Mrps34 (mitochondrial ribosomal protein S34)

Advanced Search (OLGA)

Gene: Mrps34 (mitochondrial ribosomal protein S34) Rattus norvegicus

Analyze

Symbol:

Mrps34

Name:

mitochondrial ribosomal protein S34

RGD ID:

1305623

Description:

Predicted to be a structural constituent of ribosome. Predicted to be involved in mitochondrial translation. Predicted to be located in mitochondrion. Predicted to be part of mitochondrial small ribosomal subunit. Human ortholog(s) of this gene implicated in combined oxidative phosphorylation deficiency 32. Orthologous to human MRPS34 (mitochondrial ribosomal protein S34); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,4-dinitrotoluene; 2,6-dinitrotoluene.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

28S ribosomal protein S34, mitochondrial; LOC287126; small ribosomal subunit protein mS34

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	MRPS34 (mitochondrial ribosomal protein S34)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Mrps34 (mitochondrial ribosomal protein S34)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Mrps34 (mitochondrial ribosomal protein S34)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	MRPS34 (mitochondrial ribosomal protein S34)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	MRPS34 (mitochondrial ribosomal protein S34)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Mrps34 (mitochondrial ribosomal protein S34)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	MRPS34 (mitochondrial ribosomal protein S34)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	MRPS34 (mitochondrial ribosomal protein S34)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Mrps34 (mitochondrial ribosomal protein S34)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	PSMD11 (proteasome 26S subunit, non-ATPase 11)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	MRPS34 (mitochondrial ribosomal protein S34)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Mrps34 (mitochondrial ribosomal protein S34)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	mrps34 (mitochondrial ribosomal protein S34)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	mrps-34	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)
Drosophila melanogaster (fruit fly):	mRpS34	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OrthoFinder\|PANTHER\|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):	mrps34	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	10	14,420,543 - 14,421,674 (+)	NCBI		GRCr8
mRatBN7.2	10	13,916,024 - 13,917,155 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	13,916,026 - 13,918,406 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	10	18,663,134 - 18,664,265 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	10	18,151,994 - 18,153,125 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	10	13,651,211 - 13,652,342 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	10	14,257,001 - 14,258,132 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	14,257,001 - 14,258,132 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	10	14,073,017 - 14,074,148 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	10	14,144,109 - 14,145,240 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	10	14,144,109 - 14,145,226 (+)	NCBI
Celera	10	13,595,232 - 13,596,363 (+)	NCBI		Celera
Cytogenetic Map	10	q12	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

combined oxidative phosphorylation deficiency 32 (ISO)

developmental and epileptic encephalopathy 1 (ISO)

epilepsy (ISO)

genetic disease (ISO)

idiopathic generalized epilepsy (ISO)

Leigh disease (ISO)

mitochondrial metabolism disease (ISO)

short-rib thoracic dysplasia 9 with or without polydactyly (ISO)

tuberous sclerosis 2 (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(1->4)-beta-D-glucan (ISO)

1,2-dimethylhydrazine (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4-dinitrotoluene (EXP)

2,6-dinitrotoluene (EXP)

6-propyl-2-thiouracil (EXP)

all-trans-retinoic acid (ISO)

amitrole (EXP)

benzo[a]pyrene (ISO)

bisphenol A (EXP,ISO)

cadmium dichloride (EXP)

chlorpyrifos (ISO)

clofibrate (ISO)

clofibric acid (EXP)

copper(II) sulfate (ISO)

corosolic acid (ISO)

cyclosporin A (ISO)

diazinon (ISO)

Dibutyl phosphate (ISO)

dibutyl phthalate (ISO)

disodium selenite (ISO)

doxorubicin (ISO)

ethyl methanesulfonate (ISO)

fenthion (ISO)

fipronil (EXP)

flutamide (EXP)

folic acid (ISO)

folpet (ISO)

formaldehyde (ISO)

furan (EXP)

gentamycin (EXP)

glafenine (EXP)

ivermectin (ISO)

leflunomide (EXP)

lipopolysaccharide (ISO)

methidathion (ISO)

methimazole (EXP)

methyl methanesulfonate (ISO)

N-nitrosodiethylamine (EXP)

nefazodone (EXP)

nimesulide (EXP)

ochratoxin A (EXP)

paracetamol (EXP,ISO)

paraquat (EXP)

perfluorohexanesulfonic acid (ISO)

perfluorooctane-1-sulfonic acid (ISO)

sodium arsenite (ISO)

sulfadimethoxine (EXP)

tetrachloroethene (ISO)

thiram (ISO)

tungsten (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

mitochondrial translation (IBA,ISO)

Cellular Component

mitochondrial small ribosomal subunit (IBA)

mitochondrion (ISO)

