Symbol:
Myadm
Name:
myeloid-associated differentiation marker
RGD ID:
727835
Description:
Predicted to be involved in several processes, including negative regulation of actin filament polymerization; negative regulation of heterotypic cell-cell adhesion; and positive regulation of substrate adhesion-dependent cell spreading. Predicted to be located in cortical actin cytoskeleton; membrane raft; and ruffle. Predicted to be active in cell-cell junction and plasma membrane. Orthologous to human MYADM (myeloid associated differentiation marker); INTERACTS WITH 1-naphthyl isothiocyanate; 2,3,7,8-tetrachlorodibenzodioxine; 2,6-dinitrotoluene.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
myeloid up-regulated protein
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 74,779,616 - 74,796,752 (-) NCBI GRCr8 mRatBN7.2 1 65,864,180 - 65,874,701 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 65,864,173 - 65,874,035 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 71,312,366 - 71,320,711 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 79,735,339 - 79,743,684 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 73,068,572 - 73,076,904 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 64,438,465 - 64,448,332 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 64,438,472 - 64,446,818 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 63,430,406 - 63,440,255 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 64,177,547 - 64,185,893 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 64,255,658 - 64,264,004 (-) NCBI Celera 1 63,588,895 - 63,597,242 (-) NCBI Celera Cytogenetic Map 1 q12 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Myadm Rat (-)-alpha-phellandrene increases expression ISO MYADM (Homo sapiens) 6480464 alpha phellandrene results in increased expression of MYADM mRNA CTD PMID:25075043 Myadm Rat (-)-demecolcine increases expression ISO MYADM (Homo sapiens) 6480464 Demecolcine results in increased expression of MYADM mRNA CTD PMID:23649840 Myadm Rat (1->4)-beta-D-glucan multiple interactions ISO Myadm (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of MYADM mRNA CTD PMID:36331819 Myadm Rat 1,2-dimethylhydrazine increases expression ISO Myadm (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in increased expression of MYADM mRNA CTD PMID:22206623 Myadm Rat 1,2-dimethylhydrazine multiple interactions ISO Myadm (Mus musculus) 6480464 Folic Acid inhibits the reaction [1 and 2-Dimethylhydrazine results in increased expression of MYADM mRNA] CTD PMID:22206623 Myadm Rat 1-naphthyl isothiocyanate increases expression EXP 6480464 1-Naphthylisothiocyanate results in increased expression of MYADM mRNA CTD PMID:25380136 and PMID:30723492 Myadm Rat 17beta-estradiol multiple interactions ISO MYADM (Homo sapiens) 6480464 EGF protein inhibits the reaction [Estradiol results in decreased expression of MYADM mRNA] CTD PMID:24758408 Myadm Rat 17beta-estradiol increases expression ISO MYADM (Homo sapiens) 6480464 Estradiol results in increased expression of MYADM mRNA CTD PMID:31614463 Myadm Rat 17beta-estradiol decreases expression ISO Myadm (Mus musculus) 6480464 Estradiol results in decreased expression of MYADM mRNA CTD PMID:39298647 Myadm Rat 17beta-estradiol decreases expression ISO MYADM (Homo sapiens) 6480464 Estradiol results in decreased expression of MYADM mRNA CTD PMID:24758408 Myadm Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO MYADM (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in increased expression of MYADM mRNA CTD PMID:20106945 Myadm Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of MYADM mRNA CTD PMID:34747641 Myadm Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Myadm (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of MYADM mRNA CTD PMID:21570461 Myadm Rat 2,6-dinitrotoluene affects expression EXP 6480464 2 and 6-dinitrotoluene affects the expression of MYADM mRNA CTD PMID:21346803 Myadm Rat 2-hydroxypropanoic acid affects expression ISO MYADM (Homo sapiens) 6480464 Lactic Acid affects the expression of MYADM mRNA CTD PMID:30851411 Myadm Rat 2-methylcholine affects expression ISO MYADM (Homo sapiens) 6480464 beta-methylcholine affects the expression of MYADM mRNA CTD PMID:21179406 Myadm Rat 3H-1,2-dithiole-3-thione decreases expression EXP 6480464 1 and 2-dithiol-3-thione results in decreased expression of MYADM mRNA CTD PMID:19162173 Myadm Rat 4,4'-diaminodiphenylmethane increases expression EXP 6480464 4 and 4'-diaminodiphenylmethane results in increased expression of MYADM mRNA CTD PMID:25380136 Myadm Rat 4,4'-sulfonyldiphenol increases expression ISO Myadm (Mus musculus) 6480464 bisphenol S results in increased expression of MYADM mRNA CTD PMID:30951980 Myadm Rat 4,4'-sulfonyldiphenol multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of MYADM mRNA CTD PMID:36041667 Myadm Rat 4,4'-sulfonyldiphenol