Advanced Search (OLGA)

Gene: Tbc1d20 (TBC1 domain family, member 20) Rattus norvegicus

Analyze

Symbol:

Tbc1d20

Name:

TBC1 domain family, member 20

RGD ID:

1303293

Description:

Predicted to enable GTPase activator activity and small GTPase binding activity. Predicted to be involved in several processes, including COPII-coated vesicle cargo loading; positive regulation by host of viral genome replication; and positive regulation by virus of viral protein levels in host cell. Predicted to act upstream of or within several processes, including acrosome assembly; lens fiber cell morphogenesis; and seminiferous tubule development. Predicted to be located in Golgi membrane; endoplasmic reticulum membrane; and nuclear membrane. Human ortholog(s) of this gene implicated in Warburg micro syndrome 4. Orthologous to human TBC1D20 (TBC1 domain family member 20); INTERACTS WITH (+)-schisandrin B; 2,3,7,8-tetrachlorodibenzodioxine; 2,6-dinitrotoluene.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

MGC94895; similar to chromosome 20 open reading frame 140; TBC1 domain family member 20

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	TBC1D20 (TBC1 domain family member 20)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Tbc1d20 (TBC1 domain family, member 20)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Tbc1d20 (TBC1 domain family member 20)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	TBC1D20 (TBC1 domain family member 20)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	TBC1D20 (TBC1 domain family member 20)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Tbc1d20 (TBC1 domain family member 20)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	TBC1D20 (TBC1 domain family member 20)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	TBC1D20 (TBC1 domain family member 20)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Tbc1d20 (TBC1 domain family member 20)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	TBC1D20 (TBC1 domain family member 20)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Tbc1d20 (TBC1 domain family, member 20)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	tbc1d20 (TBC1 domain family, member 20)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG17883	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	GYP8	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	tbc-20	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	tbc1d20.1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	161,228,699 - 161,247,319 (+)	NCBI		GRCr8
mRatBN7.2	3	140,768,537 - 140,787,010 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	140,768,537 - 140,785,121 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	3	144,673,328 - 144,690,001 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	153,257,161 - 153,273,834 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	150,997,769 - 151,014,273 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	147,772,006 - 147,790,946 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	147,772,165 - 147,789,158 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	3	154,120,296 - 154,137,199 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	3	142,623,713 - 142,640,197 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	3	142,529,285 - 142,545,770 (+)	NCBI
Celera	3	139,520,860 - 139,537,468 (+)	NCBI		Celera
Cytogenetic Map	3	q41	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Brown-Vialetto-Van Laere syndrome 1 (ISO)

genetic disease (ISO)

Neurodevelopmental Disorders (ISO)

Polyglucosan Body Myopathy 1 with or without Immunodeficiency (ISO)

Warburg micro syndrome (ISO)

Warburg micro syndrome 4 (ISO,ISS)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-schisandrin B (EXP)

2,2',4,4',5,5'-hexachlorobiphenyl (ISO)

2,2',5,5'-tetrachlorobiphenyl (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,6-dinitrotoluene (EXP)

2-hydroxypropanoic acid (ISO)

all-trans-retinoic acid (ISO)

benzo[a]pyrene (ISO)

benzo[a]pyrene diol epoxide I (ISO)

bisphenol A (EXP,ISO)

caffeine (ISO)

chlorpyrifos (ISO)

cocaine (EXP)

cyclosporin A (ISO)

Dibutyl phosphate (ISO)

endosulfan (EXP)

fenthion (ISO)

folic acid (ISO)

formaldehyde (ISO)

furan (EXP)

inulin (ISO)

leflunomide (ISO)

methidathion (ISO)

nickel sulfate (ISO)

paracetamol (ISO)

PCB138 (ISO)

perfluorohexanesulfonic acid (ISO)

perfluorooctane-1-sulfonic acid (ISO)

pirinixic acid (ISO)

rac-lactic acid (ISO)

silver atom (ISO)

silver(0) (ISO)

sodium arsenite (ISO)

sunitinib (ISO)

tetrachloromethane (EXP)

thioacetamide (EXP)

thiram (ISO)

titanium dioxide (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

acrosome assembly (ISO)

camera-type eye development (ISO)

