Symbol:
Aqp9
Name:
aquaporin 9
RGD ID:
68433
Description:
Enables channel activity and nucleobase transmembrane transporter activity. Involved in several processes, including canalicular bile acid transport; nucleobase transport; and response to pain. Located in basolateral plasma membrane. Orthologous to human AQP9 (aquaporin 9); PARTICIPATES IN water transport pathway; bile acid transport pathway; INTERACTS WITH (+)-schisandrin B; 17alpha-ethynylestradiol; 17beta-estradiol.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
AQP-9; aquaglyceroporin-9; aquaporin-9; MGC93419; neutral solute channel aquaporin 9
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
AQP9 (aquaporin 9) HGNC
Ensembl, HomoloGene, Inparanoid, NCBI, Panther, PhylomeDB
Mus musculus (house mouse):
Aqp9 (aquaporin 9) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Aqp9 (aquaporin 9) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
AQP9 (aquaporin 9) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
AQP9 (aquaporin 9) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Aqp9 (aquaporin 9) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
AQP9 (aquaporin 9) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
AQP9 (aquaporin 9) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Aqp9 (aquaporin 9) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Mus musculus (house mouse):
Aqp9 (aquaporin 9)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
AQP9 (aquaporin 9)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
aqp9b (aquaporin 9b)
Alliance
DIOPT (InParanoid|OMA|OrthoFinder|PANTHER|PhylomeDB)
Saccharomyces cerevisiae (baker's yeast):
AQY3
Alliance
DIOPT (Ensembl Compara|Hieranoid|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
aqp-1
Alliance
DIOPT (OrthoFinder|OrthoInspector|PANTHER|PhylomeDB)
Caenorhabditis elegans (roundworm):
aqp-2
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
aqp-3
Alliance
DIOPT (InParanoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):
aqp9
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 8 80,678,027 - 80,718,273 (-) NCBI GRCr8 mRatBN7.2 8 71,797,231 - 71,837,485 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 8 71,797,234 - 71,837,395 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 8 77,331,526 - 77,371,805 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 8 75,604,495 - 75,644,778 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 8 73,441,536 - 73,481,821 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 8 77,559,621 - 77,599,781 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 8 77,559,624 - 77,599,781 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 8 75,483,006 - 75,523,423 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 8 75,611,485 - 75,651,646 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 8 75,630,541 - 75,670,700 (-) NCBI Celera 8 69,899,442 - 69,939,523 (+) NCBI Celera Cytogenetic Map 8 q24 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Aqp9 Rat (+)-schisandrin B multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of AQP9 mRNA] CTD PMID:31150632 Aqp9 Rat (-)-demecolcine increases expression ISO AQP9 (Homo sapiens) 6480464 Demecolcine results in increased expression of AQP9 mRNA CTD PMID:23649840 Aqp9 Rat (1->4)-beta-D-glucan multiple interactions ISO Aqp9 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of AQP9 mRNA CTD PMID:36331819 Aqp9 Rat 17alpha-ethynylestradiol increases expression EXP 6480464 Ethinyl Estradiol results in increased expression of AQP9 mRNA CTD PMID:17108234 Aqp9 Rat 17beta-estradiol multiple interactions EXP 6480464 [Estradiol results in decreased expression of AQP9 mRNA] which results in decreased uptake