Advanced Search (OLGA)

Gene: Usp3 (ubiquitin specific peptidase 3) Rattus norvegicus

Analyze

Symbol:

Usp3

Name:

ubiquitin specific peptidase 3

RGD ID:

1308852

Description:

Enables RNA polymerase II cis-regulatory region sequence-specific DNA binding activity and promoter-specific chromatin binding activity. Involved in negative regulation of transcription by RNA polymerase II. Predicted to be located in several cellular components, including Flemming body; cytoplasmic ribonucleoprotein granule; and nucleoplasm. Predicted to be active in cytoplasm and nucleus. Orthologous to human USP3 (ubiquitin specific peptidase 3); PARTICIPATES IN ataxia telangiectasia-mutated (ATM) signaling pathway; histone modification pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,4-dinitrotoluene; 6-propyl-2-thiouracil.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

LOC363084; ubiquitin carboxyl-terminal hydrolase 3; ubiquitin specific protease 3; ubiquitin thiolesterase 3

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	USP3 (ubiquitin specific peptidase 3)	HGNC	Ensembl, HomoloGene, NCBI, OrthoDB
Mus musculus (house mouse):	Usp3 (ubiquitin specific peptidase 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Usp3 (ubiquitin specific peptidase 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	USP3 (ubiquitin specific peptidase 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	USP3 (ubiquitin specific peptidase 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Usp3 (ubiquitin specific peptidase 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	USP3 (ubiquitin specific peptidase 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	USP3 (ubiquitin specific peptidase 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Usp3 (ubiquitin specific peptidase 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	USP3 (ubiquitin specific peptidase 3)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Usp3 (ubiquitin specific peptidase 3)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	usp3 (ubiquitin specific peptidase 3)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	usp-3	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	usp3	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	8	75,973,278 - 76,049,151 (-)	NCBI		GRCr8
mRatBN7.2	8	67,078,249 - 67,154,109 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	8	67,079,927 - 67,154,111 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	8	72,592,343 - 72,666,625 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	8	70,865,164 - 70,939,434 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	8	68,735,501 - 68,809,701 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	8	72,207,970 - 72,284,871 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	8	72,207,972 - 72,284,873 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	8	71,875,687 - 71,951,083 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	8	70,821,429 - 70,897,119 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	8	70,840,484 - 70,916,173 (-)	NCBI
Celera	8	66,465,505 - 66,539,503 (-)	NCBI		Celera
Cytogenetic Map	8	q24	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

atrial fibrillation (ISO)

Bloom syndrome (ISO)

colorectal cancer (ISO)

hypertrophic cardiomyopathy (ISO)

nemaline myopathy 6 (ISO)

neutropenia (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dimethylhydrazine (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4-dinitrotoluene (EXP)

4,4'-sulfonyldiphenol (ISO)

4-hydroxyphenyl retinamide (ISO)

6-propyl-2-thiouracil (EXP)

aflatoxin B1 (ISO)

amitrole (EXP)

amphetamine (EXP)

antirheumatic drug (ISO)

arsenous acid (ISO)

Benoxacor (ISO)

benzene (ISO)

benzo[a]pyrene (ISO)

benzo[a]pyrene diol epoxide I (ISO)

beta-lapachone (ISO)

bisphenol A (EXP,ISO)

Bisphenol A diglycidyl ether (ISO)

cadmium atom (ISO)

cadmium dichloride (ISO)

carbon nanotube (ISO)

chloroacetaldehyde (ISO)

choline (ISO)

cidofovir anhydrous (ISO)

copper(II) sulfate (ISO)

coumestrol (ISO)

cyclosporin A (ISO)

dexamethasone (EXP)

diarsenic trioxide (ISO)

dioxygen (ISO)

elemental selenium (ISO)

Enterolactone (ISO)

ethyl methanesulfonate (ISO)

fenofibrate (EXP)

fluorescein 5-isothiocyanate (ISO)

flutamide (EXP)

folic acid (ISO)

formaldehyde (ISO)

gallic acid (ISO)

gentamycin (EXP)

ifosfamide (ISO)

isotretinoin (ISO)

L-methionine (ISO)

lipopolysaccharide (EXP)

metformin (EXP)

methimazole (EXP)

methotrexate (ISO)

methyl methanesulfonate (ISO)

nefazodone (EXP)

oxaliplatin (EXP)

ozone (ISO)

paracetamol (EXP,ISO)

pentachlorophenol (ISO)

phenobarbital (ISO)

pirinixic acid (ISO)

selenium atom (ISO)

sulfadimethoxine (EXP)

thioacetamide (EXP)

titanium dioxide (ISO)

topotecan (EXP)

trichostatin A (ISO)

triphenyl phosphate (ISO)

valproic acid (ISO)

vitamin E (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

DNA repair (ISO)

DNA repair-dependent chromatin remodeling (ISO)

negative regulation of transcription by RNA polymerase II (IDA)

protein deubiquitination (IEA)

proteolysis (IEA)

Cellular Component

chromatin (ISO)

cytoplasm (IBA)

cytoplasmic ribonucleoprotein granule (IEA,ISO)

Flemming body (IEA,ISO)

nucleoplasm (IEA,ISO)

nucleus (IBA)

Molecular Function

cysteine-type deubiquitinase activity (ISO)

histone binding (ISO)

histone H2A deubiquitinase activity (ISO)

histone H2B deubiquitinase activity (ISO)

promoter-specific chromatin binding (IDA)

RNA polymerase II cis-regulatory region sequence-specific DNA binding (IDA)

zinc ion binding (IEA)

Molecular Pathway Annotations Click to see Annotation Detail View

ataxia telangiectasia-mutated (ATM) signaling pathway (ISO)

histone modification pathway (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	H2A-DUBbing the mammalian epigenome: expanding frontiers for histone H2A deubiquitinating enzymes in cell biology and physiology.	Belle JI and Nijnik A, Int J Biochem Cell Biol. 2014 May;50:161-74. doi: 10.1016/j.biocel.2014.03.004. Epub 2014 Mar 16.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
4.	Push back to respond better: regulatory inhibition of the DNA double-strand break response.	Panier S and Durocher D, Nat Rev Mol Cell Biol. 2013 Oct;14(10):661-72. doi: 10.1038/nrm3659. Epub 2013 Sep 4.
5.	GOA pipeline	RGD automated data pipeline
6.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
7.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
8.	Identification of a short form of ubiquitin-specific protease 3 that is a repressor of rat glutathione S-transferase gene expression.	Whalen R, etal., Biochem J. 2006 Mar 1;394(Pt 2):519-26.

Additional References at PubMed

PMID:12477932	PMID:17980597	PMID:25931508

Genomics

Comparative Map Data

Usp3
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	8	75,973,278 - 76,049,151 (-)	NCBI		GRCr8
mRatBN7.2	8	67,078,249 - 67,154,109 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	8	67,079,927 - 67,154,111 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	8	72,592,343 - 72,666,625 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	8	70,865,164 - 70,939,434 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	8	68,735,501 - 68,809,701 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	8	72,207,970 - 72,284,871 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	8	72,207,972 - 72,284,873 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	8	71,875,687 - 71,951,083 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	8	70,821,429 - 70,897,119 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	8	70,840,484 - 70,916,173 (-)	NCBI
Celera	8	66,465,505 - 66,539,503 (-)	NCBI		Celera
Cytogenetic Map	8	q24	NCBI

USP3
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	15	63,504,593 - 63,594,633 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	15	63,504,511 - 63,594,640 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	15	63,796,792 - 63,886,832 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	15	61,583,863 - 61,670,716 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	15	61,583,862 - 61,670,714	NCBI
Celera	15	40,676,343 - 40,763,066 (+)	NCBI		Celera
Cytogenetic Map	15	q22.31	NCBI
HuRef	15	40,621,287 - 40,711,268 (+)	NCBI		HuRef
CHM1_1	15	63,915,941 - 64,006,065 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	15	61,311,846 - 61,401,872 (+)	NCBI		T2T-CHM13v2.0