increases expression ISO MYADM (Homo sapiens) 6480464 bisphenol S results in increased expression of MYADM protein CTD PMID:34186270 Myadm Rat 4,4'-sulfonyldiphenol decreases expression ISO Myadm (Mus musculus) 6480464 bisphenol S results in decreased expression of MYADM mRNA CTD PMID:39298647 Myadm Rat 5-methoxy-2-\{[(4-methoxy-3,5-dimethylpyridin-2-yl)methyl]sulfinyl\}-1H-benzimidazole affects expression EXP 6480464 Omeprazole affects the expression of MYADM mRNA CTD PMID:19483382 Myadm Rat 6-propyl-2-thiouracil affects expression EXP 6480464 Propylthiouracil affects the expression of MYADM mRNA CTD PMID:19483382 Myadm Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of MYADM mRNA CTD PMID:25825206 Myadm Rat acetamide increases expression EXP 6480464 acetamide results in increased expression of MYADM mRNA CTD PMID:31881176 Myadm Rat aflatoxin B1 affects expression ISO MYADM (Homo sapiens) 6480464 Aflatoxin B1 affects the expression of MYADM protein CTD PMID:20106945 Myadm Rat all-trans-retinoic acid increases expression ISO MYADM (Homo sapiens) 6480464 Tretinoin results in increased expression of MYADM mRNA CTD PMID:33167477 Myadm Rat alpha-phellandrene increases expression ISO MYADM (Homo sapiens) 6480464 alpha phellandrene results in increased expression of MYADM mRNA CTD PMID:25075043 Myadm Rat amiodarone affects expression EXP 6480464 Amiodarone affects the expression of MYADM mRNA CTD PMID:19483382 Myadm Rat amitrole decreases expression EXP 6480464 Amitrole results in decreased expression of MYADM mRNA CTD PMID:38685447 Myadm Rat amphetamine increases expression EXP 6480464 Amphetamine results in increased expression of MYADM mRNA CTD PMID:30779732 Myadm Rat arsane multiple interactions ISO MYADM (Homo sapiens) 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of MYADM mRNA CTD PMID:39836092 Myadm Rat arsenic atom multiple interactions ISO MYADM (Homo sapiens) 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of MYADM mRNA CTD PMID:39836092 Myadm Rat atrazine decreases expression EXP 6480464 Atrazine results in decreased expression of MYADM mRNA CTD PMID:36841081 Myadm Rat benzbromarone affects expression EXP 6480464 Benzbromarone affects the expression of MYADM mRNA CTD PMID:19483382 Myadm Rat benzo[a]pyrene decreases expression ISO Myadm (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of MYADM mRNA CTD PMID:19770486 Myadm Rat benzo[a]pyrene increases expression ISO MYADM (Homo sapiens) 6480464 Benzo(a)pyrene results in increased expression of MYADM mRNA CTD PMID:32234424 Myadm Rat benzo[a]pyrene affects methylation ISO MYADM (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of MYADM promoter CTD PMID:27901495 Myadm Rat benzo[a]pyrene increases methylation ISO MYADM (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of MYADM 5' UTR and Benzo(a)pyrene results in increased methylation of MYADM exon CTD PMID:27901495 Myadm Rat benzo[a]pyrene decreases methylation ISO MYADM (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased methylation of MYADM 3' UTR CTD PMID:27901495 Myadm Rat benzo[a]pyrene multiple interactions ISO Myadm (Mus musculus) 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in decreased expression of MYADM mRNA CTD PMID:27858113 Myadm Rat benzo[a]pyrene diol epoxide I increases expression ISO MYADM (Homo sapiens) 6480464 7 more ... CTD PMID:20018196 Myadm Rat benzo[b]fluoranthene multiple interactions ISO Myadm (Mus musculus) 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in decreased expression of MYADM mRNA CTD PMID:27858113 Myadm Rat bisphenol A increases expression ISO Myadm (Mus musculus) 6480464 bisphenol A results in increased expression of MYADM mRNA CTD PMID:26063408 and PMID:30951980 Myadm Rat bisphenol A increases expression ISO MYADM (Homo sapiens) 6480464 bisphenol A results in increased expression of MYADM protein CTD PMID:37567409 Myadm Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of MYADM mRNA CTD PMID:36041667 Myadm Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of MYADM mRNA CTD PMID:30816183 more ... Myadm Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of MYADM mRNA CTD PMID:25181051 Myadm Rat bisphenol AF increases expression ISO MYADM (Homo sapiens) 6480464 bisphenol AF results in increased expression of MYADM protein CTD PMID:34186270 Myadm Rat Bisphenol B increases expression ISO MYADM (Homo sapiens) 6480464 bisphenol B results in increased expression of MYADM protein CTD PMID:34186270 Myadm Rat bisphenol F increases expression ISO Myadm (Mus musculus) 6480464 bisphenol F results in increased expression of MYADM mRNA CTD PMID:30951980 Myadm Rat bisphenol F multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of MYADM mRNA CTD PMID:36041667 Myadm Rat bisphenol F increases expression ISO MYADM (Homo sapiens) 6480464 bisphenol F results in increased expression of MYADM protein CTD