of Glycerol and Isoflavones inhibits the reaction [Estradiol results in increased expression of AQP9 mRNA] CTD PMID:20381596 and PMID:22114114 Aqp9 Rat 17beta-estradiol increases expression ISO Aqp9 (Mus musculus) 6480464 Estradiol results in increased expression of AQP9 mRNA CTD PMID:39298647 Aqp9 Rat 17beta-estradiol decreases expression EXP 6480464 Estradiol results in decreased expression of AQP9 mRNA CTD PMID:22114114 Aqp9 Rat 17beta-estradiol increases expression EXP 6480464 Estradiol results in increased expression of AQP9 mRNA and Estradiol results in increased expression of AQP9 protein CTD PMID:17026757 and PMID:20381596 Aqp9 Rat 17beta-hydroxy-5alpha-androstan-3-one increases expression EXP 6480464 Dihydrotestosterone results in increased expression of AQP9 mRNA and Dihydrotestosterone results in increased expression of AQP9 protein CTD PMID:17026757 Aqp9 Rat 17beta-hydroxy-5alpha-androstan-3-one multiple interactions ISO AQP9 (Homo sapiens) 6480464 2-(4-morpholinyl)-8-phenyl-4H-1-benzopyran-4-one inhibits the reaction [Dihydrotestosterone results in decreased expression of AQP9 mRNA] CTD PMID:20378617 Aqp9 Rat 17beta-hydroxy-5alpha-androstan-3-one decreases expression ISO AQP9 (Homo sapiens) 6480464 Dihydrotestosterone results in decreased expression of AQP9 mRNA and Dihydrotestosterone results in decreased expression of AQP9 protein CTD PMID:20378617 Aqp9 Rat 2,2',4,4'-Tetrabromodiphenyl ether affects expression ISO Aqp9 (Mus musculus) 6480464 2 more ... CTD PMID:30294300 Aqp9 Rat 2,3,4,7,8-Pentachlorodibenzofuran decreases expression EXP 6480464 2 more ... CTD PMID:21724226 Aqp9 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Aqp9 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of AQP9 mRNA CTD PMID:18796159 Aqp9 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO AQP9 (Homo sapiens) 6480464 [Endosulfan co-treated with Tetrachlorodibenzodioxin] results in decreased expression of AQP9 mRNA CTD PMID:26159488 Aqp9 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO AQP9 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in decreased expression of AQP9 mRNA CTD PMID:20106945 and PMID:26159488 Aqp9 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of AQP9 mRNA CTD PMID:19490992 more ... Aqp9 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Aqp9 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of AQP9 mRNA CTD PMID:21570461 Aqp9 Rat 2,3,7,8-Tetrachlorodibenzofuran decreases expression EXP 6480464 2 more ... CTD PMID:21724226 Aqp9 Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether affects expression ISO Aqp9 (Mus musculus) 6480464 2 more ... CTD PMID:38648751 Aqp9 Rat 2-hydroxypropanoic acid increases uptake EXP 6480464 AQP9 protein results in increased uptake of Lactic Acid CTD PMID:9733774 Aqp9 Rat 2-hydroxypropanoic acid increases uptake ISO AQP9 (Homo sapiens) 6480464 AQP9 protein results in increased uptake of Lactic Acid CTD PMID:28798983 Aqp9 Rat 2-hydroxypropanoic acid multiple interactions ISO AQP9 (Homo sapiens) 6480464 arsenite inhibits the reaction [AQP9 protein results in increased uptake of Lactic Acid] more ... CTD PMID:28798983 Aqp9 Rat 2-hydroxypropanoic acid decreases expression ISO AQP9 (Homo sapiens) 6480464 Lactic Acid results in decreased expression of AQP9 mRNA CTD PMID:30851411 Aqp9 Rat 3-hydroxybutyric acid increases uptake EXP 6480464 AQP9 protein results in increased uptake of 3-Hydroxybutyric Acid CTD PMID:9733774 Aqp9 Rat 4,4'-diaminodiphenylmethane decreases expression ISO Aqp9 (Mus musculus) 6480464 4 and 4'-diaminodiphenylmethane results in decreased expression of AQP9 mRNA CTD PMID:18648102 Aqp9 Rat 4,4'-sulfonyldiphenol decreases expression ISO Aqp9 (Mus