Advanced Search (OLGA)

Gene: Gstm5l (glutathione S-transferase, mu 5-like) Rattus norvegicus

Analyze

Symbol:

Gstm5l

Name:

glutathione S-transferase, mu 5-like

RGD ID:

1311731

Description:

Predicted to enable glutathione transferase activity and identical protein binding activity. Predicted to be involved in glutathione metabolic process. Predicted to be located in cytosol and intercellular bridge. Human ortholog(s) of this gene implicated in several diseases, including autoimmune disease (multiple); eye disease (multiple); gastrointestinal system cancer (multiple); hematologic cancer (multiple); and lung disease (multiple). Orthologous to human GSTM1 (glutathione S-transferase mu 1); PARTICIPATES IN glutathione conjugation pathway; INTERACTS WITH 1-chloro-2,4-dinitrobenzene; 1-naphthyl isothiocyanate; 17alpha-ethynylestradiol.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

glutathione S-transferase M6-like; glutathione S-transferase, mu 6; glutathione S-transferase, mu 6-like; Gstm6; Gstm6l; LOC295362

RGD Orthologs

Human

Bonobo

Green Monkey

Alliance Orthologs

More Info

more info ...

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	2	198,231,285 - 198,238,122 (-)	NCBI		GRCr8
mRatBN7.2	2	195,544,424 - 195,549,895 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	195,544,426 - 195,628,961 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	2	203,186,781 - 203,191,887 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	2	201,068,896 - 201,074,002 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	2	195,885,851 - 195,890,957 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	2	210,698,155 - 210,703,265 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	210,698,155 - 210,703,606 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	2	230,167,122 - 230,172,232 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	2	203,468,919 - 203,474,026 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	2	203,432,058 - 203,437,251 (-)	NCBI
Celera	2	188,190,852 - 188,195,959 (-)	NCBI		Celera
Cytogenetic Map	2	q34	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

autism spectrum disorder (ISO)

autistic disorder (ISO)

Colonic Neoplasms (ISO)

hereditary spastic paraplegia 63 (ISO)

neurodegenerative disease (ISO)

uterine fibroid (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-catechin (ISO)

1-chloro-2,4-dinitrobenzene (EXP)

1-naphthyl isothiocyanate (EXP)

17alpha-ethynylestradiol (EXP)

17beta-estradiol (EXP)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4-dinitrotoluene (EXP)

2,5-hexanedione (EXP)

2,6-dinitrotoluene (EXP)

3,3',4,4',5-pentachlorobiphenyl (EXP)

3-chloropropane-1,2-diol (EXP)

4,4'-diaminodiphenylmethane (EXP)

5-aza-2'-deoxycytidine (ISO)

6-propyl-2-thiouracil (EXP)

8'-apo-beta,psi-caroten-8'-al (ISO)

Aflatoxin B2 alpha (ISO)

amitrole (EXP)

ammonium chloride (EXP)

arsenous acid (ISO)

atrazine (EXP)

benzo[a]pyrene (ISO)

beta-carotene (ISO)

bexarotene (EXP)

bis(2-ethylhexyl) phthalate (EXP)

bisphenol A (EXP,ISO)

C60 fullerene (EXP)

cadmium atom (ISO)

cadmium dichloride (EXP)

chlorpyrifos (EXP)

copper atom (EXP)

copper(0) (EXP)

Cuprizon (EXP)

dexamethasone (EXP)

diarsenic trioxide (ISO)

diazinon (EXP)

diuron (EXP)

ethylparaben (ISO)

fonofos (ISO)

furan (EXP)

genistein (EXP)

glutathione (EXP)

Licochalcone B (ISO)

limonene (EXP)

lithium atom (EXP)

lithium hydride (EXP)

methimazole (EXP)

N-nitrosodiethylamine (EXP)

N-nitrosomorpholine (EXP)

nickel atom (EXP,ISO)

oxaliplatin (EXP)

paclitaxel (ISO)

parathion (ISO)

phenobarbital (EXP)

PhIP (EXP)

pirinixic acid (EXP)

pregnenolone 16alpha-carbonitrile (EXP)

propiconazole (EXP)

quercetin (ISO)

sarin (ISO)

sodium arsenite (ISO)

streptozocin (EXP)

sulfadimethoxine (EXP)

terbufos (ISO)

testosterone (EXP)

tetrachloromethane (EXP)

thioacetamide (EXP)

topotecan (EXP)

vanadyl sulfate (EXP)

vinclozolin (EXP)

vitamin E (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

biological_process (ND)

glutathione metabolic process (ISO)

