Symbol:
Brinp2
Name:
BMP/retinoic acid inducible neural specific 2
RGD ID:
708419
Description:
Involved in negative regulation of cell cycle and nervous system development. Located in dendrite and neuronal cell body. Human ortholog(s) of this gene implicated in oral squamous cell carcinoma. Orthologous to human BRINP2 (BMP/retinoic acid inducible neural specific 2); INTERACTS WITH 1,3-dinitrobenzene; 17alpha-ethynylestradiol; 17beta-estradiol.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
BMP/retinoic acid-inducible neural-specific protein 2; bone morphogenetic protein/retinoic acid inducible neural-specific 2; bone morphogenic protein/retinoic acid inducible neural-specific 2; Fam5b; family with sequence similarity 5, member B
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 13 72,964,498 - 73,065,312 (-) NCBI GRCr8 mRatBN7.2 13 70,431,006 - 70,532,766 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 13 70,431,010 - 70,531,810 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 13 73,009,747 - 73,110,601 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 13 74,307,588 - 74,408,329 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 13 71,567,679 - 71,668,362 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 13 75,948,679 - 76,049,363 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 13 75,948,679 - 76,049,363 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 13 80,863,780 - 80,964,493 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 13 73,541,992 - 73,644,517 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 13 73,556,179 - 73,658,705 (-) NCBI Celera 13 70,246,465 - 70,347,212 (-) NCBI Celera Cytogenetic Map 13 q22 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Brinp2 Rat 1,2-dimethylhydrazine decreases expression ISO Brinp2 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of BRINP2 mRNA CTD PMID:22206623 Brinp2 Rat 1,3-dinitrobenzene decreases expression EXP 6480464 3-dinitrobenzene results in decreased expression of BRINP2 mRNA CTD PMID:21983209 Brinp2 Rat 17alpha-ethynylestradiol increases expression EXP 6480464 Ethinyl Estradiol results in increased expression of BRINP2 mRNA CTD PMID:29097150 Brinp2 Rat 17beta-estradiol multiple interactions ISO BRINP2 (Homo sapiens) 6480464 [Estradiol co-treated with Tetrachlorodibenzodioxin] results in decreased expression of BRINP2 mRNA and Raloxifene Hydrochloride inhibits the reaction [Estradiol results in increased expression of BRINP2 mRNA] CTD PMID:19619570 and PMID:21185374 Brinp2 Rat 17beta-estradiol increases expression ISO BRINP2 (Homo sapiens) 6480464 Estradiol results in increased expression of BRINP2 mRNA CTD PMID:19619570 and PMID:21185374 Brinp2 Rat 17beta-estradiol decreases expression EXP 6480464 Estradiol results in decreased expression of BRINP2 mRNA CTD PMID:20068009 Brinp2 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO BRINP2 (Homo sapiens) 6480464 [Estradiol co-treated with Tetrachlorodibenzodioxin] results in decreased expression of BRINP2 mRNA CTD PMID:19619570 Brinp2 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of BRINP2 mRNA CTD PMID:33387578 Brinp2 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO BRINP2 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in decreased expression of BRINP2 mRNA CTD PMID:19619570 Brinp2 Rat 2-palmitoylglycerol increases expression ISO BRINP2 (Homo sapiens) 6480464 2-palmitoylglycerol results in increased expression of BRINP2 mRNA CTD PMID:37199045 Brinp2 Rat 4,4'-sulfonyldiphenol increases methylation ISO Brinp2 (Mus musculus) 6480464 bisphenol S results in increased methylation of BRINP2 exon CTD PMID:33297965 Brinp2 Rat 4,4'-sulfonyldiphenol affects methylation ISO Brinp2 (Mus musculus) 6480464 bisphenol S affects the methylation of BRINP2 gene CTD