musculus) 6480464 bisphenol S results in decreased expression of AQP9 mRNA CTD PMID:39298647 Aqp9 Rat 4-hydroxyphenyl retinamide increases expression ISO Aqp9 (Mus musculus) 6480464 Fenretinide results in increased expression of AQP9 mRNA CTD PMID:28973697 Aqp9 Rat 5-azacytidine multiple interactions ISO AQP9 (Homo sapiens) 6480464 [Azacitidine results in increased expression of AQP9 mRNA] which results in increased uptake of arsenic trioxide and HNF1A mutant form inhibits the reaction [Azacitidine results in increased expression of AQP9 mRNA] CTD PMID:25953102 Aqp9 Rat 5-azacytidine increases expression ISO AQP9 (Homo sapiens) 6480464 Azacitidine results in increased expression of AQP9 mRNA CTD PMID:25953102 Aqp9 Rat 5-fluorouracil increases uptake EXP 6480464 AQP9 protein results in increased uptake of Fluorouracil CTD PMID:9733774 Aqp9 Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of AQP9 mRNA CTD PMID:25825206 Aqp9 Rat 7,9-dihydro-1H-purine-2,6,8(3H)-trione multiple interactions ISO AQP9 (Homo sapiens) 6480464 AQP9 mRNA affects the reaction [Uric Acid results in increased secretion of IL1B protein] CTD PMID:21051542 Aqp9 Rat acetamide decreases expression EXP 6480464 acetamide results in decreased expression of AQP9 mRNA CTD PMID:31881176 Aqp9 Rat adenine increases uptake EXP 6480464 AQP9 protein results in increased uptake of Adenine CTD PMID:9733774 Aqp9 Rat aflatoxin B1 affects expression ISO AQP9 (Homo sapiens) 6480464 Aflatoxin B1 affects the expression of AQP9 protein CTD PMID:20106945 Aqp9 Rat aflatoxin B1 decreases expression ISO AQP9 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased expression of AQP9 mRNA CTD PMID:27153756 Aqp9 Rat aflatoxin B1 decreases expression ISO Aqp9 (Mus musculus) 6480464 Aflatoxin B1 results in decreased expression of AQP9 mRNA CTD PMID:19770486 Aqp9 Rat all-trans-retinoic acid multiple interactions ISO AQP9 (Homo sapiens) 6480464 [Tretinoin co-treated with Arsenic Trioxide] results in increased expression of AQP9 mRNA more ... CTD PMID:16968895 more ... Aqp9 Rat all-trans-retinoic acid increases expression ISO AQP9 (Homo sapiens) 6480464 Tretinoin results in increased expression of AQP9 more ... CTD PMID:16968895 more ... Aqp9 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of AQP9 mRNA CTD PMID:16483693 Aqp9 Rat amphetamine increases expression EXP 6480464 Amphetamine results in increased expression of AQP9 mRNA CTD PMID:30779732 Aqp9 Rat androstane-3,17-diol increases expression EXP 6480464 Androstane-3 more ... CTD PMID:17026757 Aqp9 Rat antimony(0) multiple interactions ISO AQP9 (Homo sapiens) 6480464 AQP9 protein results in increased uptake of and results in increased susceptibility to Antimony CTD PMID:15336539 Aqp9 Rat antirheumatic drug decreases expression ISO AQP9 (Homo sapiens) 6480464 Antirheumatic Agents results in decreased expression of AQP9 mRNA CTD PMID:24449571 Aqp9 Rat arsane increases expression ISO AQP9 (Homo sapiens) 6480464 Arsenic results in increased expression of AQP9 mRNA CTD PMID:23866971 and PMID:28615018 Aqp9 Rat arsane multiple interactions ISO AQP9 (Homo sapiens) 6480464 [sodium arsenate results in increased abundance of Arsenic] which results in decreased expression of AQP9 mRNA more ... CTD PMID:32525701 and PMID:36504884 Aqp9 Rat arsenic atom multiple interactions ISO AQP9 (Homo sapiens) 6480464 [sodium arsenate results in increased abundance of Arsenic] which results in decreased expression of AQP9 mRNA more ... CTD PMID:32525701 and PMID:36504884 Aqp9 Rat arsenic atom increases expression ISO AQP9 (Homo sapiens) 6480464 Arsenic results in increased expression of AQP9 mRNA CTD PMID:23866971 and PMID:28615018 Aqp9 Rat arsenite(3-) increases