COPII-coated vesicle cargo loading (ISO)

endoplasmic reticulum to Golgi vesicle-mediated transport (IBA,ISO)

Golgi organization (ISO)

lens development in camera-type eye (ISO)

lens fiber cell morphogenesis (ISO)

lipid droplet organization (ISO)

male gonad development (ISO)

positive regulation by host of viral genome replication (ISO)

positive regulation by virus of viral protein levels in host cell (ISO)

positive regulation of ER to Golgi vesicle-mediated transport (ISO)

positive regulation of GTPase activity (ISO)

regulation of cilium assembly (ISO)

seminiferous tubule development (ISO)

spermatogenesis (ISO)

virion assembly (IEA)

Cellular Component

endoplasmic reticulum (ISO)

endoplasmic reticulum membrane (IBA,ISO)

Golgi membrane (ISO)

nuclear membrane (ISO)

Molecular Function

GTPase activator activity (IBA,ISO)

protein binding (ISO)

small GTPase binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
3.	GOA pipeline	RGD automated data pipeline
4.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
5.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
6.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.

Additional References at PubMed

PMID:14757819	PMID:17646400	PMID:17684057	PMID:17686842	PMID:21680502	PMID:22491470	PMID:24239381

Genomics

Comparative Map Data

Tbc1d20
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	161,228,699 - 161,247,319 (+)	NCBI		GRCr8
mRatBN7.2	3	140,768,537 - 140,787,010 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	140,768,537 - 140,785,121 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	3	144,673,328 - 144,690,001 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	153,257,161 - 153,273,834 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	150,997,769 - 151,014,273 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	147,772,006 - 147,790,946 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	147,772,165 - 147,789,158 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	3	154,120,296 - 154,137,199 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	3	142,623,713 - 142,640,197 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	3	142,529,285 - 142,545,770 (+)	NCBI
Celera	3	139,520,860 - 139,537,468 (+)	NCBI		Celera
Cytogenetic Map	3	q41	NCBI

TBC1D20
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	20	435,480 - 462,533 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	20	423,596 - 462,566 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	20	416,124 - 443,177 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	20	364,124 - 391,187 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	20	364,125 - 391,147	NCBI
Celera	20	510,958 - 538,015 (-)	NCBI		Celera
Cytogenetic Map	20	p13	NCBI
HuRef	20	367,459 - 394,130 (-)	NCBI		HuRef
CHM1_1	20	416,126 - 443,204 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	20	479,231 - 506,260 (-)	NCBI		T2T-CHM13v2.0

Tbc1d20
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	2	152,135,745 - 152,155,914 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	2	152,135,748 - 152,155,916 (+)	Ensembl		GRCm39 Ensembl
GRCm38	2	152,293,826 - 152,313,994 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	2	152,293,828 - 152,313,996 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	2	152,119,608 - 152,138,326 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	2	151,985,313 - 152,004,031 (+)	NCBI		MGSCv36	mm8
Celera	2	158,107,984 - 158,126,733 (+)	NCBI		Celera
Cytogenetic Map	2	G3	NCBI
cM Map	2	74.83	NCBI

Tbc1d20
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955597	291,541 - 314,292 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955597	291,541 - 313,799 (-)	NCBI	ChiLan1.0	ChiLan1.0

TBC1D20
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	21	1,524,951 - 1,551,103 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	20	1,521,783 - 1,547,931 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	20	644,646 - 670,860 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	20	414,066 - 429,189 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	20	414,066 - 431,032 (-)	Ensembl	panpan1.1		panPan2

TBC1D20
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	24	20,400,647 - 20,419,652 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	24	20,400,791 - 20,419,655 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	24	20,054,600 - 20,073,599 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	24	21,093,909 - 21,112,923 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	24	21,093,893 - 21,112,920 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	24	20,368,969 - 20,388,211 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	24	20,475,176 - 20,494,176 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	24	20,905,480 - 20,924,706 (+)	NCBI		UU_Cfam_GSD_1.0