PMID:31683443 Brinp2 Rat acrylamide decreases expression ISO BRINP2 (Homo sapiens) 6480464 Acrylamide results in decreased expression of BRINP2 mRNA CTD PMID:32763439 Brinp2 Rat aflatoxin B1 decreases methylation ISO BRINP2 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of BRINP2 exon and Aflatoxin B1 results in decreased methylation of BRINP2 gene CTD PMID:27153756 and PMID:30157460 Brinp2 Rat Aflatoxin B2 alpha increases methylation ISO BRINP2 (Homo sapiens) 6480464 aflatoxin B2 results in increased methylation of BRINP2 intron CTD PMID:30157460 Brinp2 Rat alpha-Zearalanol multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in increased expression of BRINP2 mRNA CTD PMID:35163327 Brinp2 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of BRINP2 mRNA CTD PMID:16483693 Brinp2 Rat arsane affects methylation ISO BRINP2 (Homo sapiens) 6480464 Arsenic affects the methylation of BRINP2 gene CTD PMID:25304211 Brinp2 Rat arsenic atom affects methylation ISO BRINP2 (Homo sapiens) 6480464 Arsenic affects the methylation of BRINP2 gene CTD PMID:25304211 Brinp2 Rat atrazine increases expression ISO BRINP2 (Homo sapiens) 6480464 Atrazine results in increased expression of BRINP2 mRNA CTD PMID:22378314 Brinp2 Rat benzo[a]pyrene increases methylation ISO BRINP2 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of BRINP2 3' UTR more ... CTD PMID:27901495 Brinp2 Rat benzo[e]pyrene increases methylation ISO BRINP2 (Homo sapiens) 6480464 benzo(e)pyrene results in increased methylation of BRINP2 exon and benzo(e)pyrene results in increased methylation of BRINP2 intron CTD PMID:30157460 Brinp2 Rat bis(2-ethylhexyl) phthalate decreases expression ISO BRINP2 (Homo sapiens) 6480464 Diethylhexyl Phthalate results in decreased expression of BRINP2 mRNA CTD PMID:31163220 Brinp2 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of BRINP2 mRNA CTD PMID:25181051 Brinp2 Rat bisphenol A decreases expression ISO Brinp2 (Mus musculus) 6480464 bisphenol A results in decreased expression of BRINP2 mRNA CTD PMID:32156529 Brinp2 Rat bisphenol A decreases methylation ISO BRINP2 (Homo sapiens) 6480464 bisphenol A results in decreased methylation of BRINP2 gene CTD PMID:31601247 Brinp2 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of BRINP2 mRNA CTD PMID:29097150 more ... Brinp2 Rat bromobenzene increases expression EXP 6480464 bromobenzene results in increased expression of BRINP2 mRNA CTD PMID:32479839 Brinp2 Rat cadmium atom multiple interactions ISO Brinp2 (Mus musculus) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of BRINP2 mRNA CTD PMID:37325564 Brinp2 Rat cadmium dichloride decreases expression EXP 6480464 Cadmium Chloride results in decreased expression of BRINP2 mRNA CTD PMID:33453195 Brinp2 Rat cadmium dichloride multiple interactions ISO Brinp2 (Mus musculus) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of BRINP2 mRNA CTD PMID:37325564 Brinp2 Rat CGP 52608 multiple interactions ISO BRINP2 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to BRINP2 gene] CTD PMID:28238834 Brinp2 Rat copper atom increases expression EXP 6480464 Copper deficiency results in increased expression of BRINP2 mRNA CTD PMID:26033743 Brinp2 Rat copper atom multiple interactions EXP 6480464 [Copper co-treated with Dietary Sucrose] results in increased expression of BRINP2 mRNA CTD PMID:26033743 Brinp2 Rat copper(0) increases expression EXP 6480464 Copper deficiency results in increased expression of BRINP2 mRNA CTD PMID:26033743 Brinp2 Rat copper(0) multiple interactions EXP 6480464 [Copper co-treated with Dietary Sucrose] results in increased expression of BRINP2 mRNA CTD PMID:26033743 Brinp2 Rat diazinon affects expression EXP 6480464 Diazinon affects the expression of BRINP2 mRNA CTD PMID:22546817 Brinp2 Rat dieldrin affects