Cellular Component

cytoplasm (IEA)

cytosol (ISO)

intercellular bridge (ISO)

Molecular Function

glutathione transferase activity (ISO)

identical protein binding (ISO)

protein binding (ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

glutathione conjugation pathway (ISS)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	GOA pipeline	RGD automated data pipeline
3.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
4.	Comprehensive gene review and curation	RGD comprehensive gene curation
5.	The role of glutathione-S-transferase in anti-cancer drug resistance.	Townsend DM and Tew KD, Oncogene 2003 Oct 20;22(47):7369-75.

Additional References at PubMed

PMID:16549767

Genomics

Comparative Map Data

Gstm5l
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	2	198,231,285 - 198,238,122 (-)	NCBI		GRCr8
mRatBN7.2	2	195,544,424 - 195,549,895 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	195,544,426 - 195,628,961 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	2	203,186,781 - 203,191,887 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	2	201,068,896 - 201,074,002 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	2	195,885,851 - 195,890,957 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	2	210,698,155 - 210,703,265 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	210,698,155 - 210,703,606 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	2	230,167,122 - 230,172,232 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	2	203,468,919 - 203,474,026 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	2	203,432,058 - 203,437,251 (-)	NCBI
Celera	2	188,190,852 - 188,195,959 (-)	NCBI		Celera
Cytogenetic Map	2	q34	NCBI

GSTM5
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	1	109,711,751 - 109,718,268 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	1	109,711,780 - 109,775,428 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	1	110,254,873 - 110,260,890 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	1	110,056,388 - 110,062,411 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	1	109,966,906 - 109,972,930	NCBI
Celera	1	108,501,476 - 108,507,502 (+)	NCBI		Celera
Cytogenetic Map	1	p13.3	NCBI
HuRef	1	108,124,716 - 108,130,653 (+)	NCBI		HuRef
CHM1_1	1	110,369,701 - 110,375,727 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	1	109,721,793 - 109,728,310 (+)	NCBI		T2T-CHM13v2.0

GSTM5
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	1	117,328,062 - 117,333,618 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	1	116,476,088 - 116,481,644 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	1	112,356,184 - 112,361,731 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	1	127,979,664 - 127,985,219 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	1	127,979,238 - 128,010,411 (-)	Ensembl	panpan1.1		panPan2

LOC103224277
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	20	23,839,722 - 23,845,771 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666038	34,568,170 - 34,619,723 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Variants