PMID:34186270 Myadm Rat cadmium atom multiple interactions ISO MYADM (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of MYADM mRNA CTD PMID:35301059 Myadm Rat cadmium dichloride affects expression EXP 6480464 Cadmium Chloride affects the expression of MYADM mRNA CTD PMID:22110744 Myadm Rat cadmium dichloride multiple interactions ISO MYADM (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of MYADM mRNA CTD PMID:35301059 Myadm Rat cadmium dichloride increases expression ISO MYADM (Homo sapiens) 6480464 Cadmium Chloride results in increased expression of MYADM mRNA CTD PMID:38382870 Myadm Rat cantharidin decreases expression ISO Myadm (Mus musculus) 6480464 Cantharidin results in decreased expression of MYADM mRNA CTD PMID:36907384 Myadm Rat carbamazepine affects expression ISO MYADM (Homo sapiens) 6480464 Carbamazepine affects the expression of MYADM mRNA CTD PMID:25979313 Myadm Rat carbon nanotube increases expression ISO Myadm (Mus musculus) 6480464 Nanotubes and Carbon results in increased expression of MYADM mRNA CTD PMID:25554681 Myadm Rat chlorpyrifos increases expression ISO Myadm (Mus musculus) 6480464 Chlorpyrifos results in increased expression of MYADM mRNA CTD PMID:32715474 Myadm Rat chrysene multiple interactions ISO Myadm (Mus musculus) 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in decreased expression of MYADM mRNA CTD PMID:27858113 Myadm Rat cisplatin decreases expression ISO MYADM (Homo sapiens) 6480464 Cisplatin results in decreased expression of MYADM mRNA CTD PMID:27594783 Myadm Rat clofibrate affects expression EXP 6480464 Clofibrate affects the expression of MYADM mRNA CTD PMID:19483382 Myadm Rat clozapine multiple interactions ISO MYADM (Homo sapiens) 6480464 [Cuprizone co-treated with Clozapine] results in decreased expression of MYADM protein CTD PMID:34122009 Myadm Rat cobalt dichloride decreases expression ISO MYADM (Homo sapiens) 6480464 cobaltous chloride results in decreased expression of MYADM mRNA CTD PMID:19320972 Myadm Rat crocidolite asbestos increases expression ISO MYADM (Homo sapiens) 6480464 Asbestos and Crocidolite results in increased expression of MYADM mRNA CTD PMID:29523930 Myadm Rat Cuprizon increases expression ISO MYADM (Homo sapiens) 6480464 Cuprizone results in increased expression of MYADM protein CTD PMID:34122009 Myadm Rat Cuprizon multiple interactions ISO MYADM (Homo sapiens) 6480464 [Cuprizone co-treated with Clozapine] results in decreased expression of MYADM protein and [Cuprizone co-treated with Haloperidol] results in decreased expression of MYADM protein CTD PMID:34122009 Myadm Rat cyclosporin A increases expression ISO MYADM (Homo sapiens) 6480464 Cyclosporine results in increased expression of MYADM mRNA CTD PMID:20106945 and PMID:25562108 Myadm Rat cytarabine decreases expression ISO MYADM (Homo sapiens) 6480464 Cytarabine results in decreased expression of MYADM mRNA CTD PMID:21198554 Myadm Rat Dibutyl phosphate affects expression ISO MYADM (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of MYADM mRNA CTD PMID:37042841 Myadm Rat dibutyl phthalate increases expression ISO Myadm (Mus musculus) 6480464 Dibutyl Phthalate results in increased expression of MYADM mRNA CTD PMID:21266533 Myadm Rat dicrotophos increases expression ISO MYADM (Homo sapiens) 6480464 dicrotophos results in increased expression of MYADM mRNA CTD PMID:28302478 Myadm Rat dieldrin increases expression ISO MYADM (Homo sapiens) 6480464 Dieldrin results in increased expression of MYADM mRNA CTD PMID:31068361 Myadm Rat flutamide decreases expression EXP 6480464 Flutamide results in decreased expression of MYADM mRNA CTD PMID:24136188 and PMID:24793618 Myadm Rat folic acid multiple interactions ISO Myadm (Mus musculus) 6480464 Folic Acid inhibits the reaction [1 and 2-Dimethylhydrazine results in increased expression of MYADM mRNA] CTD PMID:22206623 Myadm Rat furan increases expression EXP 6480464 furan results in increased expression of MYADM mRNA CTD PMID:26194646 Myadm Rat glafenine increases expression EXP 6480464 Glafenine results in increased expression of MYADM mRNA CTD PMID:24136188 Myadm Rat haloperidol multiple interactions ISO MYADM (Homo sapiens) 6480464 [Cuprizone co-treated with Haloperidol] results in decreased expression of MYADM protein CTD PMID:34122009 Myadm Rat hydrogen peroxide affects expression ISO MYADM (Homo sapiens) 6480464 Hydrogen Peroxide affects the expression of MYADM mRNA CTD PMID:20044591 Myadm Rat inulin multiple interactions ISO Myadm (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of MYADM mRNA CTD PMID:36331819 Myadm Rat isobutanol multiple interactions ISO MYADM (Homo sapiens) 6480464 [[Gasoline co-treated with isobutyl alcohol] results in increased abundance of [Particulate Matter co-treated with Polycyclic Aromatic Hydrocarbons]] which results in increased expression of MYADM mRNA CTD