expression EXP 6480464 Dieldrin affects the expression of BRINP2 mRNA CTD PMID:22546817 Brinp2 Rat ethanol affects splicing ISO Brinp2 (Mus musculus) 6480464 Ethanol affects the splicing of BRINP2 mRNA CTD PMID:30319688 Brinp2 Rat fenvalerate increases expression EXP 6480464 fenvalerate results in increased expression of BRINP2 mRNA CTD PMID:30307764 Brinp2 Rat fipronil multiple interactions ISO BRINP2 (Homo sapiens) 6480464 [fipronil co-treated with DEET] results in increased expression of BRINP2 mRNA CTD PMID:27091632 Brinp2 Rat gentamycin decreases expression EXP 6480464 Gentamicins results in decreased expression of BRINP2 mRNA CTD PMID:22061828 Brinp2 Rat ketamine increases expression EXP 6480464 Ketamine results in increased expression of BRINP2 mRNA CTD PMID:20080153 Brinp2 Rat methapyrilene increases methylation ISO BRINP2 (Homo sapiens) 6480464 Methapyrilene results in increased methylation of BRINP2 exon and Methapyrilene results in increased methylation of BRINP2 intron CTD PMID:30157460 Brinp2 Rat methoxychlor affects methylation EXP 6480464 Methoxychlor affects the methylation of BRINP2 gene CTD PMID:35440735 Brinp2 Rat N,N-diethyl-m-toluamide multiple interactions ISO BRINP2 (Homo sapiens) 6480464 [fipronil co-treated with DEET] results in increased expression of BRINP2 mRNA CTD PMID:27091632 Brinp2 Rat nickel dichloride affects expression EXP 6480464 nickel chloride affects the expression of BRINP2 mRNA CTD PMID:22546817 Brinp2 Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of BRINP2 mRNA CTD PMID:33387578 Brinp2 Rat perfluorohexanesulfonic acid decreases expression ISO Brinp2 (Mus musculus) 6480464 perfluorohexanesulfonic acid results in decreased expression of BRINP2 mRNA CTD PMID:37315490 Brinp2 Rat perfluorooctanoic acid multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in increased expression of BRINP2 mRNA CTD PMID:35163327 Brinp2 Rat pirinixic acid multiple interactions ISO Brinp2 (Mus musculus) 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in increased expression of BRINP2 mRNA CTD PMID:19710929 Brinp2 Rat potassium dichromate increases expression ISO Brinp2 (Mus musculus) 6480464 Potassium Dichromate results in increased expression of BRINP2 mRNA CTD PMID:23608068 Brinp2 Rat raloxifene multiple interactions ISO BRINP2 (Homo sapiens) 6480464 Raloxifene Hydrochloride inhibits the reaction [Estradiol results in increased expression of BRINP2 mRNA] CTD PMID:21185374 Brinp2 Rat rotenone decreases expression ISO BRINP2 (Homo sapiens) 6480464 Rotenone results in decreased expression of BRINP2 mRNA CTD PMID:29955902 Brinp2 Rat Soman decreases expression EXP 6480464 Soman results in decreased expression of BRINP2 mRNA CTD PMID:19281266 Brinp2 Rat trichloroethene increases expression EXP 6480464 Trichloroethylene results in increased expression of BRINP2 mRNA CTD PMID:33387578 Brinp2 Rat triclosan decreases expression ISO BRINP2 (Homo sapiens) 6480464 Triclosan results in decreased expression of BRINP2 mRNA CTD PMID:30510588 Brinp2 Rat vinclozolin affects expression EXP 6480464 vinclozolin affects the expression of BRINP2 mRNA CTD PMID:19015723
1,2-dimethylhydrazine (ISO) 1,3-dinitrobenzene (EXP) 17alpha-ethynylestradiol (EXP) 17beta-estradiol (EXP,ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2-palmitoylglycerol (ISO) 4,4'-sulfonyldiphenol (ISO) acrylamide (ISO) aflatoxin B1 (ISO) Aflatoxin B2 alpha (ISO) alpha-Zearalanol (EXP) ammonium chloride (EXP) arsane (ISO) arsenic atom (ISO) atrazine (ISO) benzo[a]pyrene (ISO) benzo[e]pyrene (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bromobenzene (EXP) cadmium atom (ISO) cadmium dichloride (EXP,ISO) CGP 52608 (ISO) copper atom (EXP) copper(0) (EXP) diazinon (EXP) dieldrin (EXP) ethanol (ISO) fenvalerate (EXP) fipronil (ISO) gentamycin (EXP) ketamine (EXP) methapyrilene (ISO) methoxychlor (EXP) N,N-diethyl-m-toluamide (ISO) nickel dichloride (EXP) paracetamol (EXP) perfluorohexanesulfonic acid (ISO) perfluorooctanoic acid (EXP) pirinixic acid (ISO) potassium dichromate (ISO) raloxifene (ISO) rotenone (ISO) Soman (EXP) trichloroethene (EXP) triclosan (ISO) vinclozolin (EXP)