Variants in Gstm5l
39 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	52
Count of miRNA genes:	49
Interacting mature miRNAs:	50
Transcripts:	ENSRNOT00000055918
Prediction methods:	Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1578648	Bss11	Bone structure and strength QTL 11	4.7		femur morphology trait (VT:0000559)	femoral neck cortical cross-sectional area (CMO:0001702)	2	114837527	211674221	Rat
1358356	Srcrt1	Stress Responsive Cort QTL1	3.66		blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	2	161699179	222436696	Rat
1331734	Bp204	Blood pressure QTL 204	3.61192		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	168358098	223265385	Rat
1298074	Bp164	Blood pressure QTL 164		0.003	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	42804607	202447032	Rat
1354648	Bp239	Blood pressure QTL 239		0.001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	66118463	226797303	Rat
1354649	Kidm17	Kidney mass QTL 17	2.9		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	2	81754530	227146641	Rat
10755499	Bp389	Blood pressure QTL 389	2.61		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	18960362	228801039	Rat
1298076	Bp166	Blood pressure QTL 166		0.0009	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	136445150	202447032	Rat
152025245	Scl81	Serum cholesterol level QTL 81	3.49		blood cholesterol amount (VT:0000180)		2	122609194	206936711	Rat
61458	Bp10	Blood pressure QTL 10	3.42		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	189020722	215287351	Rat
70162	Bp63	Blood pressure QTL 63	5.64		arterial blood pressure trait (VT:2000000)	blood pressure measurement (CMO:0000003)	2	169745596	214745596	Rat
1554319	Bmd2	Bone mineral density QTL 2	13.4	0.0001	lumbar vertebra area (VT:0010570)	lumbar vertebra cross-sectional area (CMO:0001689)	2	114837675	212549332	Rat
1581569	Uae32	Urinary albumin excretion QTL 32		0.0001	urine protein amount (VT:0005160)	urine albumin excretion rate (CMO:0000757)	2	78665619	219826953	Rat
1302793	Bw16	Body weight QTL 16	5	0.0001	body mass (VT:0001259)	body weight (CMO:0000012)	2	157142209	202446871	Rat
61467	Bp14	Blood pressure QTL 14	2.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	43154682	202446871	Rat
2317752	Glom23	Glomerulus QTL 23	3.6		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	2	193452645	245889826	Rat
61469	Bp16	Blood pressure QTL 16	5.64		arterial blood pressure trait (VT:2000000)	blood pressure measurement (CMO:0000003)	2	169745596	214745596	Rat
70175	BpQTLCluster3	Blood pressure QTL cluster 3	4.128		arterial blood pressure trait (VT:2000000)	absolute change in systolic blood pressure (CMO:0000607)	2	135552573	202446871	Rat
1358900	Bw48	Body weight QTL 48	4.88		body mass (VT:0001259)	body weight (CMO:0000012)	2	157142078	211086598	Rat
4889834	Pur24	Proteinuria QTL 24	5.8	0.014	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	2	184114274	202447032	Rat
1359031	Bp275	Blood pressure QTL 275			arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	185876309	219753474	Rat
1581499	Esta2	Estrogen-induced thymic atrophy QTL 2			thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	2	189599258	226936289	Rat
1331760	Bp206	Blood pressure QTL 206	3.62454		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	56043031	202447032	Rat
9589044	Scfw1	Subcutaneous fat weight QTL 1	5.8	0.001	subcutaneous adipose mass (VT:1000472)	abdominal subcutaneous fat pad weight (CMO:0002069)	2	182171407	227171407	Rat
8694435	Bw166	Body weight QTL 166	14.08	0.001	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	2	182171407	227171407	Rat
2301966	Bp322	Blood pressure QTL 322	3.58		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	150540301	202447032	Rat
1298083	Bp158	Blood pressure QTL 158	2.62		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	189020722	215287351	Rat
1298080	Bp163	Blood pressure QTL 163		0.02	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	66118275	202447032	Rat
8662832	Vetf7	Vascular elastic tissue fragility QTL 7	3.5		aorta elastin amount (VT:0003905)	aorta wall extracellular elastin dry weight to aorta wall dry weight ratio (CMO:0002002)	2	81689826	221035911	Rat
1331745	Bp203	Blood pressure QTL 203	4.377		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	189599258	218414891	Rat
1298085	Bp165	Blood pressure QTL 165		0.0006	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	42804607	202447032	Rat
8694194	Abfw1	Abdominal fat weight QTL 1	11.7	0.001	visceral adipose mass (VT:0010063)	abdominal fat pad weight to body weight ratio (CMO:0000095)	2	182171407	227171407	Rat
61366	Iddm3	Insulin dependent diabetes mellitus QTL 3	4.7		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	2	189599258	234599258	Rat
1359022	Ppulsi1	Prepulse inhibition QTL 1	3.63		prepulse inhibition trait (VT:0003088)	acoustic startle response measurement (CMO:0001519)	2	136916935	213594495	Rat
1641891	Alcrsp17	Alcohol response QTL 17			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	2	149559561	249053267	Rat
724534	Uae6	Urinary albumin excretion QTL 6	10		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	2	78665619	249053267	Rat
61374	Edpm2	Estrogen-dependent pituitary mass QTL 2	4.42	0.86	pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	2	76539322	202447032	Rat
2300189	Bmd48	Bone mineral density QTL 48	5.8	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	2	179335906	224335906	Rat
8662843	Vetf9	Vascular elastic tissue fragility QTL 9	2.05		thoracic aorta molecular composition trait (VT:0010568)	aorta wall extracellular elastin dry weight to aorta wall extracellular collagen weight ratio (CMO:0002003)	2	157142078	226277316	Rat
2301408	Kidm36	Kidney mass QTL 36		0.002	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	190613715	226808892	Rat
631501	Bp101	Blood pressure QTL 101	2.4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	150341684	202446871	Rat
2307174	Activ3	Activity QTL 3	4.83	0.000058	locomotor behavior trait (VT:0001392)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	2	168594495	213594495	Rat
1331794	Bp202	Blood pressure QTL 202	3.66819		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	141194931	223265385	Rat
71113	Cari2	Carrageenan-induced inflammation QTL 2	2.7	0.009	hypodermis integrity trait (VT:0010550)	inflammatory exudate volume (CMO:0001429)	2	141596551	202447032	Rat
1331805	Cm29	Cardiac mass QTL 29	3.50746		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	2	141194931	223265385	Rat
634308	Sach6	Saccharin preference QTL 6	4.9		taste sensitivity trait (VT:0001986)	saccharin intake volume to total fluid intake volume ratio (CMO:0001601)	2	112456140	212696837	Rat
1358917	Cm42	Cardiac mass QTL 42	2.82		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	25413423	203928301	Rat
724568	Uae13	Urinary albumin excretion QTL 13	4.4		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	2	143157029	210020885	Rat
1358913	Cm41	Cardiac mass QTL 41	2.73		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	25413423	203928301	Rat
1300165	Rf9	Renal function QTL 9	3.28		kidney glomerulus integrity trait (VT:0010546)	index of glomerular damage (CMO:0001135)	2	133914684	202447032	Rat
738013	Alc15	Alcohol consumption QTL 15	4.1	0.00022	consumption behavior trait (VT:0002069)	ethanol drink intake rate to body weight ratio (CMO:0001616)	2	184165752	229165752	Rat
61398	Bp50	Blood pressure QTL 50	4.4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	189599258	234599258	Rat
631507	Bp105	Blood pressure QTL 105		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	112456140	212696837	Rat
1641925	Alcrsp2	Alcohol response QTL 2			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	2	149559561	221167075	Rat
1354609	Niddm62	Non-insulin dependent diabetes mellitus QTL 62	4.72	0.000006	insulin secretion trait (VT:0003564)	plasma insulin level (CMO:0000342)	2	150540301	202447032	Rat
61417	Cia10	Collagen induced arthritis QTL 10	3.4		joint integrity trait (VT:0010548)	experimental arthritis severity measurement (CMO:0001459)	2	179946951	224946951	Rat
1354622	Kidm16	Kidney mass QTL 16	3		kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	2	81754530	222436696	Rat
631266	Bp132	Blood pressure QTL 132		0.0005	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	46123260	202447032	Rat
8694383	Bw158	Body weight QTL 158	7.69	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	2	182171407	227171407	Rat
7488927	Bp365	Blood pressure QTL 365		0.008	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	162765032	207765032	Rat
1598838	Bp290	Blood pressure QTL 290	1.9		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	166539266	211539266	Rat
7488925	Bp364	Blood pressure QTL 364		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	160564068	205564068	Rat
2306901	Bp337	Blood pressure QTL 337		0.01	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	164073756	227146641	Rat
1354605	Rf48	Renal function QTL 48	2.9		blood creatinine amount (VT:0005328)	plasma creatinine level (CMO:0000537)	2	74786664	206665859	Rat
2293084	Iddm26	Insulin dependent diabetes mellitus QTL 26	2.9		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	2	174930955	213594495	Rat

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	4	9	32	34	34	17	9	17	6	90	31	20	30	59	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001106464	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039102079	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH473952	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000002	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000025746 ⟹ ENSRNOP00000025746

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	2	195,579,566 - 195,584,350 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000025939 ⟹ ENSRNOP00000025939

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	2	195,624,018 - 195,628,961 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000077563 ⟹ ENSRNOP00000070866

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	2	195,625,711 - 195,628,803 (-)	Ensembl
Rnor_6.0 Ensembl	2	210,698,697 - 210,703,606 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000080228 ⟹ ENSRNOP00000073859

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	2	195,544,426 - 195,549,959 (-)	Ensembl
Rnor_6.0 Ensembl	2	210,698,155 - 210,703,265 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000109587 ⟹ ENSRNOP00000084446

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	2	195,579,566 - 195,584,350 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000110922 ⟹ ENSRNOP00000092883

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	2	195,544,426 - 195,628,803 (-)	Ensembl

RefSeq Acc Id:

NM_001106464 ⟹ NP_001099934

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	198,232,596 - 198,237,703 (-)	NCBI
mRatBN7.2	2	195,544,426 - 195,549,533 (-)	NCBI
Rnor_6.0	2	210,698,155 - 210,703,265 (-)	NCBI
Rnor_5.0	2	230,167,122 - 230,172,232 (-)	NCBI
RGSC_v3.4	2	203,468,919 - 203,474,026 (-)	RGD
Celera	2	188,190,852 - 188,195,959 (-)	RGD

Sequence:

show sequence

TCCTAGTTGGGTCAAGCCATCCGTCTGCTCCTGGAATACACAGGTTCAAGCTATGAGGAGAAGA
GATACACCATGGGGGACGCTCCCGACTATGACAGAAGCCAGTGGCTGAGTGAGAAGTTCAAACT
GGGCCTGGACATTCCTAATCTGCCCTACTTAATCGATGGGTCACACAAGATCACCCAGAGCAAT
GCCATCCTGCGCTACCTTGGCCGGAAGCACAACCTGTGTGGAGAGACAGAAGAAGAGAGACTCC
GTGTGGACATTTTGGAGAACCAGGCCGTGGACACTCGTAGGCAGCTTTCAATGGTCTGCTACAG
CCCTGAGTTTGAGAAACGGAAGCCAGAGTACTTAGAGGGTCTCCCTGACAAGATGAAGCTCTAC
TCTGAGTTCCTGGGCAAGCAGCTATGGTTTGCAGGGAACAAGATTACCTATGTGGATTTCCTTG
TTTATGATGTCCTCGATAAGCACCGTATGTTTGAGCTCAAGTGCCTGGACGCCTTTCCAAATCT
GAAGGACTTCATGGCTCGATTTGAGACCCTTGAGAAGATCTCTGCCTACATGAAGTCCAGCCGC
TTCCTTTCAGGCCCTGTGTATTTGAAGACAGCGCTGTGGGGTAACAAGTAGAGCGCCCGTAATA
CCAGGGCCAGGAGGAGATTTACCTCTATGCTTGCGGTCCATGGTCTGGGGCCCATCTGCGTCCC
CGGGCATCTCTGTATCAGTCTTCCCACCTCCGTTCTTCTCTGAAAGGTGTTAGTGACTCCGCTT
TCTACCCAGCCTTTCTGTAAGGGGAGGTTCTCAAACTCAGGTCTAGTTCCCTAATTGGTTCTTG
ATGTGTCAATAAAGAAGGCTGGGAGCCAATTGCTGGGCGGAAGGTATAGGTGGGACTTCCGGGT
CCCAAGAGAAAAAGGAGATTCAGGGAAAGATAGAGGGGCTTTTTCTGCTGTGCTTCGGAGTAAG
AAGGTAACAGTCATGTAAGGTCTTCCGGCAGCTAGGGCCTGTGGCCTCCGCAACAGGCGGATAG
CCAAGGATGTTGGCAGGGGCTGGCTGATACAAGTCACTAAGTTTAGGGCAGAGGGAGATGGAGA
TAATAAACTGGTAAGAGCACGCCTTTCCAGGCCGTTGTTATCTGAGCCCAGCAATTGTGCCTAG
CAGGCAAATTCTAAAGT

hide sequence

RefSeq Acc Id:

XM_039102079 ⟹ XP_038958007

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	198,231,285 - 198,238,122 (-)	NCBI
mRatBN7.2	2	195,544,424 - 195,549,895 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_001099934	(Get FASTA)	NCBI Sequence Viewer
	XP_038958007	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDL81895	(Get FASTA)	NCBI Sequence Viewer
	EDL81896	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000070866.2
	ENSRNOP00000073859.2
	ENSRNOP00000084446.1
	ENSRNOP00000092883.1

RefSeq Acc Id:	NP_001099934 ⟸ NM_001106464
- UniProtKB:	A6HUV9 (UniProtKB/TrEMBL), A0A8I6AJ43 (UniProtKB/TrEMBL)
- Sequence:	show sequence MGDAPDYDRSQWLSEKFKLGLDIPNLPYLIDGSHKITQSNAILRYLGRKHNLCGETEEERLRVD ILENQAVDTRRQLSMVCYSPEFEKRKPEYLEGLPDKMKLYSEFLGKQLWFAGNKITYVDFLVYD VLDKHRMFELKCLDAFPNLKDFMARFETLEKISAYMKSSRFLSGPVYLKTALWGNK hide sequence

Ensembl Acc Id:

ENSRNOP00000073859 ⟸ ENSRNOT00000080228

Ensembl Acc Id:

ENSRNOP00000070866 ⟸ ENSRNOT00000077563

RefSeq Acc Id:	XP_038958007 ⟸ XM_039102079
- Peptide Label:	isoform X1
- UniProtKB:	A0A0G2K6L4 (UniProtKB/TrEMBL), A0A8I6AJ43 (UniProtKB/TrEMBL)

Ensembl Acc Id:

ENSRNOP00000025939 ⟸ ENSRNOT00000025939

Ensembl Acc Id:

ENSRNOP00000084446 ⟸ ENSRNOT00000109587

Ensembl Acc Id:

ENSRNOP00000025746 ⟸ ENSRNOT00000025746

Ensembl Acc Id:

ENSRNOP00000092883 ⟸ ENSRNOT00000110922

Protein Domains

GST C-terminal GST N-terminal

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-A0A0G2JZ09-F1-model_v2	AlphaFold	A0A0G2JZ09	1-215	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13691675

Promoter ID:

EPDNEW_R2190

Type:

single initiation site

Name:

Gstm6l_1

Description:

glutathione S-transferase, mu 6-like

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	2	210,703,657 - 210,703,717	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1311731	AgrOrtholog
BioCyc Gene	G2FUF-51654	BioCyc
Ensembl Genes	ENSRNOG00000060939	Ensembl, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000077563.2	UniProtKB/TrEMBL
	ENSRNOT00000080228.2	UniProtKB/TrEMBL
	ENSRNOT00000109587.1	UniProtKB/TrEMBL
	ENSRNOT00000110922.1	UniProtKB/TrEMBL
Gene3D-CATH	1.20.1050.10	UniProtKB/TrEMBL
	1.20.1050.130	UniProtKB/TrEMBL
	Glutaredoxin	UniProtKB/TrEMBL
InterPro	Glutathione-S-Trfase_C-like	UniProtKB/TrEMBL
	Glutathione-S-Trfase_C_sf	UniProtKB/TrEMBL
	Glutathione_S-Trfase	UniProtKB/TrEMBL
	Glutathione_S-Trfase_N	UniProtKB/TrEMBL
	GST_C	UniProtKB/TrEMBL
	GST_mu	UniProtKB/TrEMBL
	GST_superfamily	UniProtKB/TrEMBL
	Thioredoxin-like_sf	UniProtKB/TrEMBL
KEGG Report	rno:295362	UniProtKB/TrEMBL
NCBI Gene	295362	ENTREZGENE
PANTHER	GLUTATHIONE S-TRANSFERASE	UniProtKB/TrEMBL
	GLUTATHIONE S-TRANSFERASE MU 1	UniProtKB/TrEMBL
	GLUTATHIONE S-TRANSFERASE MU 6	UniProtKB/TrEMBL
Pfam	GST_C	UniProtKB/TrEMBL
	GST_C_3	UniProtKB/TrEMBL
	GST_N	UniProtKB/TrEMBL
PhenoGen	Gstm5l	PhenoGen
PRINTS	GSTRNSFRASEM	UniProtKB/TrEMBL
PROSITE	GST_CTER	UniProtKB/TrEMBL
	GST_NTER	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000060939	RatGTEx
Superfamily-SCOP	GST_C_like	UniProtKB/TrEMBL
	Thiordxn-like_fd	UniProtKB/TrEMBL
UniProt	A0A0G2JZ09_RAT	UniProtKB/TrEMBL
	A0A0G2K6L4	ENTREZGENE, UniProtKB/TrEMBL
	A0A8I6A1B0_RAT	UniProtKB/TrEMBL
	A0A8I6AJ43	ENTREZGENE, UniProtKB/TrEMBL
	A6HUV9	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2024-02-26	Gstm5l	glutathione S-transferase, mu 5-like	Gstm6l	glutathione S-transferase, mu 6-like	Name and Symbol changed	629549	APPROVED
2008-05-14	Gstm6l	glutathione S-transferase, mu 6-like	Gstm6_predicted	glutathione S-transferase, mu 6 (predicted)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-01-12	Gstm6_predicted	glutathione S-transferase, mu 6 (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

RGD Manual Annotations

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

RGD Manual Annotations