PMID:29432896 Myadm Rat ivermectin decreases expression ISO MYADM (Homo sapiens) 6480464 Ivermectin results in decreased expression of MYADM protein CTD PMID:32959892 Myadm Rat L-ethionine affects expression EXP 6480464 Ethionine affects the expression of MYADM mRNA CTD PMID:19483382 Myadm Rat lead diacetate increases expression ISO MYADM (Homo sapiens) 6480464 lead acetate results in increased expression of MYADM mRNA CTD PMID:38568856 Myadm Rat lipopolysaccharide multiple interactions ISO MYADM (Homo sapiens) 6480464 [NAT10 protein affects the susceptibility to Lipopolysaccharides] which affects the expression of MYADM mRNA CTD PMID:35877022 Myadm Rat menadione affects expression ISO MYADM (Homo sapiens) 6480464 Vitamin K 3 affects the expression of MYADM mRNA CTD PMID:20044591 Myadm Rat N-nitrosodiethylamine increases expression ISO Myadm (Mus musculus) 6480464 Diethylnitrosamine results in increased expression of MYADM mRNA CTD PMID:24535843 Myadm Rat N-nitrosodimethylamine increases expression EXP 6480464 Dimethylnitrosamine results in increased expression of MYADM mRNA CTD PMID:25380136 Myadm Rat nickel atom increases expression ISO MYADM (Homo sapiens) 6480464 Nickel results in increased expression of MYADM mRNA CTD PMID:23195993 Myadm Rat nickel sulfate decreases expression ISO MYADM (Homo sapiens) 6480464 nickel sulfate results in decreased expression of MYADM mRNA CTD PMID:22714537 Myadm Rat omeprazole affects expression EXP 6480464 Omeprazole affects the expression of MYADM mRNA CTD PMID:19483382 Myadm Rat oxaliplatin multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in increased expression of MYADM mRNA CTD PMID:25729387 Myadm Rat paracetamol affects expression ISO Myadm (Mus musculus) 6480464 Acetaminophen affects the expression of MYADM mRNA CTD PMID:17562736 Myadm Rat paracetamol increases expression ISO MYADM (Homo sapiens) 6480464 Acetaminophen results in increased expression of MYADM mRNA CTD PMID:29067470 Myadm Rat paracetamol affects response to substance ISO MYADM (Homo sapiens) 6480464 MYADM gene polymorphism affects the susceptibility to Acetaminophen CTD PMID:26104854 Myadm Rat perfluorohexanesulfonic acid increases expression ISO Myadm (Mus musculus) 6480464 perfluorohexanesulfonic acid results in increased expression of MYADM mRNA CTD PMID:37995155 Myadm Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Myadm (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of MYADM mRNA and [perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of MYADM mRNA CTD PMID:36331819 Myadm Rat phenobarbital multiple interactions ISO Myadm (Mus musculus) 6480464 NR1I3 protein affects the reaction [Phenobarbital results in increased expression of MYADM mRNA] CTD PMID:19482888 Myadm Rat phenobarbital increases expression ISO Myadm (Mus musculus) 6480464 Phenobarbital results in increased expression of MYADM mRNA CTD PMID:19482888 Myadm Rat pirinixic acid increases expression ISO Myadm (Mus musculus) 6480464 pirinixic acid results in increased expression of MYADM mRNA CTD PMID:18301758 Myadm Rat pirinixic acid affects expression EXP 6480464 pirinixic acid affects the expression of MYADM mRNA CTD PMID:19483382 Myadm Rat progesterone increases expression ISO MYADM (Homo sapiens) 6480464 Progesterone results in increased expression of MYADM mRNA CTD PMID:21795739 Myadm Rat rac-lactic acid affects expression ISO MYADM (Homo sapiens) 6480464 Lactic Acid affects the expression of MYADM mRNA CTD PMID:30851411 Myadm Rat rotenone decreases expression EXP 6480464 Rotenone results in decreased expression of MYADM mRNA CTD PMID:28374803 Myadm Rat SB 431542 multiple interactions ISO MYADM (Homo sapiens) 6480464 [LDN 193189 co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide co-treated with FGF2 protein] results in decreased expression of MYADM protein CTD PMID:37664457 Myadm Rat silicon dioxide increases expression ISO MYADM (Homo sapiens) 6480464 Silicon Dioxide analog results in increased expression of MYADM mRNA CTD PMID:25895662 Myadm Rat sodium arsenite increases expression ISO MYADM (Homo sapiens) 6480464 sodium arsenite results in increased expression of MYADM mRNA CTD PMID:24570342 more ... Myadm Rat sodium arsenite increases expression ISO Myadm (Mus musculus) 6480464 sodium arsenite results in increased expression of MYADM mRNA CTD PMID:36209798 Myadm Rat sodium arsenite multiple interactions ISO MYADM (Homo sapiens) 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of MYADM mRNA CTD PMID:39836092 Myadm Rat sodium arsenite decreases expression ISO MYADM (Homo sapiens) 6480464 sodium arsenite results in decreased expression of MYADM mRNA CTD PMID:34032870 Myadm Rat sodium arsenite increases methylation ISO MYADM (Homo sapiens) 6480464 sodium arsenite results in increased methylation of MYADM gene CTD PMID:24570342 Myadm Rat sodium arsenite increases expression EXP 6480464 