Biological Process
cellular response to retinoic acid (IBA,IEA,ISO) central nervous system neuron differentiation (IBA,IEA,ISO) locomotion (IEA,ISO) multicellular organism growth (IEA,ISO) negative regulation of cell cycle (IEA,IMP) negative regulation of mitotic cell cycle (IBA,IEA,ISO) nervous system development (IEA,IEP,ISO) positive regulation of neuron differentiation (IEA) regulation of cell cycle (IEA)
1.
Genetic alterations in oral squamous cell carcinoma progression detected by combining array-based comparative genomic hybridization and multiplex ligation-dependent probe amplification.
Cha JD, etal., Oral Surg Oral Med Oral Pathol Oral Radiol Endod. 2011 May;111(5):594-607. doi: 10.1016/j.tripleo.2010.11.020. Epub 2011 Feb 22.
2.
Characterization of biological pathways associated with a 1.37 Mbp genomic region protective of hypertension in Dahl S rats.
Cowley AW, etal., Physiol Genomics. 2014 Jun 1;46(11):398-410. doi: 10.1152/physiolgenomics.00179.2013. Epub 2014 Apr 8.
3.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
4.
Identification and characterization of novel developmentally regulated neural-specific proteins, BRINP family.
Kawano H, etal., Brain Res Mol Brain Res 2004 Jun 18;125(1-2):60-75.
5.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
6.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
Brinp2 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 13 72,964,498 - 73,065,312 (-) NCBI GRCr8 mRatBN7.2 13 70,431,006 - 70,532,766 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 13 70,431,010 - 70,531,810 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 13 73,009,747 - 73,110,601 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 13 74,307,588 - 74,408,329 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 13 71,567,679 - 71,668,362 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 13 75,948,679 - 76,049,363 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 13 75,948,679 - 76,049,363 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 13 80,863,780 - 80,964,493 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 13 73,541,992 - 73,644,517 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 13 73,556,179 - 73,658,705 (-) NCBI Celera 13 70,246,465 - 70,347,212 (-) NCBI Celera Cytogenetic Map 13 q22 NCBI
BRINP2 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 1 177,170,958 - 177,282,422 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 1 177,170,958 - 177,282,422 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 1 177,140,094 - 177,251,558 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 1 175,407,256 - 175,518,181 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 1 150,250,704 - 150,361,628 (+) NCBI Celera Cytogenetic Map 1 q25.2 NCBI HuRef 1 148,367,642 - 148,478,577 (+) NCBI HuRef CHM1_1 1 178,564,624 - 178,675,569 (+) NCBI CHM1_1 T2T-CHM13v2.0 1 176,525,633 - 176,637,111 (+) NCBI T2T-CHM13v2.0
Brinp2 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 1 158,072,835 - 158,185,096 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 1 158,072,839 - 158,183,896 (-) Ensembl GRCm39 Ensembl GRCm38 1 158,245,265 - 158,356,528 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 1 158,245,269 - 158,356,326 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 1 160,175,400 - 160,286,391 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 1 160,081,948 - 160,193,003 (-) NCBI MGSCv36 mm8 Celera 1 160,640,225 - 160,749,398 (-) NCBI Celera Cytogenetic Map 1 H1 NCBI cM Map 1 68.27 NCBI