uptake ISO AQP9 (Homo sapiens) 6480464 AQP9 protein results in increased uptake of arsenite CTD PMID:11972053 Aqp9 Rat arsenite(3-) increases response to substance ISO AQP9 (Homo sapiens) 6480464 AQP9 protein results in increased susceptibility to arsenite CTD PMID:29566083 Aqp9 Rat arsenite(3-) multiple interactions ISO AQP9 (Homo sapiens) 6480464 arsenite inhibits the reaction [AQP9 protein results in increased uptake of Lactic Acid] more ... CTD PMID:28798983 Aqp9 Rat arsenite(3-) increases uptake ISO Aqp9 (Mus musculus) 6480464 AQP9 protein results in increased uptake of arsenite CTD PMID:19341753 Aqp9 Rat arsenite(3-) multiple interactions ISO Aqp9 (Mus musculus) 6480464 Sorbitol inhibits the reaction [AQP9 protein results in increased uptake of arsenite] CTD PMID:19341753 Aqp9 Rat arsenite(3-) increases response to substance ISO Aqp9 (Mus musculus) 6480464 AQP9 protein results in increased susceptibility to arsenite CTD PMID:19341753 Aqp9 Rat arsenous acid increases expression ISO AQP9 (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of AQP9 protein CTD PMID:21945491 Aqp9 Rat arsenous acid increases uptake ISO AQP9 (Homo sapiens) 6480464 AQP9 protein results in increased uptake of Arsenic Trioxide CTD PMID:19100828 and PMID:35590355 Aqp9 Rat arsenous acid multiple interactions ISO AQP9 (Homo sapiens) 6480464 [Azacitidine results in increased expression of AQP9 mRNA] which results in increased uptake of Arsenic Trioxide more ... CTD PMID:15336539 more ... Aqp9 Rat arsenous acid increases import ISO AQP9 (Homo sapiens) 6480464 AQP9 protein results in increased import of Arsenic Trioxide CTD PMID:16968895 Aqp9 Rat arsenous acid affects expression ISO AQP9 (Homo sapiens) 6480464 Arsenic Trioxide affects the expression of AQP9 protein CTD PMID:19100828 Aqp9 Rat arsenous acid increases response to substance ISO AQP9 (Homo sapiens) 6480464 AQP9 protein results in increased susceptibility to Arsenic Trioxide CTD PMID:16968895 Aqp9 Rat astragaloside IV increases expression ISO Aqp9 (Mus musculus) 6480464 astragaloside A results in increased expression of AQP9 mRNA and astragaloside A results in increased expression of AQP9 protein CTD PMID:37918281 Aqp9 Rat atrazine affects methylation EXP 6480464 Atrazine affects the methylation of AQP9 gene CTD PMID:28931070 Aqp9 Rat Azoxymethane multiple interactions ISO Aqp9 (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of AQP9 mRNA CTD PMID:29950665 Aqp9 Rat benzo[a]pyrene decreases expression ISO AQP9 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of AQP9 mRNA CTD PMID:20064835 and PMID:32234424 Aqp9 Rat benzo[a]pyrene increases methylation ISO AQP9 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of AQP9 promoter CTD PMID:27901495 Aqp9 Rat benzo[a]pyrene affects methylation ISO AQP9 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of AQP9 5' UTR CTD PMID:27901495 Aqp9 Rat benzo[a]pyrene decreases expression ISO Aqp9 (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of AQP9 mRNA CTD PMID:19770486 Aqp9 Rat bis(2-ethylhexyl) phthalate increases expression ISO Aqp9 (Mus musculus) 6480464 Diethylhexyl Phthalate results in increased expression of AQP9 mRNA CTD PMID:34319233 Aqp9 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of AQP9 mRNA CTD PMID:25181051 Aqp9 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of AQP9 mRNA CTD PMID:30903817 Aqp9 Rat buta-1,3-diene decreases expression ISO Aqp9 (Mus musculus) 6480464 1 and 3-butadiene results in decreased expression of AQP9 mRNA CTD PMID:29038090 Aqp9 Rat calcitriol multiple interactions ISO AQP9 (Homo sapiens) 6480464 Calcitriol inhibits the reaction [[sodium arsenite results in increased abundance of Arsenic] which