Advanced Search (OLGA)

Gene: Lenep (lens epithelial protein) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Lenep

Name:

lens epithelial protein

RGD ID:

69433

Description:

Orthologous to human LENEP (lens epithelial protein); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,4-dinitrotoluene; 6-propyl-2-thiouracil.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

Elp; lens epithelial cell protein LEP503; lens epithelial protein 503; Lens epithelium 503; LEP503

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	LENEP (lens epithelial protein)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, PhylomeDB
Mus musculus (house mouse):	Lenep (lens epithelial protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Lenep (lens epithelial protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	LENEP (lens epithelial protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	LENEP (lens epithelial protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Lenep (lens epithelial protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	LENEP (lens epithelial protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	LENEP (lens epithelial protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Lenep (lens epithelial protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	TMA16 (translation machinery associated 16 homolog)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	LENEP (lens epithelial protein)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Lenep (lens epithelial protein)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	lenep (lens epithelial protein)	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	2	177,117,171 - 177,117,859 (-)	NCBI		GRCr8
mRatBN7.2	2	174,819,439 - 174,820,127 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	174,819,459 - 174,820,127 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	2	181,964,980 - 181,965,668 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	2	179,987,356 - 179,988,044 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	2	174,587,915 - 174,588,603 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	2	188,727,004 - 188,727,670 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	188,727,002 - 188,727,670 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	2	208,141,448 - 208,141,949 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	2	181,598,078 - 181,598,744 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	2	181,548,183 - 181,548,850 (-)	NCBI
Celera	2	168,760,199 - 168,760,865 (-)	NCBI		Celera
Cytogenetic Map	2	q34	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Lenep	Rat	Charcot-Marie-Tooth disease type 2		ISO	LENEP (Homo sapiens)	8554872	ClinVar Annotator: match by term: Charcot-Marie-Tooth disease type 2	ClinVar	PMID:28492532 and PMID:29845577
Lenep	Rat	gastrointestinal stromal tumor		ISO	LENEP (Homo sapiens)	8554872	ClinVar Annotator: match by term: Gastrointestinal stromal tumor	ClinVar	PMID:28492532
Lenep	Rat	immunodeficiency 42		ISO	LENEP (Homo sapiens)	8554872	ClinVar Annotator: match by term: Autosomal recessive mendelian susceptibility to mycobacterial diseases due to complete RORgamma receptor deficiency	ClinVar	PMID:28492532
Lenep	Rat	MHC class II deficiency		ISO	LENEP (Homo sapiens)	8554872	ClinVar Annotator: match by term: MHC class II deficiency	ClinVar	PMID:28492532
Lenep	Rat	parathyroid carcinoma		ISO	LENEP (Homo sapiens)	8554872	ClinVar Annotator: match by term: Parathyroid carcinoma	ClinVar	PMID:28492532
Lenep	Rat	severe congenital neutropenia 3		ISO	LENEP (Homo sapiens)	8554872	ClinVar Annotator: match by term: Kostmann syndrome	ClinVar	PMID:28492532
Lenep	Rat	severe congenital neutropenia 5		ISO	LENEP (Homo sapiens)	8554872	ClinVar Annotator: match by term: Congenital neutropenia-myelofibrosis-nephromegaly syndrome	ClinVar	PMID:28492532

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Lenep	Rat	2,3,7,8-tetrachlorodibenzodioxine	decreases expression	EXP		6480464	Tetrachlorodibenzodioxin results in decreased expression of LENEP mRNA	CTD	PMID:21215274 and PMID:33387578
Lenep	Rat	2,4-dinitrotoluene	affects expression	EXP		6480464	2 and 4-dinitrotoluene affects the expression of LENEP mRNA	CTD	PMID:21346803
Lenep	Rat	6-propyl-2-thiouracil	decreases expression	EXP		6480464	Propylthiouracil results in decreased expression of LENEP mRNA	CTD	PMID:30047161
Lenep	Rat	aflatoxin B1	increases methylation	ISO	LENEP (Homo sapiens)	6480464	Aflatoxin B1 results in increased methylation of LENEP gene	CTD	PMID:27153756
Lenep	Rat	amitrole	decreases expression	EXP		6480464	Amitrole results in decreased expression of LENEP mRNA	CTD	PMID:30047161
Lenep	Rat	arsenite(3-)	increases methylation	ISO	LENEP (Homo sapiens)	6480464	arsenite results in increased methylation of LENEP promoter	CTD	PMID:23974009
Lenep	Rat	bisphenol A	increases expression	EXP		6480464	bisphenol A results in increased expression of LENEP mRNA	CTD	PMID:25181051
Lenep	Rat	bisphenol F	decreases expression	ISO	Lenep (Mus musculus)	6480464	bisphenol F results in decreased expression of LENEP mRNA	CTD	PMID:38685157
Lenep	Rat	carbon nanotube	increases expression	ISO	Lenep (Mus musculus)	6480464	Nanotubes and Carbon results in increased expression of LENEP mRNA	CTD	PMID:25620056
Lenep	Rat	CGP 52608	multiple interactions	ISO	LENEP (Homo sapiens)	6480464	CGP 52608 promotes the reaction [RORA protein binds to LENEP gene]	CTD	PMID:28238834
Lenep	Rat	decabromodiphenyl ether	increases expression	EXP		6480464	decabromobiphenyl ether results in increased expression of LENEP mRNA	CTD	PMID:23640034
Lenep	Rat	glafenine	increases expression	EXP		6480464	Glafenine results in increased expression of LENEP mRNA	CTD	PMID:24136188
Lenep	Rat	leflunomide	decreases expression	ISO	LENEP (Homo sapiens)	6480464	leflunomide results in decreased expression of LENEP mRNA	CTD	PMID:28988120
Lenep	Rat	methimazole	decreases expression	EXP		6480464	Methimazole results in decreased expression of LENEP mRNA	CTD	PMID:30047161
Lenep	Rat	methylisothiazolinone	increases expression	ISO	LENEP (Homo sapiens)	6480464	2-methyl-4-isothiazolin-3-one results in increased expression of LENEP mRNA	CTD	PMID:31629900
Lenep	Rat	perfluorooctanoic acid	increases expression	EXP		6480464	perfluorooctanoic acid results in increased expression of LENEP mRNA	CTD	PMID:19162173
Lenep	Rat	tetrachloromethane	decreases expression	EXP		6480464	Carbon Tetrachloride results in decreased expression of LENEP mRNA	CTD	PMID:33387578
Lenep	Rat	trovafloxacin	increases expression	ISO	Lenep (Mus musculus)	6480464	trovafloxacin results in increased expression of LENEP mRNA	CTD	PMID:35537566
Lenep	Rat	vinclozolin	decreases expression	EXP		6480464	vinclozolin results in decreased expression of LENEP mRNA	CTD	PMID:23034163

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Lenep	Rat	protein binding	enables	ISO	LENEP (Homo sapiens)	1624291	UniProtKB:A0PK05 and PMID:32296183	RGD	PMID:32296183

#	Reference Title	Reference Citation
1.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
2.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
3.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
4.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
5.	Tentative Sequence Identification Numbers	Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
6.	Lens epithelial cell mRNA. I. Cloning and sequencing of a messenger RNA with a basic motif/leucine-rich domain specifically expressed in rat lens epithelial cells.	Wen Y, etal., Exp Eye Res 1995 Jun;60(6):675-82.
7.	A novel lens epithelium gene, LEP503, is highly conserved in different vertebrate species and is developmentally regulated in postnatal rat lens.	Wen Y, etal., Exp Eye Res 2000 Feb;70(2):159-68.

Lenep
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	2	177,117,171 - 177,117,859 (-)	NCBI		GRCr8
mRatBN7.2	2	174,819,439 - 174,820,127 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	174,819,459 - 174,820,127 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	2	181,964,980 - 181,965,668 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	2	179,987,356 - 179,988,044 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	2	174,587,915 - 174,588,603 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	2	188,727,004 - 188,727,670 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	188,727,002 - 188,727,670 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	2	208,141,448 - 208,141,949 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	2	181,598,078 - 181,598,744 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	2	181,548,183 - 181,548,850 (-)	NCBI
Celera	2	168,760,199 - 168,760,865 (-)	NCBI		Celera
Cytogenetic Map	2	q34	NCBI

LENEP
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	1	154,993,586 - 154,994,321 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	1	154,993,586 - 154,994,315 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	1	154,966,062 - 154,966,797 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	1	153,232,686 - 153,233,415 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	1	151,779,134 - 151,779,863	NCBI
Celera	1	128,037,086 - 128,037,815 (+)	NCBI		Celera
Cytogenetic Map	1	q21.3	NCBI
HuRef	1	126,327,803 - 126,328,532 (+)	NCBI		HuRef
CHM1_1	1	156,362,464 - 156,363,193 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	1	154,132,942 - 154,133,677 (+)	NCBI		T2T-CHM13v2.0

Lenep
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	3	89,309,203 - 89,309,957 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	3	89,308,295 - 89,310,100 (-)	Ensembl		GRCm39 Ensembl
GRCm38	3	89,401,896 - 89,402,650 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	3	89,400,988 - 89,402,793 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	3	89,205,818 - 89,206,572 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	3	89,486,915 - 89,488,720 (-)	NCBI		MGSCv36	mm8
Celera	3	89,436,956 - 89,437,710 (-)	NCBI		Celera
Cytogenetic Map	3	F1	NCBI
cM Map	3	39.1	NCBI

Lenep
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0	NW_004955545	1,495,877 - 1,497,014 (+)	NCBI	ChiLan1.0	ChiLan1.0

LENEP
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	1	94,844,997 - 94,847,605 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	1	94,578,591 - 94,579,326 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	1	130,341,395 - 130,342,409 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	1	133,950,882 - 133,951,424 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	1	133,950,896 - 133,951,081 (+)	Ensembl	panpan1.1		panPan2

LENEP
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	7	42,487,902 - 42,488,901 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	7	42,488,363 - 42,488,548 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	7	41,978,982 - 41,980,046 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	7	42,357,834 - 42,358,898 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	7	42,358,295 - 42,358,480 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	7	42,137,530 - 42,138,594 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	7	42,191,358 - 42,192,422 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	7	42,474,717 - 42,475,781 (-)	NCBI		UU_Cfam_GSD_1.0

Lenep
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405058	25,505,856 - 25,508,000 (+)	NCBI		HiC_Itri_2
SpeTri2.0	NW_004936580	4,536,329 - 4,537,058 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

LENEP
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	4	94,806,595 - 94,806,780 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	4	94,805,409 - 94,807,175 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	4	103,561,816 - 103,563,589 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

LENEP
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	20	8,836,074 - 8,838,034 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	20	8,837,451 - 8,837,633 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666038	8,170,506 - 8,172,113 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Lenep
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624885	2,492,525 - 2,503,465 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624885	2,495,400 - 2,496,273 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Lenep
1 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	86
Count of miRNA genes:	77
Interacting mature miRNAs:	81
Transcripts:	ENSRNOT00000074920
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1578648	Bss11	Bone structure and strength QTL 11	4.7		femur morphology trait (VT:0000559)	femoral neck cortical cross-sectional area (CMO:0001702)	2	114837527	211674221	Rat
1358356	Srcrt1	Stress Responsive Cort QTL1	3.66		blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	2	161699179	222436696	Rat
1331734	Bp204	Blood pressure QTL 204	3.61192		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	168358098	223265385	Rat
1298074	Bp164	Blood pressure QTL 164		0.003	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	42804607	202447032	Rat
1354648	Bp239	Blood pressure QTL 239		0.001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	66118463	226797303	Rat
1354649	Kidm17	Kidney mass QTL 17	2.9		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	2	81754530	227146641	Rat
10755499	Bp389	Blood pressure QTL 389	2.61		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	18960362	228801039	Rat
1298076	Bp166	Blood pressure QTL 166		0.0009	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	136445150	202447032	Rat
61457	Niddm8	Non-insulin dependent diabetes mellitus QTL 8	4.1	0.01	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	2	174543008	175950118	Rat
152025245	Scl81	Serum cholesterol level QTL 81	3.49		blood cholesterol amount (VT:0000180)		2	122609194	206936711	Rat
70162	Bp63	Blood pressure QTL 63	5.64		arterial blood pressure trait (VT:2000000)	blood pressure measurement (CMO:0000003)	2	169745596	214745596	Rat
1554319	Bmd2	Bone mineral density QTL 2	13.4	0.0001	lumbar vertebra area (VT:0010570)	lumbar vertebra cross-sectional area (CMO:0001689)	2	114837675	212549332	Rat
12879836	Kidm61	Kidney mass QTL 61		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	152413072	185122374	Rat
1581569	Uae32	Urinary albumin excretion QTL 32		0.0001	urine protein amount (VT:0005160)	urine albumin excretion rate (CMO:0000757)	2	78665619	219826953	Rat
10043136	Iddm54	Insulin dependent diabetes mellitus QTL 54	3.4	0.0001	blood glucose amount (VT:0000188)	age at onset/diagnosis of type 1 diabetes mellitus (CMO:0001140)	2	143657411	190602963	Rat
12879837	Am2	Aortic mass QTL 2		0.001	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	2	152413072	185122374	Rat
12879838	Cm86	Cardiac mass QTL 86		0.002	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	2	152413072	185122374	Rat
1302793	Bw16	Body weight QTL 16	5	0.0001	body mass (VT:0001259)	body weight (CMO:0000012)	2	157142209	202446871	Rat
61467	Bp14	Blood pressure QTL 14	2.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	43154682	202446871	Rat
12879839	Cm85	Cardiac mass QTL 85		0.001	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	2	152413072	185122374	Rat
61469	Bp16	Blood pressure QTL 16	5.64		arterial blood pressure trait (VT:2000000)	blood pressure measurement (CMO:0000003)	2	169745596	214745596	Rat
70175	BpQTLCluster3	Blood pressure QTL cluster 3	4.128		arterial blood pressure trait (VT:2000000)	absolute change in systolic blood pressure (CMO:0000607)	2	135552573	202446871	Rat
1549833	Bp257	Blood pressure QTL 257		0.003	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	168354880	185122374	Rat
1358900	Bw48	Body weight QTL 48	4.88		body mass (VT:0001259)	body weight (CMO:0000012)	2	157142078	211086598	Rat
12879845	Cm89	Cardiac mass QTL 89		0.008	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	2	152413072	175950118	Rat
61473	Bp19	Blood pressure QTL 19	6.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	172710921	175950118	Rat
1359030	Bp277	Blood pressure QTL 277			arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	114837527	185876470	Rat
12879846	Cm90	Cardiac mass QTL 90		0.011	heart right ventricle mass (VT:0007033)	heart right ventricle weight to body weight ratio (CMO:0000914)	2	152413072	175950118	Rat
12879847	Am4	Aortic mass QTL 4		0.001	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	2	152413072	175950118	Rat
1331760	Bp206	Blood pressure QTL 206	3.62454		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	56043031	202447032	Rat
12879840	Bw179	Body weight QTL 179		0.005	body mass (VT:0001259)	body weight (CMO:0000012)	2	152413072	185122374	Rat
1581502	Esta3	Estrogen-induced thymic atrophy QTL 3			thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	2	136916935	189599348	Rat
1359032	Hrtrt18	Heart rate QTL 18			heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	2	157142078	192625452	Rat
2301966	Bp322	Blood pressure QTL 322	3.58		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	150540301	202447032	Rat
1298080	Bp163	Blood pressure QTL 163		0.02	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	66118275	202447032	Rat
8662832	Vetf7	Vascular elastic tissue fragility QTL 7	3.5		aorta elastin amount (VT:0003905)	aorta wall extracellular elastin dry weight to aorta wall dry weight ratio (CMO:0002002)	2	81689826	221035911	Rat
1298085	Bp165	Blood pressure QTL 165		0.0006	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	42804607	202447032	Rat
1359022	Ppulsi1	Prepulse inhibition QTL 1	3.63		prepulse inhibition trait (VT:0003088)	acoustic startle response measurement (CMO:0001519)	2	136916935	213594495	Rat
1641891	Alcrsp17	Alcohol response QTL 17			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	2	149559561	249053267	Rat
724534	Uae6	Urinary albumin excretion QTL 6	10		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	2	78665619	249053267	Rat
61374	Edpm2	Estrogen-dependent pituitary mass QTL 2	4.42	0.86	pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	2	76539322	202447032	Rat
8662843	Vetf9	Vascular elastic tissue fragility QTL 9	2.05		thoracic aorta molecular composition trait (VT:0010568)	aorta wall extracellular elastin dry weight to aorta wall extracellular collagen weight ratio (CMO:0002003)	2	157142078	226277316	Rat
631501	Bp101	Blood pressure QTL 101	2.4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	150341684	202446871	Rat
2301415	Cm67	Cardiac mass QTL 67		0.003	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	2	152413072	175950118	Rat
2307174	Activ3	Activity QTL 3	4.83	0.000058	locomotor behavior trait (VT:0001392)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	2	168594495	213594495	Rat
1331794	Bp202	Blood pressure QTL 202	3.66819		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	141194931	223265385	Rat
71113	Cari2	Carrageenan-induced inflammation QTL 2	2.7	0.009	hypodermis integrity trait (VT:0010550)	inflammatory exudate volume (CMO:0001429)	2	141596551	202447032	Rat
1331805	Cm29	Cardiac mass QTL 29	3.50746		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	2	141194931	223265385	Rat
11565180	Kidm56	Kidney mass QTL 56		0.003	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	152413072	175950118	Rat
634308	Sach6	Saccharin preference QTL 6	4.9		taste sensitivity trait (VT:0001986)	saccharin intake volume to total fluid intake volume ratio (CMO:0001601)	2	112456140	212696837	Rat
1598805	Memor8	Memory QTL 8	3		exploratory behavior trait (VT:0010471)	average horizontal distance between subject and target during voluntary locomotion in an experimental apparatus (CMO:0002674)	2	150341585	189039377	Rat
11565181	Bw176	Body weight QTL 176		0.002	body mass (VT:0001259)	body weight (CMO:0000012)	2	152413072	175950118	Rat
1358917	Cm42	Cardiac mass QTL 42	2.82		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	25413423	203928301	Rat
724568	Uae13	Urinary albumin excretion QTL 13	4.4		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	2	143157029	210020885	Rat
1358913	Cm41	Cardiac mass QTL 41	2.73		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	25413423	203928301	Rat
1300165	Rf9	Renal function QTL 9	3.28		kidney glomerulus integrity trait (VT:0010546)	index of glomerular damage (CMO:0001135)	2	133914684	202447032	Rat
61401	Niddm2	Non-insulin dependent diabetes mellitus QTL 2	4.54		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	2	144599348	189599348	Rat
631507	Bp105	Blood pressure QTL 105		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	112456140	212696837	Rat
1641925	Alcrsp2	Alcohol response QTL 2			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	2	149559561	221167075	Rat
1354609	Niddm62	Non-insulin dependent diabetes mellitus QTL 62	4.72	0.000006	insulin secretion trait (VT:0003564)	plasma insulin level (CMO:0000342)	2	150540301	202447032	Rat
1598833	Bp295	Blood pressure QTL 295	3.5		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	147798556	192798556	Rat
1354622	Kidm16	Kidney mass QTL 16	3		kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	2	81754530	222436696	Rat
631266	Bp132	Blood pressure QTL 132		0.0005	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	46123260	202447032	Rat
631522	Bp74	Blood pressure QTL 74		0.05	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	172710921	184114403	Rat
7488927	Bp365	Blood pressure QTL 365		0.008	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	162765032	207765032	Rat
1598838	Bp290	Blood pressure QTL 290	1.9		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	166539266	211539266	Rat
7488925	Bp364	Blood pressure QTL 364		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	160564068	205564068	Rat
2293843	Kiddil6	Kidney dilation QTL 6	3.1		kidney pelvis morphology trait (VT:0004194)	hydronephrosis severity score (CMO:0001208)	2	42804607	182042367	Rat
2306901	Bp337	Blood pressure QTL 337		0.01	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	164073756	227146641	Rat
1354605	Rf48	Renal function QTL 48	2.9		blood creatinine amount (VT:0005328)	plasma creatinine level (CMO:0000537)	2	74786664	206665859	Rat
6903312	Bw112	Body weight QTL 112	3.2	0.0013	body mass (VT:0001259)	body weight (CMO:0000012)	2	143657569	184114274	Rat
7488904	Bp363	Blood pressure QTL 363		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	172982062	175950118	Rat
1354601	Slep1	Serum leptin concentration QTL 1	5.39		blood leptin amount (VT:0005667)	serum leptin level (CMO:0000780)	2	43171017	184114403	Rat

RH132519

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	2	174,819,525 - 174,819,731 (+)	MAPPER	mRatBN7.2
Rnor_6.0	2	188,727,069 - 188,727,274	NCBI	Rnor6.0
Rnor_5.0	2	208,141,512 - 208,141,623	NCBI	Rnor5.0
RGSC_v3.4	2	181,598,143 - 181,598,348	UniSTS	RGSC3.4
Celera	2	168,760,264 - 168,760,469	UniSTS
RH 3.4 Map	2	1161.4	UniSTS
Cytogenetic Map	2	q34	UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
6	6	26	29	25	13	6	13	6	49	24	14	6	17	12


RefSeq Transcripts	NM_053614	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC098750	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF144410	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000002	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	U15149	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000074920 ⟹ ENSRNOP00000065837

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	2	174,819,459 - 174,820,127 (-)	Ensembl
Rnor_6.0 Ensembl	2	188,727,002 - 188,727,670 (-)	Ensembl

RefSeq Acc Id:

NM_053614 ⟹ NP_446066

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	177,117,171 - 177,117,859 (-)	NCBI
mRatBN7.2	2	174,819,439 - 174,820,127 (-)	NCBI
Rnor_6.0	2	188,727,004 - 188,727,670 (-)	NCBI
Rnor_5.0	2	208,141,448 - 208,141,949 (-)	NCBI
RGSC_v3.4	2	181,598,078 - 181,598,744 (-)	RGD
Celera	2	168,760,199 - 168,760,865 (-)	RGD

Sequence:

show sequence

TGAATTCGTGGGCCGAGCTGCTGTCCACCATGAAGCCACCGATGCAGCCCCTGACCCAGGCCCTGCCCTTCTCTCTGAGAGATGCCCTTCAAGGCACTGGTCTCCGCGTGCCTGTCATTAAGATGGGC
ACAGGGTGGGAGGGCATGTATCGAACCCTGAAGGAAGTCGCCCACATCCTTCTTTGTTGCTGGTGTATCAAGGAACTGCTGGATTAATGGTGGCGGGGAACACCTCCTGTCATCCCTGACACCAAGAC
CTGCATCACTCAGCCCTAAGACTCCTGGAGCCTGCCGGCCTTCACCAAGGATGGAGCGCAAACAACTGAGAGGGAACCATGAACCTTGCTTTGAGCCGTTTATGCGTCTGACCTGCCTCATCCTGGGG
CATGTATCCTGGGCTCCTGTCTCTGGTGTGGTTCTGGTACTCATGAGCTTGGCTTGCCGCCTAAGACTCCAGTGAGACTACAGCAGGATCTAATATTCTCCAAAATTGGTACAGTGACCCCACCAACC
CACACACTTGAAGAACCAGGAATGGACTGCCCCTAAGATACCTGGTAATCACTCAACTATATAATAAATAGCCTTGAGGAC

hide sequence


Protein RefSeqs	NP_446066	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAA87067	(Get FASTA)	NCBI Sequence Viewer
	AAD38376	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000065837.1
GenBank Protein	Q9WVB7	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_446066 ⟸ NM_053614
- UniProtKB:	Q9WVB7 (UniProtKB/Swiss-Prot), Q62699 (UniProtKB/Swiss-Prot)
- Sequence:	show sequence MKPPMQPLTQALPFSLRDALQGTGLRVPVIKMGTGWEGMYRTLKEVAHILLCCWCIKELLD hide sequence

Ensembl Acc Id:

ENSRNOP00000065837 ⟸ ENSRNOT00000074920

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q9WVB7-F1-model_v2	AlphaFold	Q9WVB7	1-61	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

RGD ID:

13691473

Promoter ID:

EPDNEW_R1998

Type:

single initiation site

Name:

Lenep_1

Description:

lens epithelial protein

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	2	188,727,675 - 188,727,735	EPDNEW

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-52408	BioCyc
Ensembl Genes	ENSRNOG00000049513	Ensembl, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000074920.3	UniProtKB/Swiss-Prot
InterPro	LEP503	UniProtKB/Swiss-Prot
KEGG Report	rno:113917	UniProtKB/Swiss-Prot
NCBI Gene	113917	ENTREZGENE
PANTHER	LENS EPITHELIAL CELL PROTEIN LEP503	UniProtKB/Swiss-Prot
	PTHR16968	UniProtKB/Swiss-Prot
Pfam	LEP503	UniProtKB/Swiss-Prot
PhenoGen	Lenep	PhenoGen
RatGTEx	ENSRNOG00000049513	RatGTEx
TIGR	TC219271
UniProt	LENEP_RAT	UniProtKB/Swiss-Prot
	Q62699	ENTREZGENE
	Q9WVB7	ENTREZGENE
UniProt Secondary	Q62699	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2002-06-10	Lenep	lens epithelial protein			Symbol and Name status set to approved	70586	APPROVED

Note Type	Note	Reference
gene_domains	contains a basic and an acidic domain	1299216
gene_expression	localized in the epithelial cells along the entire anterior surface of the rat lens	68892
gene_expression	expressed at low level in newborn, increased ten-fold around postnatal day 14	68892
gene_process	involved in lens epithelial cell differentiation	68892
gene_protein	57 amino acids	1299216
gene_transcript	contains 2 exons	68892
gene_transcript	has 2 atypical GATA elements which are conserved between rat and human suggesting functional significance	68892

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Send us a Message

Imported Disease Annotations - ClinVar