Brinp2 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955406 16,748,824 - 16,844,093 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955406 16,748,824 - 16,840,924 (+) NCBI ChiLan1.0 ChiLan1.0
BRINP2 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 1 72,437,118 - 72,547,910 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 1 72,107,317 - 72,218,106 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 1 152,694,667 - 152,806,085 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 1 156,391,436 - 156,502,742 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 1 156,450,411 - 156,502,742 (+) Ensembl panpan1.1 panPan2
BRINP2 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 7 22,332,465 - 22,449,295 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 7 22,339,056 - 22,448,854 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 7 21,865,088 - 21,973,700 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 7 22,086,726 - 22,195,881 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 7 22,072,721 - 22,195,861 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 7 21,992,092 - 22,101,532 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 7 22,092,409 - 22,201,467 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 7 22,235,542 - 22,344,318 (-) NCBI UU_Cfam_GSD_1.0
Brinp2 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024409344 93,512,083 - 93,615,246 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936481 11,356,608 - 11,455,125 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936481 11,358,832 - 11,455,104 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
BRINP2 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 9 118,975,719 - 119,095,336 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 9 118,967,670 - 119,095,345 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 9 130,733,801 - 130,820,039 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
BRINP2 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 25 51,993,095 - 52,114,569 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 25 51,993,135 - 52,105,212 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666055 53,564,202 - 53,676,022 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Brinp2
.
Predicted Target Of
Count of predictions: 34 Count of miRNA genes: 33 Interacting mature miRNAs: 34 Transcripts: ENSRNOT00000007455 Prediction methods: Miranda, Rnahybrid Result types: miRGate_prediction
1298066 Bp159 Blood pressure QTL 159 0.004 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 13 46088046 91088046 Rat 10755495 Bp387 Blood pressure QTL 387 3.78 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 13 34663461 87525369 Rat 1354655 Bp241 Blood pressure QTL 241 3.9 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 13 56056920 101056920 Rat 8655951 Rf63 Renal function QTL 63 12.2 blood urea nitrogen amount (VT:0005265) plasma urea nitrogen level (CMO:0000586) 13 69060519 77046890 Rat 70220 Bp55 Blood pressure QTL 55 5.75 arterial blood pressure trait (VT:2000000) blood pressure measurement (CMO:0000003) 13 37374509 82374509 Rat 8655945 Rf61 Renal function QTL 61 3.6 blood creatinine amount (VT:0005328) creatinine clearance (CMO:0000765) 13 69060519 86800898 Rat 71119 Thym2 Thymus enlargement QTL 2 3.8 thymus mass (VT:0004954) thymus weight to body weight ratio (CMO:0000612) 13 46197976 84753113 Rat 4889861 Pur29 Proteinuria QTL 29 13.8 0.005 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 13 37415584 80753406 Rat 1331783 Bp221 Blood pressure QTL 221 3.72886 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 13 69060519 86800898 Rat 12879441 Bp396 Blood pressure QTL 396 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 13 45699983 90699983 Rat 2293687 Bss26 Bone structure and strength QTL 26 4.6 0.0001 femur morphology trait (VT:0000559) femur cross-sectional area (CMO:0001661) 13 65103704 106807694 Rat 1300166 Kidm6 Kidney mass QTL 6 3.93 kidney mass (VT:0002707) single kidney wet weight to body weight ratio (CMO:0000622) 13 69060519 86800898 Rat 619615 Bp80 Blood pressure QTL 80 0.0354 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 13 39754544 84754544 Rat 2303028 Bp329 Blood pressure QTL 329 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 13 58497872 73485113 Rat 1581570 Eae17 Experimental allergic encephalomyelitis QTL 17 4.1 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046) 13 8897350 101631289 Rat 61340 Bp25 Blood pressure QTL 25 4.2 0.004 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 13 34535218 79535218 Rat 1581573 Uae36 Urinary albumin excretion QTL 36 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 13 5994833 77046787 Rat 1549897 Stresp12 Stress response QTL 12 3.35 stress-related behavior trait (VT:0010451) number of approaches toward negative stimulus before onset of defensive burying response (CMO:0001960) 13 38433408 83433408 Rat 724564 Uae11 Urinary albumin excretion QTL 11 5.7 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 13 59492522 77046890 Rat 7207885 Glom27 Glomerulus QTL 27 3.9 kidney glomerulus integrity trait (VT:0010546) kidney crescentic glomeruli count to kidney normal glomeruli count ratio (CMO:0002139) 13 20605871 101339738 Rat 7387280 Uae43 Urinary albumin excretion QTL 43 5.69 0.4174 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 13 66451204 106807694 Rat 738026 Lnnr5 Liver neoplastic nodule remodeling QTL 5 3.29 liver integrity trait (VT:0010547) liver remodeling tumorous lesion number (CMO:0001461) 13 59874408 85581182 Rat 70181 BpQTLcluster11 Blood pressure QTL cluster 11 6.922 arterial blood pressure trait (VT:2000000) absolute change in mean arterial blood pressure (CMO:0000533) 13 31241331 93395974 Rat 2293702 Bss34 Bone structure and strength QTL 34 4.61 0.0001 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 13 65103704 106807694 Rat 61349 Bp31 Blood pressure QTL 31 5.75 arterial blood pressure trait (VT:2000000) blood pressure measurement (CMO:0000003) 13 37374509 82374509 Rat 2303563 Bw89 Body weight QTL 89 6 body mass (VT:0001259) body weight (CMO:0000012) 13 32284471 77284471 Rat 1354621 Rf47 Renal function QTL 47 3.7 kidney renin amount (VT:0010559) kidney renin level (CMO:0002166) 13 30395351 101056920 Rat 1581554 Pur11 Proteinuria QTL 11 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 13 5994833 77046787 Rat 12879477 Bp401 Blood pressure QTL 401 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 13 37262092 82262092 Rat 1331750 Bp220 Blood pressure QTL 220 2.98 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 13 37415584 82415584 Rat 1641901 Alcrsp6 Alcohol response QTL 6 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 13 52362171 97362171 Rat 12879475 Bp400 Blood pressure QTL 400 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 13 61825626 106807694 Rat 1354666 Bp244 Blood pressure QTL 244 4.9 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 13 1 101056920 Rat
RH143402
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 13 70,431,248 - 70,431,370 (+) MAPPER mRatBN7.2 Rnor_6.0 13 75,948,918 - 75,949,039 NCBI Rnor6.0 Rnor_5.0 13 80,864,019 - 80,864,140 UniSTS Rnor5.0 RGSC_v3.4 13 73,542,231 - 73,542,352 UniSTS RGSC3.4 Celera 13 70,246,704 - 70,246,825 UniSTS Cytogenetic Map 13 q22 UniSTS
AU046789
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 13 70,441,637 - 70,441,813 (+) MAPPER mRatBN7.2 Rnor_6.0 13 75,959,309 - 75,959,484 NCBI Rnor6.0 Rnor_5.0 13 80,874,410 - 80,874,585 UniSTS Rnor5.0 RGSC_v3.4 13 73,553,232 - 73,553,407 UniSTS RGSC3.4 Celera 13 70,257,093 - 70,257,268 UniSTS Cytogenetic Map 13 q22 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
56
55
24
25
24
6
177
97
93
39
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000007455 ⟹ ENSRNOP00000007455
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 13 70,431,010 - 70,531,810 (-) Ensembl Rnor_6.0 Ensembl 13 75,948,679 - 76,049,363 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000075865 ⟹ ENSRNOP00000068294
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source Rnor_6.0 Ensembl 13 75,948,679 - 76,049,363 (-) Ensembl
RefSeq Acc Id:
NM_173115 ⟹ NP_775138
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 13 72,964,502 - 73,065,294 (-) NCBI mRatBN7.2 13 70,431,010 - 70,531,810 (-) NCBI Rnor_6.0 13 75,948,679 - 76,049,363 (-) NCBI Rnor_5.0 13 80,863,780 - 80,964,493 (-) NCBI RGSC_v3.4 13 73,541,992 - 73,644,517 (-) RGD Celera 13 70,246,465 - 70,347,212 (-) RGD
Sequence:
GGCAGGGCAGCATTGTTATCTTAAGACACTCATCTGGTGTCTGAGTCTGCAGGTGACACTGGTTAGGTACGGAGCGTGAAGTCGGAGTGGGGACGCACCGGGCTGCAGCTCTAGGATGGAATCCGCCT
hide sequence
RefSeq Acc Id:
XM_039090411 ⟹ XP_038946339
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 13 72,964,498 - 73,065,312 (-) NCBI mRatBN7.2 13 70,431,006 - 70,532,766 (-) NCBI
RefSeq Acc Id:
XM_039090412 ⟹ XP_038946340
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 13 72,964,498 - 73,065,312 (-) NCBI mRatBN7.2 13 70,431,006 - 70,532,765 (-) NCBI
RefSeq Acc Id:
XM_039090413 ⟹ XP_038946341
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 13 72,964,498 - 73,065,312 (-) NCBI mRatBN7.2 13 70,431,006 - 70,532,765 (-) NCBI
RefSeq Acc Id:
XM_063272059 ⟹ XP_063128129
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 13 72,964,498 - 73,012,334 (-) NCBI
RefSeq Acc Id:
NP_775138 ⟸ NM_173115
- Peptide Label:
precursor
- UniProtKB:
Q8K1M8 (UniProtKB/Swiss-Prot), A6ID37 (UniProtKB/TrEMBL), F1MA15 (UniProtKB/TrEMBL)
- Sequence:
MRWPCSSRFRGLWPEAAPWAVLLALGVPGWVLAVSATVAAVVPEQHVSSAGQAPLDWLLTDRGPFHRAQEYADFMERYRQGFTTRYRIYREFARWKVNNLALERKDFFSLPLPLAPEFVRNIRLLGRR
hide sequence
Ensembl Acc Id:
ENSRNOP00000068294 ⟸ ENSRNOT00000075865
Ensembl Acc Id:
ENSRNOP00000007455 ⟸ ENSRNOT00000007455
RefSeq Acc Id:
XP_038946339 ⟸ XM_039090411
- Peptide Label:
isoform X1
- UniProtKB:
Q8K1M8 (UniProtKB/Swiss-Prot), A6ID37 (UniProtKB/TrEMBL), F1MA15 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038946341 ⟸ XM_039090413
- Peptide Label:
isoform X1
- UniProtKB:
Q8K1M8 (UniProtKB/Swiss-Prot), A6ID37 (UniProtKB/TrEMBL), F1MA15 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038946340 ⟸ XM_039090412
- Peptide Label:
isoform X1
- UniProtKB:
Q8K1M8 (UniProtKB/Swiss-Prot), A6ID37 (UniProtKB/TrEMBL), F1MA15 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063128129 ⟸ XM_063272059
- Peptide Label:
isoform X2
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-03-01
Brinp2
BMP/retinoic acid inducible neural specific 2
Brinp2
bone morphogenetic protein/retinoic acid inducible neural-specific 2
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2013-08-14
Brinp2
bone morphogenetic protein/retinoic acid inducible neural-specific 2
Brinp2
bone morphogenic protein/retinoic acid inducible neural-specific 2
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2013-08-07
Brinp2
bone morphogenic protein/retinoic acid inducible neural-specific 2
Fam5b
family with sequence similarity 5, member B
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-05-15
Fam5b
family with sequence similarity 5, member B
Brinp2
BMP/retinoic acid-inducible neural-specific protein 2
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2005-07-08
Brinp2
BMP/retinoic acid-inducible neural-specific protein 2
Symbol and Name status set to approved
1299863 APPROVED