sodium arsenite results in increased expression of MYADM mRNA CTD PMID:21297353 Myadm Rat temozolomide increases expression ISO MYADM (Homo sapiens) 6480464 Temozolomide results in increased expression of MYADM mRNA CTD PMID:31758290 Myadm Rat testosterone decreases expression ISO Myadm (Mus musculus) 6480464 Testosterone results in decreased expression of MYADM mRNA CTD PMID:20403060 Myadm Rat tetrachloromethane increases expression ISO Myadm (Mus musculus) 6480464 Carbon Tetrachloride results in increased expression of MYADM mRNA CTD PMID:31919559 Myadm Rat tetraphene decreases expression ISO Myadm (Mus musculus) 6480464 benz(a)anthracene results in decreased expression of MYADM mRNA CTD PMID:26377693 Myadm Rat tetraphene multiple interactions ISO Myadm (Mus musculus) 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in decreased expression of MYADM mRNA CTD PMID:27858113 Myadm Rat thioacetamide affects expression EXP 6480464 Thioacetamide affects the expression of MYADM mRNA CTD PMID:19483382 Myadm Rat thiram increases expression ISO MYADM (Homo sapiens) 6480464 Thiram results in increased expression of MYADM mRNA CTD PMID:38568856 Myadm Rat topotecan multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in increased expression of MYADM mRNA CTD PMID:25729387 Myadm Rat triphenyl phosphate affects expression ISO MYADM (Homo sapiens) 6480464 triphenyl phosphate affects the expression of MYADM mRNA CTD PMID:37042841 Myadm Rat triptonide decreases expression ISO Myadm (Mus musculus) 6480464 triptonide results in decreased expression of MYADM mRNA CTD PMID:33045310 Myadm Rat urethane increases expression ISO MYADM (Homo sapiens) 6480464 Urethane results in increased expression of MYADM mRNA CTD PMID:28818685 Myadm Rat valproic acid increases expression ISO MYADM (Homo sapiens) 6480464 Valproic Acid results in increased expression of MYADM mRNA CTD PMID:19101580 and PMID:23179753 Myadm Rat vancomycin decreases expression ISO Myadm (Mus musculus) 6480464 Vancomycin results in decreased expression of MYADM mRNA CTD PMID:18930951 Myadm Rat vinclozolin affects expression EXP 6480464 vinclozolin affects the expression of MYADM mRNA CTD PMID:19015723 Myadm Rat vinclozolin increases expression EXP 6480464 vinclozolin results in increased expression of MYADM mRNA CTD PMID:23034163
(-)-alpha-phellandrene (ISO) (-)-demecolcine (ISO) (1->4)-beta-D-glucan (ISO) 1,2-dimethylhydrazine (ISO) 1-naphthyl isothiocyanate (EXP) 17beta-estradiol (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,6-dinitrotoluene (EXP) 2-hydroxypropanoic acid (ISO) 2-methylcholine (ISO) 3H-1,2-dithiole-3-thione (EXP) 4,4'-diaminodiphenylmethane (EXP) 4,4'-sulfonyldiphenol (EXP,ISO) 5-methoxy-2-\{[(4-methoxy-3,5-dimethylpyridin-2-yl)methyl]sulfinyl\}-1H-benzimidazole (EXP) 6-propyl-2-thiouracil (EXP) acetamide (EXP) aflatoxin B1 (ISO) all-trans-retinoic acid (ISO) alpha-phellandrene (ISO) amiodarone (EXP) amitrole (EXP) amphetamine (EXP) arsane (ISO) arsenic atom (ISO) atrazine (EXP) benzbromarone (EXP) benzo[a]pyrene (ISO) benzo[a]pyrene diol epoxide I (ISO) benzo[b]fluoranthene (ISO) bisphenol A (EXP,ISO) bisphenol AF (ISO) Bisphenol B (ISO) bisphenol F (EXP,ISO) cadmium atom (ISO) cadmium dichloride (EXP,ISO) cantharidin (ISO) carbamazepine (ISO) carbon nanotube (ISO) chlorpyrifos (ISO) chrysene (ISO) cisplatin (ISO) clofibrate (EXP) clozapine (ISO) cobalt dichloride (ISO) crocidolite asbestos (ISO) Cuprizon (ISO) cyclosporin A (ISO) cytarabine (ISO) Dibutyl phosphate (ISO) dibutyl phthalate (ISO) dicrotophos (ISO) dieldrin (ISO) flutamide (EXP) folic acid (ISO) furan (EXP) glafenine (EXP) haloperidol (ISO) hydrogen peroxide (ISO) inulin (ISO) isobutanol (ISO) ivermectin (ISO) L-ethionine (EXP) lead diacetate (ISO) lipopolysaccharide (ISO) menadione (ISO) N-nitrosodiethylamine (ISO) N-nitrosodimethylamine (EXP) nickel atom (ISO) nickel sulfate (ISO) omeprazole (EXP) oxaliplatin (EXP) paracetamol (ISO) perfluorohexanesulfonic acid (ISO) perfluorooctane-1-sulfonic acid (ISO) phenobarbital (ISO) pirinixic acid (EXP,ISO) progesterone (ISO) rac-lactic acid (ISO) rotenone (EXP) SB 431542 (ISO) silicon dioxide (ISO) sodium arsenite (EXP,ISO) temozolomide (ISO) testosterone (ISO) tetrachloromethane (ISO) tetraphene (ISO) thioacetamide (EXP) thiram (ISO) topotecan (EXP) triphenyl phosphate (ISO) triptonide (ISO) urethane (ISO) valproic acid (ISO) vancomycin (ISO) vinclozolin (EXP)
Biological Process
cell-cell junction maintenance (ISO) establishment of endothelial barrier (IEA,ISO) intracellular signal transduction (IEA,ISO) membrane raft organization (IEA,ISO) negative regulation of actin filament polymerization (IEA,ISO) negative regulation of gene expression (IEA,ISO) negative regulation of heterotypic cell-cell adhesion (IBA,IEA,ISO) positive regulation of cell migration (IEA,ISO) positive regulation of substrate adhesion-dependent cell spreading (IEA,ISO) protein localization to plasma membrane raft (IEA,ISO) regulation of cell-substrate adhesion (ISO)