results in increased expression of AQP9 mRNA] CTD PMID:36504884 Aqp9 Rat calcitriol decreases expression ISO AQP9 (Homo sapiens) 6480464 Calcitriol results in decreased expression of AQP9 mRNA CTD PMID:36504884 Aqp9 Rat cannabidiol multiple interactions ISO Aqp9 (Mus musculus) 6480464 [lipopolysaccharide and E coli O55-B5 co-treated with Cannabidiol] results in increased expression of AQP9 mRNA CTD PMID:30742662 Aqp9 Rat cannabidiol increases expression ISO Aqp9 (Mus musculus) 6480464 Cannabidiol results in increased expression of AQP9 mRNA CTD PMID:21542829 and PMID:30742662 Aqp9 Rat carbon nanotube increases expression ISO AQP9 (Homo sapiens) 6480464 Nanotubes and Carbon results in increased expression of AQP9 mRNA CTD PMID:29348435 Aqp9 Rat carbonyl cyanide p-trifluoromethoxyphenylhydrazone multiple interactions ISO AQP9 (Homo sapiens) 6480464 Carbonyl Cyanide p-Trifluoromethoxyphenylhydrazone inhibits the reaction [AQP9 protein results in increased uptake of Lactic Acid] and Carbonyl Cyanide p-Trifluoromethoxyphenylhydrazone inhibits the reaction [AQP9 protein results in increased uptake of Selenious Acid] CTD PMID:28798983 Aqp9 Rat CGP 52608 multiple interactions ISO AQP9 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to AQP9 gene] CTD PMID:28238834 Aqp9 Rat cholesterol increases expression ISO AQP9 (Homo sapiens) 6480464 Cholesterol results in increased expression of AQP9 mRNA CTD PMID:26296894 Aqp9 Rat choline multiple interactions ISO Aqp9 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased expression of AQP9 mRNA CTD PMID:20938992 Aqp9 Rat cobalt atom multiple interactions ISO AQP9 (Homo sapiens) 6480464 [tungsten carbide co-treated with Cobalt] results in decreased expression of AQP9 mRNA CTD PMID:18078969 Aqp9 Rat copper(II) chloride increases expression ISO AQP9 (Homo sapiens) 6480464 cupric chloride results in increased expression of AQP9 mRNA CTD PMID:38568856 Aqp9 Rat curcumin increases expression ISO AQP9 (Homo sapiens) 6480464 Curcumin results in increased expression of AQP9 mRNA and Curcumin results in increased expression of AQP9 protein CTD PMID:34675983 Aqp9 Rat cycloastragenol increases expression ISO Aqp9 (Mus musculus) 6480464 cycloastragenol results in increased expression of AQP9 mRNA and cycloastragenol results in increased expression of AQP9 protein CTD PMID:37918281 Aqp9 Rat cyclosporin A decreases expression ISO AQP9 (Homo sapiens) 6480464 Cyclosporine results in decreased expression of AQP9 mRNA CTD PMID:20106945 Aqp9 Rat cyclosporin A increases expression ISO AQP9 (Homo sapiens) 6480464 Cyclosporine results in increased expression of AQP9 mRNA CTD PMID:27989131 Aqp9 Rat D-glucitol multiple interactions ISO Aqp9 (Mus musculus) 6480464 Sorbitol inhibits the reaction [AQP9 protein results in increased uptake of arsenite] CTD PMID:19341753 Aqp9 Rat D-glucitol increases uptake EXP 6480464 AQP9 protein results in increased uptake of Sorbitol CTD PMID:9733774 Aqp9 Rat D-mannitol increases uptake EXP 6480464 AQP9 protein results in increased uptake of Mannitol CTD PMID:9733774 Aqp9 Rat dextran sulfate multiple interactions ISO Aqp9 (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of AQP9 mRNA CTD PMID:29950665 Aqp9 Rat diarsenic trioxide increases uptake ISO AQP9 (Homo sapiens) 6480464 AQP9 protein results in increased uptake of Arsenic Trioxide CTD PMID:19100828 and PMID:35590355 Aqp9 Rat diarsenic trioxide multiple interactions ISO AQP9 (Homo sapiens) 6480464 [Azacitidine results in increased expression of AQP9 mRNA] which results in increased uptake of Arsenic Trioxide more ... CTD PMID:15336539 more ... Aqp9 Rat diarsenic trioxide increases import ISO AQP9 (Homo sapiens) 6480464 AQP9 protein results in increased import of Arsenic Trioxide CTD PMID:16968895 Aqp9 Rat diarsenic trioxide increases response to substance ISO AQP9 (Homo sapiens) 6480464 AQP9 protein results in increased susceptibility to Arsenic Trioxide CTD PMID:16968895 Aqp9 Rat diarsenic trioxide affects expression ISO AQP9 (Homo sapiens) 6480464 Arsenic Trioxide affects the expression of AQP9 protein CTD PMID:19100828 Aqp9 Rat diarsenic trioxide increases expression ISO AQP9 (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of AQP9 protein CTD PMID:21945491 Aqp9 Rat Dibutyl phosphate affects expression ISO AQP9 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of AQP9 mRNA CTD PMID:37042841 Aqp9 Rat dibutyl phthalate increases expression EXP 6480464 Dibutyl Phthalate results in increased expression of AQP9 mRNA CTD PMID:21266533 Aqp9 Rat diclofenac decreases expression ISO Aqp9 (Mus musculus) 6480464 Diclofenac results in decreased expression of AQP9 mRNA CTD PMID:35537566 Aqp9 Rat dieldrin decreases expression EXP 6480464 Dieldrin results in decreased expression of AQP9 mRNA CTD PMID:23153324 Aqp9 Rat dioxygen multiple interactions EXP 6480464 [Oxygen deficiency co-treated with Blood Glucose deficiency co-treated with Particulate Matter] results in increased expression of AQP9 mRNA CTD PMID:33729688 Aqp9 Rat diprotium oxide multiple interactions EXP 6480464 CFTR protein promotes the reaction [AQP9 protein affects the transport of Water] more ... CTD PMID:10205677 more ... Aqp9 Rat diprotium oxide increases transport EXP 6480464 AQP9 protein results in increased transport of Water CTD PMID:10205677 more ... Aqp9 Rat diprotium oxide increases transport ISO AQP9 (Homo sapiens) 6480464 AQP9 protein results in increased transport of Water CTD PMID:9514918 Aqp9 Rat diprotium oxide multiple interactions ISO AQP9 (Homo sapiens) 6480464 Mercuric Chloride inhibits the reaction [AQP9 protein results in increased transport of Water] CTD PMID:9514918 Aqp9 Rat diprotium oxide affects transport EXP 6480464 AQP9 protein affects the transport of Water CTD PMID:12606488 Aqp9 Rat endosulfan multiple interactions ISO AQP9 (Homo sapiens) 6480464 [Endosulfan co-treated with Tetrachlorodibenzodioxin] results in decreased expression of AQP9 mRNA CTD PMID:26159488 Aqp9 Rat fenofibrate decreases expression ISO AQP9 (Homo sapiens) 6480464 Fenofibrate results in decreased expression of AQP9 mRNA CTD PMID:25572481 Aqp9 Rat fenthion decreases expression ISO Aqp9 (Mus musculus) 6480464 Fenthion results in decreased expression of AQP9 mRNA CTD PMID:34813904 Aqp9 Rat fipronil decreases expression EXP 6480464 fipronil results in decreased expression of AQP9 mRNA CTD PMID:23962444 and PMID:34044035 Aqp9 Rat folic acid multiple interactions ISO Aqp9 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased expression of AQP9 mRNA CTD PMID:20938992 Aqp9 Rat formaldehyde increases expression ISO AQP9 (Homo sapiens) 6480464 Formaldehyde results in increased expression of AQP9 mRNA CTD PMID:23649840 Aqp9 Rat genistein decreases expression EXP 6480464 Genistein results in decreased expression of AQP9 mRNA CTD PMID:20381596 Aqp9 Rat glycerol increases abundance ISO Aqp9 (Mus musculus) 6480464 AQP9 gene mutant form results in increased abundance of Glycerol CTD PMID:17360690 Aqp9 Rat glycerol increases uptake EXP 6480464 AQP9 protein results in increased uptake of Glycerol CTD PMID:22114114 and PMID:9733774 Aqp9 Rat glycerol multiple interactions EXP 6480464 [Estradiol results in decreased expression of AQP9 mRNA] which results in decreased uptake of Glycerol CTD PMID:22114114 Aqp9 Rat glycerol increases transport EXP 6480464 AQP9 protein results in increased transport of Glycerol CTD