Molecular Function

structural constituent of ribosome (IBA,ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
3.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:18614015	PMID:25816300	PMID:28777931

Genomics

Comparative Map Data

Mrps34
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	10	14,420,543 - 14,421,674 (+)	NCBI		GRCr8
mRatBN7.2	10	13,916,024 - 13,917,155 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	13,916,026 - 13,918,406 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	10	18,663,134 - 18,664,265 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	10	18,151,994 - 18,153,125 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	10	13,651,211 - 13,652,342 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	10	14,257,001 - 14,258,132 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	14,257,001 - 14,258,132 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	10	14,073,017 - 14,074,148 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	10	14,144,109 - 14,145,240 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	10	14,144,109 - 14,145,226 (+)	NCBI
Celera	10	13,595,232 - 13,596,363 (+)	NCBI		Celera
Cytogenetic Map	10	q12	NCBI

MRPS34
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	16	1,771,895 - 1,773,134 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	16	1,771,890 - 1,773,150 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	16	1,821,896 - 1,823,135 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	16	1,761,897 - 1,763,141 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	16	1,761,897 - 1,763,141	NCBI
Celera	16	2,034,171 - 2,035,419 (-)	NCBI		Celera
Cytogenetic Map	16	p13.3	NCBI
HuRef	16	1,744,788 - 1,746,036 (-)	NCBI		HuRef
CHM1_1	16	1,821,844 - 1,823,088 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	16	1,787,729 - 1,788,968 (-)	NCBI		T2T-CHM13v2.0

Mrps34
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	17	25,114,094 - 25,115,263 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	17	25,114,090 - 25,116,476 (+)	Ensembl		GRCm39 Ensembl
GRCm38	17	24,895,120 - 24,896,289 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	17	24,895,116 - 24,897,502 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	17	25,032,065 - 25,033,219 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	17	24,622,720 - 24,623,874 (+)	NCBI		MGSCv36	mm8
Celera	17	25,421,811 - 25,422,964 (+)	NCBI		Celera
Cytogenetic Map	17	A3.3	NCBI
cM Map	17	12.53	NCBI

Mrps34
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955442	15,496,639 - 15,497,757 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955442	15,496,639 - 15,497,757 (+)	NCBI	ChiLan1.0	ChiLan1.0

MRPS34
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	18	2,038,522 - 2,039,746 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	16	5,819,960 - 5,821,270 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	16	394,257 - 395,564 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	16	1,824,282 - 1,825,560 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	16	1,824,282 - 1,825,558 (-)	Ensembl	panpan1.1		panPan2

MRPS34
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	6	39,130,597 - 39,131,643 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	6	39,130,561 - 39,131,648 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	6	40,369,262 - 40,370,275 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	6	39,446,788 - 39,447,801 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	6	39,446,814 - 39,448,236 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	6	39,123,490 - 39,124,503 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	6	39,096,071 - 39,097,084 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	6	39,574,522 - 39,575,532 (+)	NCBI		UU_Cfam_GSD_1.0

Mrps34
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024409344	104,487,749 - 104,488,918 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936694	2,220,475 - 2,221,714 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936694	2,220,492 - 2,221,716 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

MRPS34
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	3	40,193,033 - 40,195,018 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	3	40,194,078 - 40,195,316 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	3	41,658,025 - 41,659,263 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

MRPS34
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	5	1,680,898 - 1,682,159 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	5	1,681,228 - 1,682,151 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666068	29,403,969 - 29,405,347 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Mrps34
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624913	479,011 - 480,067 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624913	479,012 - 480,067 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Mrps34
3 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	35
Count of miRNA genes:	35
Interacting mature miRNAs:	35
Transcripts:	ENSRNOT00000021075
Prediction methods:	Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
9589136	Insul27	Insulin level QTL 27	10.46	0.001	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	10	11474010	56474010	Rat
8662860	Vetf10	Vascular elastic tissue fragility QTL 10			artery integrity trait (VT:0010639)	number of ruptures of the internal elastic lamina of the abdominal aorta and iliac arteries (CMO:0002562)	10	6154182	73453136	Rat
2313066	Bss63	Bone structure and strength QTL 63	1.4	0.0001	tibia strength trait (VT:1000284)	bone polar moment of inertia (CMO:0001558)	10	5387014	50387014	Rat
631554	Bp133	Blood pressure QTL 133		0.005	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	743364	63851208	Rat
2313064	Bmd71	Bone mineral density QTL 71	0.9	0.0001	tibia mineral mass (VT:1000283)	compact volumetric bone mineral density (CMO:0001730)	10	5387014	50387014	Rat
70223	Bp57	Blood pressure QTL 57	5		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	1	80676123	Rat
634329	Pia15	Pristane induced arthritis QTL 15	3.1		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	1	24158324	Rat
1578761	Stresp21	Stress response QTL 21	3.3		thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	10	6375746	51375746	Rat
2293680	Bss40	Bone structure and strength QTL 40	5.66	0.0001	femur strength trait (VT:0010010)	femur total energy absorbed before break (CMO:0001677)	10	1	35225947	Rat
7387235	Uae41	Urinary albumin excretion QTL 41	5.26	0.1874	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	10	1	29497586	Rat
2298544	Neuinf9	Neuroinflammation QTL 9	4.6		nervous system integrity trait (VT:0010566)	spinal cord complement component 1, q subcomponent, B chain mRNA level (CMO:0002126)	10	5801990	62146030	Rat
10401803	Kidm50	Kidney mass QTL 50			kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	10	418344	45418344	Rat
737820	Alc9	Alcohol consumption QTL 9	2.2		consumption behavior trait (VT:0002069)	ethanol drink intake rate (CMO:0001407)	10	5144027	19233348	Rat
2313081	Bss64	Bone structure and strength QTL 64	1.3	0.0001	tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	10	5387014	50387014	Rat
631828	Alc5	Alcohol consumption QTL 5	2.4		consumption behavior trait (VT:0002069)	ethanol drink intake rate (CMO:0001407)	10	5144027	17245662	Rat
634327	Hc4	Hypercalciuria QTL 4	2.4		urine calcium amount (VT:0002985)	urine calcium excretion rate (CMO:0000763)	10	1	38328221	Rat
2313095	Bss62	Bone structure and strength QTL 62	1.5	0.0001	tibia size trait (VT:0100001)	tibia midshaft cross-sectional area (CMO:0001717)	10	5387014	50387014	Rat
631660	Hcar1	Hepatocarcinoma resistance QTL 1	3.4	0.0001	liver integrity trait (VT:0010547)	volume of individual liver tumorous lesion (CMO:0001078)	10	6154182	15990232	Rat
1576304	Schws7	Schwannoma susceptibility QTL 7		0.0115	nervous system integrity trait (VT:0010566)	percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017)	10	4765527	19816042	Rat
7411611	Foco17	Food consumption QTL 17	18.7	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	10	1	42315980	Rat
2303118	Mamtr7	Mammary tumor resistance QTL 7		0.003	mammary gland integrity trait (VT:0010552)	mammary tumor growth rate (CMO:0000344)	10	9658275	104670812	Rat
9590268	Scort13	Serum corticosterone level QTL 13	3.26	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	10	11474010	56474010	Rat
2313104	Bss61	Bone structure and strength QTL 61	0.9	0.0001	tibia area (VT:1000281)	tibia midshaft cross-sectional area (CMO:0001717)	10	5387014	50387014	Rat
61427	Cia16	Collagen induced arthritis QTL 16	3.2		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	6357896	96121100	Rat
9590310	Scort19	Serum corticosterone level QTL 19	6.3	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	10	11474010	56474010	Rat

Markers in Region

AV001970

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	10	13,916,911 - 13,917,007 (+)	MAPPER	mRatBN7.2
Rnor_6.0	10	14,257,889 - 14,257,984	NCBI	Rnor6.0
Rnor_5.0	10	14,073,905 - 14,074,000	UniSTS	Rnor5.0
RGSC_v3.4	10	14,144,997 - 14,145,092	UniSTS	RGSC3.4
Celera	10	13,596,120 - 13,596,215	UniSTS
Cytogenetic Map	10	q12	UniSTS

RH129468

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	10	13,916,916 - 13,917,102 (+)	MAPPER	mRatBN7.2
Rnor_6.0	10	14,257,894 - 14,258,079	NCBI	Rnor6.0
Rnor_5.0	10	14,073,910 - 14,074,095	UniSTS	Rnor5.0
RGSC_v3.4	10	14,145,002 - 14,145,187	UniSTS	RGSC3.4
Celera	10	13,596,125 - 13,596,310	UniSTS
Cytogenetic Map	10	q12	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001105771	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC130925	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473948	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ228234	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ230451	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000010	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000021075 ⟹ ENSRNOP00000021075

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	10	13,916,026 - 13,918,406 (+)	Ensembl
Rnor_6.0 Ensembl	10	14,257,001 - 14,258,132 (+)	Ensembl

RefSeq Acc Id:

NM_001105771 ⟹ NP_001099241

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	14,420,543 - 14,421,674 (+)	NCBI
mRatBN7.2	10	13,916,024 - 13,917,155 (+)	NCBI
Rnor_6.0	10	14,257,001 - 14,258,132 (+)	NCBI
Rnor_5.0	10	14,073,017 - 14,074,148 (+)	NCBI
RGSC_v3.4	10	14,144,109 - 14,145,240 (+)	RGD
Celera	10	13,595,232 - 13,596,363 (+)	RGD

Sequence:

show sequence

TGGGGAGCTGGTGAAGCGCAGGTTTCCTGTGGAGTAAGGACACCGGCATGGCGCGGAAGAAAGT
GAAACCCCGGCTGATCGCTGAGCTGGCCCGCCGCGTGCGCGCCTTGCGCGAGCAGCGGAACCAG
CCGCGAGACTCGCAGCTCTACGCCCTAGACTACGAGACGCTGACCCGGCCGCACTCTGGTCGCC
GGCTGCCAGTGCGCGCCTGGGCCGACGTACGTCGCGAGAGCCGCCTTCTACAGCTGCTCGCCCG
CCTCCCCTTGTTTGGCCTGGGTCGTCTGGTTACCCGCAAGTCCTGGCTGTGGCAGCACGACGAG
CCATGCTACTGGCGCCTCACGCGTGTGAGGCCTGACTACACGGCGCAGAACTTGGACCACGGGA
GGGCCTGGGGTATCCTGACTTTCAAAGGGAAGAGTGAGGAAACGGCTCGGGAAATCGAGCAAGT
CATGTACCACGATTGGCGGTTGGTACCCAAGCACGAGGAGGAGGCTTTCACTGCGTTCACTGGG
AAAGCAGAGGACAGATTGAACCTTGTCCCCTACCCACCTCTGCTGCGGGCCATGATCCTCGCTG
AGCGACAGAAAAACGGGGATACCAGCGTCGAGGAGCCGCTCCTGAACCTGGAGAGGACTCGAAT
GCGCCCCTGGGACTACCCTGCAAAACAGGAGACTAAAGGGAGAGCCAAGGGCACCCCAGTCTAA
CTGCCAGGATTGGCAGAGAGGTCCTGTGAGTCATTTGATGGACAAGTGTCTTTGACTGTGTCAG
AATCTCCCCTTTGGTGGGGAGACCCTAAAGCCTTGACACATCTGCCAATGAATAATGGGGCAGA
TGACAGATTGTGATTTTCAGGCGGCCCCTCGCCGATTCCTCCGTCTGGAAATAAACTCCCGAAA
TGGCC

hide sequence

Protein Sequences


Protein RefSeqs	NP_001099241	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDM03889	(Get FASTA)	NCBI Sequence Viewer
	EDM03890	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000021075.4

RefSeq Acc Id:

NP_001099241 ⟸ NM_001105771

- UniProtKB:

D4ABM5 (UniProtKB/TrEMBL), A6HCY4 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MARKKVKPRLIAELARRVRALREQRNQPRDSQLYALDYETLTRPHSGRRLPVRAWADVRRESRL
LQLLARLPLFGLGRLVTRKSWLWQHDEPCYWRLTRVRPDYTAQNLDHGRAWGILTFKGKSEETA
REIEQVMYHDWRLVPKHEEEAFTAFTGKAEDRLNLVPYPPLLRAMILAERQKNGDTSVEEPLLN
LERTRMRPWDYPAKQETKGRAKGTPV

hide sequence

Ensembl Acc Id:

ENSRNOP00000021075 ⟸ ENSRNOT00000021075

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D4ABM5-F1-model_v2	AlphaFold	D4ABM5	1-218	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13697035

Promoter ID:

EPDNEW_R7559

Type:

initiation region

Name:

Mrps34_1

Description:

mitochondrial ribosomal protein S34

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	10	14,257,029 - 14,257,089	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1305623	AgrOrtholog
BioCyc Gene	G2FUF-25814	BioCyc
Ensembl Genes	ENSRNOG00000015479	Ensembl, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000021075.6	UniProtKB/TrEMBL
InterPro	MRP-S34	UniProtKB/TrEMBL
KEGG Report	rno:287126	UniProtKB/TrEMBL
NCBI Gene	287126	ENTREZGENE
PANTHER	28S RIBOSOMAL PROTEIN S34, MITOCHONDRIAL	UniProtKB/TrEMBL
	PTHR28589	UniProtKB/TrEMBL
Pfam	MRP-S34	UniProtKB/TrEMBL
PhenoGen	Mrps34	PhenoGen
RatGTEx	ENSRNOG00000015479	RatGTEx
UniProt	A6HCY4	ENTREZGENE, UniProtKB/TrEMBL
	D4ABM5	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-04-30	Mrps34	mitochondrial ribosomal protein S34	Mrps34_predicted	mitochondrial ribosomal protein S34 (predicted)	'predicted' is removed	2292626	APPROVED
2005-01-12	Mrps34_predicted	mitochondrial ribosomal protein S34 (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - OMIM

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - OMIM