Usp3
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	9	66,421,573 - 66,501,996 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	9	66,421,919 - 66,500,424 (-)	Ensembl		GRCm39 Ensembl
GRCm38	9	66,514,639 - 66,593,148 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	9	66,514,637 - 66,593,142 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	9	66,365,688 - 66,440,787 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	9	66,315,887 - 66,390,986 (-)	NCBI		MGSCv36	mm8
Celera	9	63,751,848 - 63,826,987 (-)	NCBI		Celera
Cytogenetic Map	9	C	NCBI
cM Map	9	35.96	NCBI

Usp3
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955450	11,727,104 - 11,802,462 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955450	11,729,433 - 11,802,462 (-)	NCBI	ChiLan1.0	ChiLan1.0

USP3
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	16	52,752,572 - 52,839,422 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	15	56,928,338 - 57,018,712 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	15	42,450,782 - 42,541,162 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	15	60,769,071 - 60,834,312 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	15	60,746,406 - 60,830,535 (+)	Ensembl	panpan1.1		panPan2

USP3
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	30	28,073,484 - 28,184,121 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	30	28,072,655 - 28,181,749 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	30	27,994,320 - 28,105,523 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	30	28,247,380 - 28,358,779 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	30	28,247,372 - 28,356,897 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	30	28,184,910 - 28,296,144 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	30	28,247,406 - 28,358,439 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	30	28,485,422 - 28,596,600 (+)	NCBI		UU_Cfam_GSD_1.0

Usp3
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024408640	106,190,114 - 106,282,480 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936471	24,035,655 - 24,130,997 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936471	24,032,644 - 24,130,543 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

USP3
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	1	108,415,703 - 108,515,447 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	1	108,414,358 - 108,515,611 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1

USP3
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	26	19,947,806 - 20,030,515 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	26	19,948,453 - 19,992,638 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666048	121,366,857 - 121,451,299 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Usp3
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624781	8,918,526 - 9,016,070 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624781	8,918,532 - 9,016,022 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Usp3
229 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	76
Count of miRNA genes:	68
Interacting mature miRNAs:	72
Transcripts:	ENSRNOT00000057739
Prediction methods:	Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1298065	Scl16	Serum cholesterol level QTL 16	3.8		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	8	30856404	75856404	Rat
1554321	Bmd3	Bone mineral density QTL 3	7.9	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	8	40952565	123900184	Rat
1578769	Uae31	Urinary albumin excretion QTL 31	3.3	0.001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	8	30848154	101699754	Rat
1298079	Activ2	Activity QTL 2	9.5	0.000001	voluntary movement trait (VT:0003491)	rearing measurement (CMO:0001515)	8	41866876	86866876	Rat
70161	Bp62	Blood pressure QTL 62	2.9	0.001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	42692684	90165460	Rat
1578765	Klgr1	Kidney lesion grade QTL 1	3.3	0.0001	kidney morphology trait (VT:0002135)	organ lesion measurement (CMO:0000677)	8	30848154	101699754	Rat
1582222	Epfw2	Epididymal fat weight QTL 2	3.2	0.0005	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	8	31737729	76737729	Rat
61464	Niddm11	Non-insulin dependent diabetes mellitus QTL 11	3.1	0.001	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	8	35582032	80582032	Rat
4889938	Bss89	Bone structure and strength QTL 89	3.8		tibia size trait (VT:0100001)	tibia cortical bone volume (CMO:0001725)	8	50095249	82460899	Rat
1578755	Pur5	Proteinuria QTL 5	3.3	0.0001	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	8	30848154	101699754	Rat
1300146	Rf17	Renal function QTL 17	2.9		renal blood flow trait (VT:2000006)	absolute change in renal blood flow rate (CMO:0001168)	8	28242912	73242912	Rat
8662823	Vetf5	Vascular elastic tissue fragility QTL 5	1.9		artery integrity trait (VT:0010639)	patent ductus arteriosus score (CMO:0002566)	8	28242912	99525068	Rat
2313088	Bss75	Bone structure and strength QTL 75	3.1	0.0001	body length (VT:0001256)	body length, nose to rump (CMO:0000079)	8	30848154	82460899	Rat
1358896	Bp262	Blood pressure QTL 262	2.89		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	27205715	99103503	Rat
731182	Uae24	Urinary albumin excretion QTL 24	6.4		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	8	19331152	93965294	Rat
724514	Uae15	Urinary albumin excretion QTL 15	2.9		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	8	29502665	70386295	Rat
631842	Inf1	Infertility severity QTL 1	4.1	0.001	seminal gland mass (VT:0010524)	seminal vesicle wet weight (CMO:0001603)	8	22662330	67662330	Rat
737824	Hcar10	Hepatocarcinoma resistance QTL 10	2.9		liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	8	40713066	82925667	Rat
1331769	Rf39	Renal function QTL 39	3.871		urine output (VT:0003620)	timed urine volume (CMO:0000260)	8	41866876	75097878	Rat
61358	Bp39	Blood pressure QTL 39	2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	35551938	80551938	Rat
1358906	Bp253	Blood pressure QTL 253	4	0.0004	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	40713066	93965294	Rat
1358907	Cm40	Cardiac mass QTL 40	1.89		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	8	27205715	99103503	Rat
70197	BpQTLcluster8	Blood pressure QTL cluster 8	3.482		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	46531639	119088626	Rat
2316950	Scl66	Serum cholesterol level QTL 66	4.1		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	8	30848259	105647037	Rat
1582254	Kidm31	Kidney mass QTL 31	3		kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	8	54237644	85365202	Rat
10402857	Bp380	Blood pressure QTL 380		0.95	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	53968765	98968765	Rat
1358892	Kidm26	Kidney mass QTL 26	3.69		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	8	27205715	99103503	Rat
631216	Stl9	Serum triglyceride level QTL 9	4.71	0.0001	blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	8	41867010	70386132	Rat
5684973	Bss100	Bone structure and strength QTL 100	4.7		tibia area (VT:1000281)	tibia area measurement (CMO:0001382)	8	50095249	82460899	Rat
1582243	Bw66	Body weight QTL 66	3.4	0.0048	body mass (VT:0001259)	body weight (CMO:0000012)	8	54237644	85365202	Rat
2313057	Bss76	Bone structure and strength QTL 76	3	0.0001	tibia size trait (VT:0100001)	tibia midshaft cross-sectional area (CMO:0001717)	8	30848154	82460899	Rat
12879878	Bw183	Body weight QTL 183		0.001	body mass (VT:0001259)	body weight (CMO:0000012)	8	43296169	98968765	Rat
1300177	Cm2	Cardiac mass QTL 2	3.65		heart mass (VT:0007028)	heart weight (CMO:0000017)	8	54259986	100382532	Rat
1549908	Neudeg1	Neurodegradation QTL 1	5.5	0	nervous system integrity trait (VT:0010566)	logarithm of the ratio of the lesioned side motor neuron count to contralateral side motor neuron count (CMO:0001986)	8	30188867	94457446	Rat
12879879	Cm99	Cardiac mass QTL 99		0.001	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	8	43296169	98968765	Rat
2313067	Bss77	Bone structure and strength QTL 77	3.1	0.0001	tibia size trait (VT:0100001)	tibia midshaft endosteal cross-sectional area (CMO:0001716)	8	30848154	82460899	Rat
12879880	Cm100	Cardiac mass QTL 100		0.001	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	8	43296169	98968765	Rat
12879881	Cm101	Cardiac mass QTL 101		0.001	heart right ventricle mass (VT:0007033)	heart right ventricle weight to body weight ratio (CMO:0000914)	8	43296169	98968765	Rat
12879882	Am8	Aortic mass QTL 8		0.001	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	8	43296169	98968765	Rat
12879883	Kidm65	Kidney mass QTL 65		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	8	43296169	98968765	Rat
1358912	Bw51	Body weight QTL 51	2.95		body mass (VT:0001259)	body weight (CMO:0000012)	8	51351728	107062046	Rat
2313086	Bss60	Bone structure and strength QTL 60	4.1	0.0001	tibia length (VT:0004357)	tibia length (CMO:0000450)	8	50095249	82460899	Rat
2303171	Bp331	Blood pressure QTL 331	5.57	0.005	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	61290298	119084929	Rat
2293697	Bmd39	Bone mineral density QTL 39			femur strength trait (VT:0010010)	femur total energy absorbed before break (CMO:0001677)	8	54043744	98968765	Rat
1331837	Bw23	Body weight QTL 23	4.19	0.00007	body mass (VT:0001259)	body weight (CMO:0000012)	8	46531722	99083736	Rat
1331838	Niddm61	Non-insulin dependent diabetes mellitus QTL 61	3.53	0.0004	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	8	36469535	99083736	Rat
631650	Stl6	Serum triglyceride level QTL 6	4	0.0019	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	8	10378157	112202585	Rat
631653	Bp125	Blood pressure QTL 125	3.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	66142385	111142385	Rat
1581557	Eae16	Experimental allergic encephalomyelitis QTL 16	3.8		nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046)	8	8462195	110921472	Rat
631271	Lecl1	Lens clarity QTL 1		0.001	lens clarity trait (VT:0001304)	age of onset/diagnosis of cataract (CMO:0001584)	8	18984168	84531599	Rat
2303564	Gluco43	Glucose level QTL 43	3		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	8	26130187	71130187	Rat
2303570	Gluco48	Glucose level QTL 48	2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	8	49805831	94805831	Rat
2313046	Bss78	Bone structure and strength QTL 78	3.5	0.0001	tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	8	30848154	82460899	Rat
2303572	Insul13	Insulin level QTL 13	2		blood insulin amount (VT:0001560)	blood insulin level (CMO:0000349)	8	26130187	71130187	Rat
2301402	Bp316	Blood pressure QTL 316		0.005	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	53968765	98968765	Rat
631664	Hcar3	Hepatocarcinoma resistance QTL 3	2.9	0.0005	liver integrity trait (VT:0010547)	volume of individual liver tumorous lesion (CMO:0001078)	8	54237644	99103503	Rat

Markers in Region

BE097110

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	8	67,091,786 - 67,091,949 (+)	MAPPER	mRatBN7.2
Rnor_6.0	8	72,219,833 - 72,219,995	NCBI	Rnor6.0
Rnor_5.0	8	71,888,380 - 71,888,542	UniSTS	Rnor5.0
RGSC_v3.4	8	70,834,122 - 70,834,284	UniSTS	RGSC3.4
Celera	8	66,477,355 - 66,477,517	UniSTS
RH 3.4 Map	8	849.5	UniSTS
Cytogenetic Map	8	q24	UniSTS

AA925744

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	8	67,079,960 - 67,080,074 (+)	MAPPER	mRatBN7.2
Rnor_6.0	8	72,208,006 - 72,208,119	NCBI	Rnor6.0
Rnor_5.0	8	71,875,723 - 71,875,836	UniSTS	Rnor5.0
RGSC_v3.4	8	70,821,465 - 70,821,578	UniSTS	RGSC3.4
Celera	8	66,465,541 - 66,465,654	UniSTS
RH 3.4 Map	8	849.8	UniSTS
Cytogenetic Map	8	q24	UniSTS

RH138449

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	8	67,099,323 - 67,099,458 (+)	MAPPER	mRatBN7.2
Rnor_6.0	8	72,227,370 - 72,227,504	NCBI	Rnor6.0
Rnor_5.0	8	71,896,037 - 71,896,171	UniSTS	Rnor5.0
RGSC_v3.4	8	70,841,789 - 70,841,923	UniSTS	RGSC3.4
Celera	8	66,484,943 - 66,485,077	UniSTS
RH 3.4 Map	8	845.9	UniSTS
Cytogenetic Map	8	q24	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001025424	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039081750	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039081751	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063265769	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC110705	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC129075	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	DQ076481	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000008	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000057739 ⟹ ENSRNOP00000054551

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	8	67,079,927 - 67,154,111 (-)	Ensembl
Rnor_6.0 Ensembl	8	72,207,972 - 72,284,873 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000080319 ⟹ ENSRNOP00000073732

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	8	67,079,927 - 67,154,090 (-)	Ensembl
Rnor_6.0 Ensembl	8	72,207,972 - 72,284,852 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000094873 ⟹ ENSRNOP00000084539

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	8	67,079,927 - 67,154,111 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000100745 ⟹ ENSRNOP00000086159

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	8	67,079,927 - 67,137,755 (-)	Ensembl

RefSeq Acc Id:

NM_001025424 ⟹ NP_001020595

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	8	75,974,954 - 76,049,151 (-)	NCBI
mRatBN7.2	8	67,079,925 - 67,154,109 (-)	NCBI
Rnor_6.0	8	72,207,970 - 72,284,871 (-)	NCBI
Rnor_5.0	8	71,875,687 - 71,951,083 (-)	NCBI
RGSC_v3.4	8	70,821,429 - 70,897,119 (-)	RGD
Celera	8	66,465,505 - 66,539,503 (-)	RGD

Sequence:

show sequence

CGCGGGGAGCCACCTTCTGCCCAGCGCCGGGTCAGAAGCGACCCCAGACGGAGCCTCCGAAGTC
CCTCCGCCCCAGAGCCTCGGCCGTCCCCGCCGCCGTCCTCGTGGCCATGGAGTGTCCGCACCTC
AGCTCTAGCGTCTGCATCGCCCCGGACTCAGCCAAGTTCCCCAACGGCTCCCCGTCGTCCTGGT
GCTGCAGCGTGTGCAGGTCCAACAAAAGCCCCTGGGTCTGTTTGACTTGTTCAAGTGTCCTCTG
TGGAAGGTATGTGAATGGCCATGCAAAAAAACATTATGAAGATGCACAGATACCCTTACTCAAC
CATAAGAGATCAGAAAAACAGGAGAAAGCTCAGCATACAGTGTGTATGGATTGCAGTAGCTACA
GCACATACTGTTACCGCTGTGATGATTTTGTGGTCAATGACACCAAGCTGGGCCTGGTACAGAA
AGTGAGAGAACACTTACAGAGCTTGGAAAACTCAGCTTTTACAGCTGACAGGCACAGAAAAAGA
AAATTATTGGAAAACTCATCACTGAATAGCAAGTTATTAAAAGTAAATGGAAGTACGGCTGCCA
TTTGTGCCACAGGCCTTCGGAATTTGGGCAACACGTGCTTCATGAATGCTATCCTTCAGTCACT
CAGTAACATCGAGCAGTTTTGCTGTTATTTCAAAGAGCTGCCTGCTGTGGAGTTAAGGAATGGG
AAAACAGCAGGGAGGCGGACATACCACACCAGGAGCCAAGGGGACAGCAACGTGTCTTTGGTAG
AAGAGTTTAGAAAGACACTGTGCGCTTTGTGGCAAGGTAGCCAGACTGCATTTAGTCCTGAGTC
CTTGTTTTATGTTGTTTGGAAGATCATGCCTAACTTTAGGGGTTATCGGCAGCAGGATGCCCAT
GAATTCATGCGTTACCTTTTGGATCATCTGCACTTGGAACTTCAGGGTGGCTTCAACGGTGTTT
CCCGCTCAGCAATTCTACAGGAGAATTCTACACTGTCTGCAAATAACAAATGCTGCATAAATGG
AGCATCAACTGTTGTCACAACAATATTTGGAGGAATTCTCCAGAATGAGGTCAACTGCCTCATA
TGTGGGACAGAGTCGAGGAAGTTTGATCCATTCCTAGATCTCTCCTTAGATATTCCAAGTCAGT
TCAGAAGCAAGCGCTCTAAGAATCAGGAAAATGGGCCTGTTTGCTCCTTACGAGATTGTCTTCG
CAGCTTCACTGACCTAGAGGAACTTGATGAGACGGAGTTGTATATGTGCCATAAGTGCAAAAAG
AAACAAAAGTCCACAAAAAAGTTTTGGATTCAAAAACTTCCCAAGGCGCTGTGCTTGCACCTGA
AAAGGTTTCACTGGACAGCATATTTACGAAACAAAGTAGATACATACGTTCAGTTCCCACTGAG
AGGCCTGGACATGAAGTGCTACCTACTAGAGCCAGAGAACAGTGGCCCCGACAGTTGCCTGTAT
GACCTCGCTGCCGTGTTTGTTCACCATGGCTCTGGGGTTGGTTCTGGGCATTACACAGCATATG
CAGTTCACGAAGGCCGCTGGTTCCATTTCAATGACAGCACTGTGACAGTGACTGATGAGGAGAC
CGTTGGGAAGGCGAAGGCCTACATTCTGTTTTATGTAGAGCGTCAGGCCAGAGCTGGAGCAGAT
AAACTGTGATACCTCCTGACCATGATTCATCTACTATACCGGACAACATTTCCATTCTCCATAA
ATACTTGATCCAAGATTTAATTTCAGTATGCACTTTTCAATTTCCAGTTTGGGGTTTTAGTTTG
GTCAGTGGTAGTAACTTACCCAATATGGGCACCAACTAATTTTTGTTGTTCTACCAGAAAACCT
CAGCAGGCATTTTGATTGGCTGCTTTAGTTGCAATAATTCAATTTTTATAAGTAGTTTCCAGAA
CTTAGTTCTGTTTGACTTTTTATATTAATGTTTTCAGTTCTCACGGAGGCACATTTTATTGCTC
TGTACTCACATGCTGAGAGCCACCCTGCCTGCTGTCTGCATAGCAGGCAGGTCAGCGACTCCGT
TGTGAGGGTCGTGTGTGCAGGTCTGTGACCCGCCGGTTTCACAGTGACTGCTCAGGTATCCCTT
CTGACTGTAGGCCGTAGTAGCTGAAGGTCAGGAGACCAGGCCATCACCACTGCCTGTGCCTCAG
GTTGCTGTTTCTCAGCATTAAATAAATTTGTCAGTTCCGTTGCGTCTGTGCTCAAAAAAAAAAA
AAAAA