Myadm Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 74,779,616 - 74,796,752 (-) NCBI GRCr8 mRatBN7.2 1 65,864,180 - 65,874,701 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 65,864,173 - 65,874,035 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 71,312,366 - 71,320,711 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 79,735,339 - 79,743,684 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 73,068,572 - 73,076,904 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 64,438,465 - 64,448,332 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 64,438,472 - 64,446,818 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 63,430,406 - 63,440,255 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 64,177,547 - 64,185,893 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 64,255,658 - 64,264,004 (-) NCBI Celera 1 63,588,895 - 63,597,242 (-) NCBI Celera Cytogenetic Map 1 q12 NCBI
MYADM Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 19 53,865,628 - 53,876,435 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 19 53,864,763 - 53,878,125 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 19 54,368,882 - 54,379,689 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 19 59,061,423 - 59,071,501 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 19 59,062,948 - 59,070,607 NCBI Celera 19 51,410,687 - 51,420,740 (+) NCBI Celera Cytogenetic Map 19 q13.42 NCBI HuRef 19 50,688,935 - 50,698,996 (+) NCBI HuRef CHM1_1 19 54,371,421 - 54,381,447 (+) NCBI CHM1_1 T2T-CHM13v2.0 19 56,945,407 - 56,956,143 (+) NCBI T2T-CHM13v2.0
Myadm Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 7 3,337,563 - 3,347,871 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 7 3,337,605 - 3,348,958 (+) Ensembl GRCm39 Ensembl GRCm38 7 3,289,038 - 3,299,355 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 7 3,289,080 - 3,300,442 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 7 3,289,039 - 3,299,350 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 Celera 7 3,239,892 - 3,250,194 (+) NCBI Celera Cytogenetic Map 7 A1 NCBI cM Map 7 1.92 NCBI
Myadm Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955604 280,977 - 284,381 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955604 280,977 - 284,381 (-) NCBI ChiLan1.0 ChiLan1.0
MYADM Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 20 59,878,608 - 59,888,754 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 19 61,800,611 - 61,810,691 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 19 50,807,615 - 50,817,196 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 19 59,656,521 - 59,666,643 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 19 59,663,790 - 59,664,758 (+) Ensembl panpan1.1 panPan2
MYADM Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 1 103,315,606 - 103,322,329 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 1 103,381,284 - 103,388,479 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 1 103,969,865 - 103,977,066 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 1 103,970,647 - 103,977,121 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 1 103,602,297 - 103,609,488 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 1 103,364,030 - 103,371,220 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 1 104,083,017 - 104,090,213 (-) NCBI UU_Cfam_GSD_1.0
Myadm
MYADM Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 6 56,236,311 - 56,244,185 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 6 56,236,306 - 56,278,577 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 6 52,971,110 - 52,978,880 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
MYADM Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 6 46,559,943 - 46,568,057 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 6 46,566,968 - 46,567,936 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666073 26,638,157 - 26,648,060 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Myadm
.
Predicted Target Of
Count of predictions: 759 Count of miRNA genes: 278 Interacting mature miRNAs: 344 Transcripts: ENSRNOT00000022264 Prediction methods: Microtar, Miranda, Targetscan Result types: miRGate_prediction