Tbc1d20
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024408640	169,603,422 - 169,624,377 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936485	18,034,732 - 18,055,767 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936485	18,034,776 - 18,055,741 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

TBC1D20
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	17	34,760,347 - 34,779,701 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	17	34,760,379 - 34,778,301 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	17	39,584,314 - 39,589,765 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

TBC1D20
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	2	56,065,975 - 56,093,521 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	2	56,066,042 - 56,094,333 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666078	7,861,563 - 7,886,879 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Tbc1d20
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624741	1,525,569 - 1,550,806 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624741	1,525,739 - 1,550,774 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Tbc1d20
120 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	107
Count of miRNA genes:	95
Interacting mature miRNAs:	101
Transcripts:	ENSRNOT00000008713
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2312673	Scl63	Serum cholesterol level QTL 63		0.001	blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	3	98535255	168026850	Rat
1578653	Vnigr3	Vascular neointimal growth QTL 3	3.1		artery morphology trait (VT:0002191)	artery neointimal hyperplastic lesion area (CMO:0001414)	3	130656562	169034231	Rat
1598877	Bp285	Blood pressure QTL 285	1.5	0.03	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	3	120538241	165538241	Rat
2302373	Gluco39	Glucose level QTL 39	5.01		blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	3	98535386	161695835	Rat
70216	Cm14	Cardiac mass QTL 14	2.1		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	3	31172320	163586636	Rat
2292591	Esta4	Estrogen-induced thymic atrophy QTL 4			thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	3	47233211	147415807	Rat
2298477	Eau4	Experimental allergic uveoretinitis QTL 4		0.0011	uvea integrity trait (VT:0010551)	experimental autoimmune uveitis score (CMO:0001504)	3	137398739	169034231	Rat
1581568	Rf53	Renal function QTL 53			urine total protein amount (VT:0000032)	urine protein excretion rate to body weight ratio (CMO:0001099)	3	56395968	161299569	Rat
1578754	Stresp16	Stress response QTL 16	4	0.001	blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	3	112681431	157681431	Rat
1300173	Rf11	Renal function QTL 11	3.38		renal blood flow trait (VT:2000006)	absolute change in renal blood flow rate (CMO:0001168)	3	121056165	145956249	Rat
9589106	Insul23	Insulin level QTL 23	13.86	0.001	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	3	131635904	169034231	Rat
10755461	Coatc16	Coat color QTL 16			coat/hair pigmentation trait (VT:0010463)	pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812)	3	122438700	167438700	Rat
8662816	Vetf4	Vascular elastic tissue fragility QTL 4	4		renal artery integrity trait (VT:0010642)	number of ruptures of the internal elastic lamina of the renal arteries (CMO:0002563)	3	59242096	157323038	Rat
1559282	Emca5	Estrogen-induced mammary cancer QTL 5	3.9		mammary gland integrity trait (VT:0010552)	percentage of study population developing mammary tumors during a period of time (CMO:0000948)	3	43827364	169034231	Rat
1354611	Despr2	Despair related QTL 2	3.03	0.0028	locomotor behavior trait (VT:0001392)	amount of time spent in voluntary immobility (CMO:0001043)	3	97084464	142084464	Rat
2303620	Vencon4	Ventilatory control QTL 4	3.9		respiration trait (VT:0001943)	tidal volume (CMO:0000222)	3	127162703	168026850	Rat
631841	Niddm39	Non-insulin dependent diabetes mellitus QTL 39	3.36		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	3	94856903	159898684	Rat
1576306	Schws3	Schwannoma susceptibility QTL 3		0.001	nervous system integrity trait (VT:0010566)	percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017)	3	118839124	163839124	Rat
619618	Rf3	Renal disease susceptibility QTL 3	6.5	0.001	urine albumin amount (VT:0002871)	urine albumin excretion rate to body weight ratio (CMO:0001270)	3	107693393	152693393	Rat
1300159	Kidm4	Kidney mass QTL 4	3.83		kidney mass (VT:0002707)	right kidney wet weight to body weight ratio (CMO:0001953)	3	121056165	157309487	Rat
5686842	Rf59	Renal function QTL 59			urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	3	140069424	146976080	Rat
631673	Iddm13	Insulin dependent diabetes mellitus QTL 13	1.3	0.663	blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	3	130193298	161695983	Rat
2312659	Slep7	Serum leptin concentration QTL 7		0.001	blood leptin amount (VT:0005667)	serum leptin level (CMO:0000780)	3	98535255	168026850	Rat
2301971	Cm71	Cardiac mass QTL 71	4.63		heart left ventricle mass (VT:0007031)	heart left ventricle weight (CMO:0000776)	3	41874578	155617519	Rat
2301970	Bw81	Body weight QTL 81	5.19		body mass (VT:0001259)	body weight (CMO:0000012)	3	41874578	155617519	Rat
1581546	Pur13	Proteinuria QTL 13	2.93	0.0335	urine total protein amount (VT:0000032)	urine protein excretion rate (CMO:0000759)	3	78196190	146592722	Rat
1578656	Vnigr2	Vascular neointimal growth QTL 2	4.2		artery morphology trait (VT:0002191)	lesioned artery residual lumen area (CMO:0001417)	3	130656562	169034231	Rat
8552952	Pigfal13	Plasma insulin-like growth factor 1 level QTL 13			blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	3	138799500	169034231	Rat
631541	Bp81	Blood pressure QTL 81	4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	3	124122556	169034231	Rat
2312670	Bw94	Body weight QTL 94		0.01	inguinal fat pad mass (VT:0010424)	inguinal fat pad weight to body weight ratio (CMO:0001253)	3	98535255	168026850	Rat
2293087	Iddm27	Insulin dependent diabetes mellitus QTL 27	2.68		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	3	97551417	147415807	Rat