hide sequence

RefSeq Acc Id:

XM_039081750 ⟹ XP_038937678

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	8	75,973,278 - 76,034,667 (-)	NCBI
mRatBN7.2	8	67,078,249 - 67,134,112 (-)	NCBI

RefSeq Acc Id:

XM_039081751 ⟹ XP_038937679

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	8	75,973,278 - 76,048,951 (-)	NCBI
mRatBN7.2	8	67,078,249 - 67,153,903 (-)	NCBI

RefSeq Acc Id:

XM_063265769 ⟹ XP_063121839

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	8	75,973,278 - 76,048,238 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_001020595	(Get FASTA)	NCBI Sequence Viewer
	XP_038937678	(Get FASTA)	NCBI Sequence Viewer
	XP_038937679	(Get FASTA)	NCBI Sequence Viewer
	XP_063121839	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAI29076	(Get FASTA)	NCBI Sequence Viewer
	AAY97907	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000054551.5
	ENSRNOP00000073732.2
	ENSRNOP00000084539.1
	ENSRNOP00000086159.1

RefSeq Acc Id:

NP_001020595 ⟸ NM_001025424

- UniProtKB:

Q4JL29 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MECPHLSSSVCIAPDSAKFPNGSPSSWCCSVCRSNKSPWVCLTCSSVLCGRYVNGHAKKHYEDA
QIPLLNHKRSEKQEKAQHTVCMDCSSYSTYCYRCDDFVVNDTKLGLVQKVREHLQSLENSAFTA
DRHRKRKLLENSSLNSKLLKVNGSTAAICATGLRNLGNTCFMNAILQSLSNIEQFCCYFKELPA
VELRNGKTAGRRTYHTRSQGDSNVSLVEEFRKTLCALWQGSQTAFSPESLFYVVWKIMPNFRGY
RQQDAHEFMRYLLDHLHLELQGGFNGVSRSAILQENSTLSANNKCCINGASTVVTTIFGGILQN
EVNCLICGTESRKFDPFLDLSLDIPSQFRSKRSKNQENGPVCSLRDCLRSFTDLEELDETELYM
CHKCKKKQKSTKKFWIQKLPKALCLHLKRFHWTAYLRNKVDTYVQFPLRGLDMKCYLLEPENSG
PDSCLYDLAAVFVHHGSGVGSGHYTAYAVHEGRWFHFNDSTVTVTDEETVGKAKAYILFYVERQ
ARAGADKL

hide sequence

Ensembl Acc Id:

ENSRNOP00000073732 ⟸ ENSRNOT00000080319

Ensembl Acc Id:

ENSRNOP00000054551 ⟸ ENSRNOT00000057739

RefSeq Acc Id:	XP_038937679 ⟸ XM_039081751
- Peptide Label:	isoform X2
- UniProtKB:	Q4JL29 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038937678 ⟸ XM_039081750
- Peptide Label:	isoform X1
- UniProtKB:	A0A8I6A351 (UniProtKB/TrEMBL), Q4JL29 (UniProtKB/TrEMBL)

Ensembl Acc Id:

ENSRNOP00000086159 ⟸ ENSRNOT00000100745

Ensembl Acc Id:

ENSRNOP00000084539 ⟸ ENSRNOT00000094873

RefSeq Acc Id:	XP_063121839 ⟸ XM_063265769
- Peptide Label:	isoform X1
- UniProtKB:	A0A8I6A351 (UniProtKB/TrEMBL)

Protein Domains

UBP-type USP

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13696089

Promoter ID:

EPDNEW_R6613

Type:

multiple initiation site

Name:

Usp3_1

Description:

ubiquitin specific peptidase 3

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	8	72,284,898 - 72,284,958	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1308852	AgrOrtholog
BioCyc Gene	G2FUF-30018	BioCyc
Ensembl Genes	ENSRNOG00000017714	Ensembl, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000057739.5	UniProtKB/TrEMBL
	ENSRNOT00000080319.2	UniProtKB/TrEMBL
	ENSRNOT00000094873.1	UniProtKB/TrEMBL
	ENSRNOT00000100745.1	UniProtKB/TrEMBL
Gene3D-CATH	3.30.40.10	UniProtKB/TrEMBL
	Cysteine proteinases	UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7383067	IMAGE-MGC_LOAD
InterPro	Papain_like_cys_pep_sf	UniProtKB/TrEMBL
	Pept_C19ubi-hydrolase_C_CS	UniProtKB/TrEMBL
	Peptidase_C19	UniProtKB/TrEMBL
	Ub_carboxyl-term_hydrolase	UniProtKB/TrEMBL
	UCH/PAN2	UniProtKB/TrEMBL
	Znf_RING/FYVE/PHD	UniProtKB/TrEMBL
	Znf_UBP	UniProtKB/TrEMBL
KEGG Report	rno:363084	UniProtKB/TrEMBL
MGC_CLONE	MGC:156515	IMAGE-MGC_LOAD
NCBI Gene	363084	ENTREZGENE
PANTHER	UBIQUITIN CARBOXYL-TERMINAL HYDROLASE	UniProtKB/TrEMBL
	UBIQUITIN CARBOXYL-TERMINAL HYDROLASE 3	UniProtKB/TrEMBL
Pfam	UCH	UniProtKB/TrEMBL
	zf-UBP	UniProtKB/TrEMBL
PhenoGen	Usp3	PhenoGen
PROSITE	UCH_2_1	UniProtKB/TrEMBL
	UCH_2_2	UniProtKB/TrEMBL
	UCH_2_3	UniProtKB/TrEMBL
	ZF_UBP	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000017714	RatGTEx
SMART	ZnF_UBP	UniProtKB/TrEMBL
Superfamily-SCOP	RING/U-box	UniProtKB/TrEMBL
	SSF54001	UniProtKB/TrEMBL
UniProt	A0A8I6A0C2_RAT	UniProtKB/TrEMBL
	A0A8I6A351	ENTREZGENE, UniProtKB/TrEMBL
	A1L1I5_RAT	UniProtKB/TrEMBL
	D4A4F6_RAT	UniProtKB/TrEMBL
	Q4JL29	ENTREZGENE, UniProtKB/TrEMBL
UniProt Secondary	A0A0G2K699	UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2006-03-30	Usp3	ubiquitin specific peptidase 3		ubiquitin specific protease 3	Name updated	1299863	APPROVED
2005-12-06	Usp3	ubiquitin specific protease 3	Usp3_predicted	ubiquitin specific protease 3 (predicted)	Symbol and Name updated	1559027	APPROVED
2005-01-12	Usp3_predicted	ubiquitin specific protease 3 (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

RGD Manual Annotations

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

RGD Manual Annotations