1331732 Srn4 Serum renin concentration QTL 4 4.467 renin activity (VT:0005581) plasma renin activity level (CMO:0000116) 1 35239598 78430678 Rat 2313059 Bss55 Bone structure and strength QTL 55 3.2 0.0001 tibia size trait (VT:0100001) tibia midshaft cross-sectional area (CMO:0001717) 1 43284731 118944897 Rat 631688 Hcas2 Hepatocarcinoma susceptibility QTL 2 3 0.0001 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 1 5925874 115540829 Rat 1578649 Bmd8 Bone mineral density QTL 8 4.9 femur mineral mass (VT:0010011) trabecular volumetric bone mineral density (CMO:0001729) 1 49393172 94393172 Rat 1358359 Sradr1 Stress Responsive Adrenal Weight QTL 1 4.74 adrenal gland mass (VT:0010420) both adrenal glands wet weight (CMO:0000164) 1 30882023 123479925 Rat 634314 Niddm44 Non-insulin dependent diabetes mellitus QTL 44 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 49393289 199050459 Rat 4889929 Bss87 Bone structure and strength QTL 87 6.7 tibia area (VT:1000281) tibia-fibula cortical bone endosteal cross-sectional area (CMO:0001722) 1 53895117 82174945 Rat 1331792 Rf29 Renal function QTL 29 4.589 urine potassium amount (VT:0010539) urine potassium level (CMO:0000128) 1 35239598 78430678 Rat 2313062 Bmd73 Bone mineral density QTL 73 3.9 0.0001 tibia mineral mass (VT:1000283) compact volumetric bone mineral density (CMO:0001730) 1 11481312 82174945 Rat 8552900 Pigfal1 Plasma insulin-like growth factor 1 level QTL 1 7.4 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 1 34836858 79836858 Rat 1578654 Bss10 Bone structure and strength QTL 10 4 femur morphology trait (VT:0000559) femoral neck cortical cross-sectional area (CMO:0001702) 1 49393172 159356837 Rat 1554320 Bmd1 Bone mineral density QTL 1 12.2 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 1 509108 86060548 Rat 1354643 Foco2 Food consumption QTL 2 7.17 0.0001 eating behavior trait (VT:0001431) food intake rate (CMO:0000427) 1 33449848 78449848 Rat 2302059 Pia36 Pristane induced arthritis QTL 36 3.8 0.001 blood immunoglobulin amount (VT:0002460) serum immunoglobulin G1 level (CMO:0002115) 1 43333002 88333002 Rat 2313065 Bss67 Bone structure and strength QTL 67 3.1 0.0001 tibia area (VT:1000281) tibia total energy absorbed before break (CMO:0001736) 1 11481312 82174945 Rat 1300121 Hrtrt1 Heart rate QTL 1 3.7 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 1 65789093 115540829 Rat 1357400 Bw62 Body weight QTL62 4.05 inguinal fat pad mass (VT:0010424) inguinal fat pad weight to body weight ratio (CMO:0001253) 1 22340647 67340647 Rat 2313069 Bss68 Bone structure and strength QTL 68 2.9 0.0001 tibia size trait (VT:0100001) tibia total energy absorbed before break (CMO:0001736) 1 11481312 82174945 Rat 631495 Bp96 Blood pressure QTL 96 4.52 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 22340647 102268831 Rat 2313075 Bss66 Bone structure and strength QTL 66 3.4 0.0001 tibia length (VT:0004357) tibia length (CMO:0000450) 1 11481312 82174945 Rat 70225 Bp58 Blood pressure QTL 58 3.3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 32356093 162846471 Rat 2298545 Neuinf8 Neuroinflammation QTL 8 4.6 nervous system integrity trait (VT:0010566) spinal cord beta-2 microglobulin mRNA level (CMO:0002125) 1 57336763 151090257 Rat 2313072 Bss53 Bone structure and strength QTL 53 4.3 0.0001 tibia length (VT:0004357) tibia length (CMO:0000450) 1 43284731 118944897 Rat 1300167 Hrtrt2 Heart rate QTL 2 4.35 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 1 11481312 75088344 Rat 10059597 Bp377 Blood pressure QTL 377 3.42 0.025 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 32737458 199368955 Rat 2313078 Bss54 Bone structure and strength QTL 54 3.5 0.0001 tibia area (VT:1000281) tibia midshaft cross-sectional area (CMO:0001717) 1 43284731 118944897 Rat 2313077 Bss69 Bone structure and strength QTL 69 3.5 0.0001 tibia strength trait (VT:1000284) bone polar moment of inertia (CMO:0001558) 1 11481312 82174945 Rat 1331778 Rf28 Renal function QTL 28 4.66 urine potassium amount (VT:0010539) urine potassium excretion rate (CMO:0000761) 1 45803140 78430678 Rat 2313402 Anxrr24 Anxiety related response QTL 24 aggression-related behavior trait (VT:0015014) tameness/aggressiveness composite score (CMO:0002136) 1 48963584 144267916 Rat 1331785 Rf27 Renal function QTL 27 4.643 urine sodium amount (VT:0006274) urine sodium level (CMO:0000129) 1 28879780 78430678 Rat 61342 Bp27 Blood pressure QTL 27 3.4 0.0006 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 56732668 98773277 Rat 1300172 Bp172 Blood pressure QTL 172 3.56 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 1 32737273 90665040 Rat 4889962 Bss94 Bone structure and strength QTL 94 3.8 tibia area (VT:1000281) tibia-fibula cortical bone endosteal cross-sectional area (CMO:0001722) 1 49361465 82174945 Rat 2313094 Bss58 Bone structure and strength QTL 58 3.7 0.0001 tibia strength trait (VT:1000284) tibia total energy absorbed before break (CMO:0001736) 1 43284731 118944897 Rat 6903308 Scl36 Serum cholesterol QTL 36 2 0.0125 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 1 53863041 90532583 Rat 2313092 Bmd72 Bone mineral density QTL 72 2.5 0.0001 tibia mineral mass (VT:1000283) total volumetric bone mineral density (CMO:0001728) 1 11481312 82174945 Rat 2300164 Bmd44 Bone mineral density QTL 44 5.4 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 1 56949932 101949932 Rat 2313099 Bss56 Bone structure and strength