Markers in Region

BE118229

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	3	140,782,217 - 140,782,367 (+)	MAPPER	mRatBN7.2
Rnor_6.0	3	147,786,155 - 147,786,304	NCBI	Rnor6.0
Rnor_5.0	3	154,134,296 - 154,134,445	UniSTS	Rnor5.0
RGSC_v3.4	3	142,637,294 - 142,637,443	UniSTS	RGSC3.4
Celera	3	139,534,565 - 139,534,714	UniSTS
RH 3.4 Map	3	1277.5	UniSTS
Cytogenetic Map	3	q41	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001004281	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_008762348	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039105482	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039105483	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039105485	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063284174	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063284175	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063284176	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC079383	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474050	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000003	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000008713 ⟹ ENSRNOP00000008713

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	3	140,768,537 - 140,785,121 (+)	Ensembl
Rnor_6.0 Ensembl	3	147,772,165 - 147,789,158 (+)	Ensembl

RefSeq Acc Id:

NM_001004281 ⟹ NP_001004281

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	161,228,848 - 161,245,430 (+)	NCBI
mRatBN7.2	3	140,768,537 - 140,785,121 (+)	NCBI
Rnor_6.0	3	147,772,155 - 147,789,058 (+)	NCBI
Rnor_5.0	3	154,120,296 - 154,137,199 (+)	NCBI
RGSC_v3.4	3	142,623,713 - 142,640,197 (+)	RGD
Celera	3	139,520,860 - 139,537,468 (+)	RGD

Sequence:

show sequence

CCGCGCGTCAGGCTCCGCCGCCAGCCGGGGCTCGGGCTGGGGCCCGGGCCCCCGGGGATGGCCC
TCCGGCCCTCAGAGGGCGACGGCTCCGCCGGCCGCTGGAACCGCGGCTCAGGGAAGGCAGACTT
TAATGCCAAAAGGAAAAAGAAGGTGGCGGAGATACACCAAGCTCTGAACAGTGATCCCACCGAT
GTGGCTGCCCTCCGACGAATGGCTATCAGCGAGGGCGGGCTCCTGACTGATGAGATCAGGTGCC
AAGTATGGCCTAAGCTCCTCAACGTCAACACCGATGAGCCACCGCCTATGTCAAGGAAGGATCT
TCGAGACATGAGCAAGGACTACCAGCAAGTGCTGCTGGACGTCAGGCGGTCTCTTCGGCGCTTC
CCTCCGGGCATGCCAGATGAGCAGAGAGAAGGGCTCCAGGAAGAGCTAATCGATATCATCCTCC
TCGTCTTGGATCGAAACCCTCAGCTCCACTACTACCAGGGCTACCATGACATTGTGGTCACTTT
TCTGCTGGTGGTGGGCGAGAGGCTGGCAACATCCCTGGTAGAAAAATTGTCCACCCACCACCTC
AGGGATTTCATGGATCCCACAATGGACAACACCAAGCACATCTTAAATTACCTGATGCCCATCA
TTGACCAAGTGAACCCAGAACTTCATGACTTCATGCAGAGTGCTGAGGTGGGGACCATCTTCGC
CCTCAGCTGGCTTATCACCTGGTTTGGGCACGTCCTGTTGGACTTCAGGCATGTGGTGAGGTTA
TACGACTTCTTCCTGGCCTGCCACCCACTCATGCCTATTTACTTTGCAGCTGTGATCGTGCTGT
ACCGGGAGCAGGAAGTGCTGGACTGTGACTGTGACATGGCCTCTGTTCACCACCTGTTGTCCCA
GATCCCTCAGGACCTGCCCTATGAGACGCTCATCAGCAGAGCAGGAGACCTCTTTGTTCAGTTT
CCCCCTTCTGAACTGGCAAGGGAGGCGGCTGCTCAGCAGGAGGCGGAGAGAACGGCAGCCTCTA
CTTTCAAAGACTTTGAGCTGGCGTCAACTCAGCAGAGGCCAGACATGGTGCTGCGGCAGCGGTT
TCGGGGACTTCTGAGGCCTGAGGCTCGAACAAAAGATGTCCTGACCAAACCAAGGACCAACCGC
TTTGTAAAACTGGCAGTGATGGGGCTGACGGTGGCCCTAGGAGCAGCAGCACTGGCAGTGGTGA
AGAGTGCCCTGGAGTGGGCCCCTAAGTTCCAGCTGCAGCTGTTCCCCTAAACTCAGCTCAATCA
GCCACTTCCTCGCCAGTGCACCAAGCTCTCCCCATTTCCGGAAAGAGGGTGCAATTGCTGTGAT
TAAAGGGTTTCTGTCAGGGGAAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_039105482 ⟹ XP_038961410

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	161,229,001 - 161,247,319 (+)	NCBI
mRatBN7.2	3	140,768,675 - 140,787,010 (+)	NCBI

RefSeq Acc Id:

XM_039105483 ⟹ XP_038961411

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	161,228,998 - 161,247,319 (+)	NCBI
mRatBN7.2	3	140,768,673 - 140,787,010 (+)	NCBI

RefSeq Acc Id:

XM_039105485 ⟹ XP_038961413

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	161,228,995 - 161,247,319 (+)	NCBI
mRatBN7.2	3	140,768,671 - 140,784,996 (+)	NCBI

RefSeq Acc Id:

XM_063284174 ⟹ XP_063140244

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	161,228,699 - 161,247,319 (+)	NCBI

RefSeq Acc Id:

XM_063284175 ⟹ XP_063140245

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	161,229,658 - 161,247,319 (+)	NCBI

RefSeq Acc Id:

XM_063284176 ⟹ XP_063140246

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	161,228,699 - 161,247,319 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_001004281	(Get FASTA)	NCBI Sequence Viewer
	XP_038961410	(Get FASTA)	NCBI Sequence Viewer
	XP_038961411	(Get FASTA)	NCBI Sequence Viewer
	XP_038961413	(Get FASTA)	NCBI Sequence Viewer
	XP_063140244	(Get FASTA)	NCBI Sequence Viewer
	XP_063140245	(Get FASTA)	NCBI Sequence Viewer
	XP_063140246	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH79383	(Get FASTA)	NCBI Sequence Viewer
	EDL86079	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000008713.2

RefSeq Acc Id:

NP_001004281 ⟸ NM_001004281

- UniProtKB:

Q6AXR1 (UniProtKB/TrEMBL), A6KHM6 (UniProtKB/TrEMBL), F7EVY6 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MALRPSEGDGSAGRWNRGSGKADFNAKRKKKVAEIHQALNSDPTDVAALRRMAISEGGLLTDEI
RCQVWPKLLNVNTDEPPPMSRKDLRDMSKDYQQVLLDVRRSLRRFPPGMPDEQREGLQEELIDI
ILLVLDRNPQLHYYQGYHDIVVTFLLVVGERLATSLVEKLSTHHLRDFMDPTMDNTKHILNYLM
PIIDQVNPELHDFMQSAEVGTIFALSWLITWFGHVLLDFRHVVRLYDFFLACHPLMPIYFAAVI
VLYREQEVLDCDCDMASVHHLLSQIPQDLPYETLISRAGDLFVQFPPSELAREAAAQQEAERTA
ASTFKDFELASTQQRPDMVLRQRFRGLLRPEARTKDVLTKPRTNRFVKLAVMGLTVALGAAALA
VVKSALEWAPKFQLQLFP

hide sequence

Ensembl Acc Id:

ENSRNOP00000008713 ⟸ ENSRNOT00000008713

RefSeq Acc Id:	XP_038961413 ⟸ XM_039105485
- Peptide Label:	isoform X5

RefSeq Acc Id:	XP_038961411 ⟸ XM_039105483
- Peptide Label:	isoform X2

RefSeq Acc Id:	XP_038961410 ⟸ XM_039105482
- Peptide Label:	isoform X1

RefSeq Acc Id:	XP_063140244 ⟸ XM_063284174
- Peptide Label:	isoform X3

RefSeq Acc Id:	XP_063140246 ⟸ XM_063284176
- Peptide Label:	isoform X6

RefSeq Acc Id:	XP_063140245 ⟸ XM_063284175
- Peptide Label:	isoform X4

Protein Domains

Rab-GAP TBC

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q6AXR1-F1-model_v2	AlphaFold	Q6AXR1	1-402	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13692532

Promoter ID:

EPDNEW_R3057

Type:

initiation region

Name:

Tbc1d20_1

Description:

TBC1 domain family, member 20

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	3	147,772,114 - 147,772,174	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1303293	AgrOrtholog
BioCyc Gene	G2FUF-47278	BioCyc
Ensembl Genes	ENSRNOG00000005766	Ensembl, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000008713.5	UniProtKB/TrEMBL
Gene3D-CATH	1.10.8.1310	UniProtKB/TrEMBL
	Ypt/Rab-GAP domain of gyp1p, domain 3	UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7111239	IMAGE-MGC_LOAD
InterPro	Rab-GTPase_TBC_sf	UniProtKB/TrEMBL
	RabGAP_TBC	UniProtKB/TrEMBL
	TBC20/Gyp8-like	UniProtKB/TrEMBL
KEGG Report	rno:362237	UniProtKB/TrEMBL
MGC_CLONE	MGC:94895	IMAGE-MGC_LOAD
NCBI Gene	362237	ENTREZGENE
PANTHER	PTHR20913	UniProtKB/TrEMBL
	TBC1 DOMAIN FAMILY MEMBER 20	UniProtKB/TrEMBL
Pfam	TBC	UniProtKB/TrEMBL
PhenoGen	Tbc1d20	PhenoGen
PROSITE	TBC_RABGAP	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000005766	RatGTEx
SMART	TBC	UniProtKB/TrEMBL
Superfamily-SCOP	RabGAP_TBC	UniProtKB/TrEMBL
UniProt	A6KHM6	ENTREZGENE, UniProtKB/TrEMBL
	F7EVY6	ENTREZGENE, UniProtKB/TrEMBL
	Q6AXR1	ENTREZGENE
UniProt Secondary	Q6AXR1	UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2006-03-30	Tbc1d20	TBC1 domain family, member 20	MGC94895	similar to chromosome 20 open reading frame 140	Symbol and Name updated	1299863	APPROVED
2005-09-30	MGC94895				Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM