCAGCTGCTGTGGCAGCAGCGGTGGCAGCAGCAGTGGCAGCAGCTGCTGTGGCAGCAGCGGTGG CAGCAGCTGCTGTGGCAGCAGCGGTGGCAGCAGCGGTGGCAGCAGTTGCTGTGGTAGCAGTGGTGGTAGCAGTGGTGGCAGCAGTAGTGGCTGCTGTGGCAGCAGCGGTGGCAGCAGTGGTGGCAGCA GCAGCCATCAGCAGTCTGGAGGCTCTAGCTGCTGCTCTGGAGGTTGCTGCTGACCTGGAGATGAAGAACATGGAAAGTAGCATTGGCCGAAGACCTGCCAGCAGAGGGTCCCCCTCTTCTCTGGGTTT CCTGCAGAAATACTTCTAGAACTCTATGTATGCCCTTCTTCATCTCCCTAAAGCTCATCTACCGTGAGGTACTGAGATCTCAGCTCTGAGATTCATTGGCTTTGTTATTTTTCTGACACAACTTACTG TTTGAAAAGAGTTTCAGCTTTGAAGCTTGTTTCTGGGCAATAATAAAGCTTTTGATTCCTG
hide sequence
RefSeq Acc Id:
NP_001102970 ⟸ NM_001109500
- UniProtKB:
D3ZG26 (UniProtKB/TrEMBL), A6KMN4 (UniProtKB/TrEMBL)
- Sequence:
MSCQQSQQQCQPPPKCKIPKCPPSSCCSLGSGGCCGSSSGGCCSSGGGSCCLSHHKPRFSLRRRRHSSGCCSSGGSSCCGSSGGSSGGSSCCGSSGGSSSGSSCCGSSGGSSCCGSSGGSSGGSSCCG SSGGSSGGSSSGCCGSSGGSSGGSSSHQQSGGSSCCSGGCC
hide sequence
Ensembl Acc Id:
ENSRNOP00000012692 ⟸ ENSRNOT00000012691
RGD ID: 13691517
Promoter ID: EPDNEW_R2042
Type: single initiation site
Name: Lce1m_1
Description: late cornified envelope 1M
SO ACC ID: SO:0000170
Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ )
Experiment Methods: Single-end sequencing.
Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 2 193,335,001 - 193,335,061 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2008-04-30
Lce1m
late cornified envelope 1M
Lce1m_predicted
late cornified envelope 1M (predicted)
'predicted' is removed
2292626
APPROVED
2008-01-09
Lce1m_predicted
late cornified envelope 1M (predicted)
LOC679245
hypothetical protein LOC679245
Data merged from RGD:1590713
1643240
APPROVED
2007-04-11
Lce1m_predicted
late cornified envelope 1M (predicted)
LOC688413
hypothetical protein LOC688413
Symbol and Name updated to reflect Human and Mouse nomenclature
1299863
APPROVED
2006-11-20
LOC679245
hypothetical protein LOC679245
Symbol and Name status set to provisional
70820
PROVISIONAL
2006-11-19
LOC688413
hypothetical protein LOC688413
Symbol and Name status set to provisional
70820
PROVISIONAL