QTL 56 2.4 0.0001 tibia size trait (VT:0100001) tibia midshaft endosteal cross-sectional area (CMO:0001716) 1 43284731 118944897 Rat 2313098 Bmd70 Bone mineral density QTL 70 3.6 0.0001 tibia mineral mass (VT:1000283) compact volumetric bone mineral density (CMO:0001730) 1 43284731 118944897 Rat 2313097 Bss70 Bone structure and strength QTL 70 3.5 0.0001 tibia strength trait (VT:1000284) tibia total energy absorbed before break (CMO:0001736) 1 11481312 82174945 Rat 9589820 Insglur3 Insulin/glucose ratio QTL 3 10.75 0.001 blood insulin amount (VT:0001560) calculated plasma insulin level (CMO:0002170) 1 34836858 79836858 Rat 152025249 Scl82 Serum cholesterol level QTL 82 4.77 blood cholesterol amount (VT:0000180) 1 50343510 99980958 Rat 1354599 Bw29 Body weight QTL 29 3.46 0.001 body mass (VT:0001259) body weight (CMO:0000012) 1 33449848 78449848 Rat 4889919 Bss86 Bone structure and strength QTL 86 4.1 tibia area (VT:1000281) tibia midshaft total cross-sectional area (CMO:0001715) 1 53895117 82174945 Rat 8552948 Pigfal11 Plasma insulin-like growth factor 1 level QTL 11 4.7 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 1 34836858 79836858 Rat 2313051 Bss57 Bone structure and strength QTL 57 3.7 0.0001 tibia strength trait (VT:1000284) bone polar moment of inertia (CMO:0001558) 1 43284731 118944897 Rat
RH133928
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 65,864,351 - 65,864,562 (+) MAPPER mRatBN7.2 Rnor_6.0 1 64,438,635 - 64,438,845 NCBI Rnor6.0 Rnor_5.0 1 63,430,576 - 63,430,786 UniSTS Rnor5.0 RGSC_v3.4 1 64,177,711 - 64,177,921 UniSTS RGSC3.4 Celera 1 63,589,059 - 63,589,269 UniSTS RH 3.4 Map 1 739.1 UniSTS RH 3.4 Map 1 732.0 UniSTS Cytogenetic Map 1 q12 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000081980 ⟹ ENSRNOP00000074552
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 65,864,176 - 65,874,035 (-) Ensembl Rnor_6.0 Ensembl 1 64,438,472 - 64,446,818 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000117211 ⟹ ENSRNOP00000095076
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 65,864,185 - 65,870,435 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000119431 ⟹ ENSRNOP00000094663
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 65,864,173 - 65,872,481 (-) Ensembl
RefSeq Acc Id:
NM_183332 ⟹ NP_899161
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 74,779,616 - 74,787,963 (-) NCBI mRatBN7.2 1 65,864,188 - 65,872,535 (-) NCBI Rnor_6.0 1 64,438,471 - 64,446,818 (-) NCBI Rnor_5.0 1 63,430,406 - 63,440,255 (-) NCBI RGSC_v3.4 1 64,177,547 - 64,185,893 (-) RGD Celera 1 63,588,895 - 63,597,242 (-) RGD
Sequence:
GCGCGCTCCTCAGCTGGCCAACTCCACCCAGCTTTAAGACCCTTTTAGTCTGCAGCTGTCGTCCTTGTTTGTGCTGCAGACGCCACTGACTGGAGAGGGCTTCTGATCTGCCTTTTCCAGGTGTGCAA
hide sequence
RefSeq Acc Id:
XM_006228035 ⟹ XP_006228097
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 74,779,616 - 74,796,752 (-) NCBI mRatBN7.2 1 65,864,180 - 65,874,701 (-) NCBI Rnor_6.0 1 64,438,465 - 64,448,332 (-) NCBI Rnor_5.0 1 63,430,406 - 63,440,255 (-) NCBI
Sequence:
TCTGCAAAGCACGAAGCAAGCGCCCAGGTCCCCTCTTCAGCTCCTCCCTCCTCTGTAGGACACG
hide sequence
RefSeq Acc Id:
XM_039085873 ⟹ XP_038941801
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 74,779,616 - 74,787,891 (-) NCBI mRatBN7.2 1 65,864,180 - 65,872,483 (-) NCBI
RefSeq Acc Id:
XM_063270027 ⟹ XP_063126097
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 74,779,616 - 74,786,857 (-) NCBI
RefSeq Acc Id:
NP_899161 ⟸ NM_183332
- UniProtKB:
Q6VBQ5 (UniProtKB/Swiss-Prot)
- Sequence:
MPVTVTRTTITTTSSSSTTVGSARALTQPLGLLRLLQLVSTCVAFSLVASVGAWTGPMGNWAMFTWCFCFAVTLIILIEELGGFQARFPLSWRNFPITFACYAALFCLSSSIIYPTTYVQFLPHGRSR
hide sequence
RefSeq Acc Id:
XP_006228097 ⟸ XM_006228035
- Peptide Label:
isoform X1
- UniProtKB:
Q05BA4 (UniProtKB/TrEMBL), A6KS43 (UniProtKB/TrEMBL), A0A0G2K8C4 (UniProtKB/TrEMBL)
- Sequence:
MPVTVTRTTITTTSSSSTTVGSARALTQPLGLLRLLQLVSTCVAFSLVASVGAWTGPMGNWAMF
hide sequence
Ensembl Acc Id:
ENSRNOP00000074552 ⟸ ENSRNOT00000081980
RefSeq Acc Id:
XP_038941801 ⟸ XM_039085873
- Peptide Label:
isoform X1
- UniProtKB:
Q05BA4 (UniProtKB/TrEMBL), A6KS43 (UniProtKB/TrEMBL), A0A0G2K8C4 (UniProtKB/TrEMBL)
Ensembl Acc Id:
ENSRNOP00000094663 ⟸ ENSRNOT00000119431
Ensembl Acc Id:
ENSRNOP00000095076 ⟸ ENSRNOT00000117211
RefSeq Acc Id:
XP_063126097 ⟸ XM_063270027
- Peptide Label:
isoform X1
- UniProtKB:
A0A0G2K8C4 (UniProtKB/TrEMBL), A6KS43 (UniProtKB/TrEMBL), Q05BA4 (UniProtKB/TrEMBL)
RGD ID: 13689667 Promoter ID: EPDNEW_R192 Type: initiation region Name: Myadm_1 Description: myeloid-associated differentiation marker SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 1 64,446,755 - 64,446,815 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2005-07-08
Myadm
myeloid-associated differentiation marker
Symbol and Name status set to approved
1299863 APPROVED
Note Type
Note
Reference
gene_disease
identified as a possible hypertension gene
1559295