PMID:10205677 Aqp9 Rat glycerol multiple interactions ISO Aqp9 (Mus musculus) 6480464 AQP9 protein affects the uptake of and affects the metabolism of Glycerol CTD PMID:17360690 Aqp9 Rat heptachlor decreases expression EXP 6480464 Heptachlor results in decreased expression of AQP9 mRNA CTD PMID:23153324 Aqp9 Rat homovanillic acid multiple interactions ISO Aqp9 (Mus musculus) 6480464 AQP9 gene mutant form inhibits the reaction [1-Methyl-4-phenylpyridinium results in decreased abundance of Homovanillic Acid] CTD PMID:29566083 Aqp9 Rat indirubin multiple interactions ISO Aqp9 (Mus musculus) 6480464 [[tetraarsenic tetrasulfide co-treated with indirubin] results in increased expression of AQP9 protein] which results in increased uptake of tetraarsenic tetrasulfide more ... CTD PMID:18344322 Aqp9 Rat indirubin-3'-monoxime multiple interactions ISO Aqp9 (Mus musculus) 6480464 indirubin-3'-monoxime promotes the reaction [tetraarsenic tetrasulfide results in increased expression of AQP9 mRNA] and indirubin-3'-monoxime promotes the reaction [tetraarsenic tetrasulfide results in increased expression of AQP9 protein] CTD PMID:18344322 Aqp9 Rat isoflavones multiple interactions EXP 6480464 Isoflavones inhibits the reaction [Estradiol results in increased expression of AQP9 mRNA] CTD PMID:20381596 Aqp9 Rat L-methionine multiple interactions ISO Aqp9 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased expression of AQP9 mRNA CTD PMID:20938992 Aqp9 Rat lamivudine multiple interactions ISO Aqp9 (Mus musculus) 6480464 [Zidovudine co-treated with Lamivudine] results in increased expression of AQP9 mRNA CTD PMID:18313992 Aqp9 Rat lipopolysaccharide multiple interactions ISO AQP9 (Homo sapiens) 6480464 [S-(1 more ... CTD PMID:35811015 Aqp9 Rat lipopolysaccharide increases expression ISO AQP9 (Homo sapiens) 6480464 Lipopolysaccharides results in increased expression of AQP9 mRNA CTD PMID:35811015 Aqp9 Rat lonidamine multiple interactions EXP 6480464 lonidamine inhibits the reaction [CFTR protein promotes the reaction [AQP9 protein affects the transport of Water]] CTD PMID:12606488 Aqp9 Rat LY294002 multiple interactions ISO AQP9 (Homo sapiens) 6480464 2-(4-morpholinyl)-8-phenyl-4H-1-benzopyran-4-one inhibits the reaction [Dihydrotestosterone results in decreased expression of AQP9 mRNA] CTD PMID:20378617 Aqp9 Rat malathion increases expression ISO AQP9 (Homo sapiens) 6480464 Malathion results in increased expression of AQP9 mRNA CTD PMID:37047231 Aqp9 Rat mercury atom multiple interactions EXP 6480464 Mercury inhibits the reaction [AQP9 protein results in increased transport of Water] CTD PMID:21259319 Aqp9 Rat mercury dichloride decreases activity ISO AQP9 (Homo sapiens) 6480464 Mercuric Chloride results in decreased activity of AQP9 protein CTD PMID:9514918 Aqp9 Rat mercury dichloride multiple interactions ISO AQP9 (Homo sapiens) 6480464 Mercuric Chloride inhibits the reaction [AQP9 protein results in increased transport of Water] CTD PMID:9514918 Aqp9 Rat mercury dichloride decreases activity EXP 6480464 Mercuric Chloride results in decreased activity of AQP9 protein CTD PMID:9733774 Aqp9 Rat mercury dichloride multiple interactions EXP 6480464 Mercuric Chloride inhibits the reaction [AQP9 protein results in increased transport of Water] CTD PMID:10205677 more ... Aqp9 Rat mercury(0) multiple interactions EXP 6480464 Mercury inhibits the reaction [AQP9 protein results in increased transport of Water] CTD PMID:21259319 Aqp9 Rat mirex decreases expression EXP 6480464 Mirex results in decreased expression of AQP9 mRNA CTD PMID:23153324 Aqp9 Rat N-methyl-4-phenylpyridinium decreases expression EXP 6480464 1-Methyl-4-phenylpyridinium results in decreased expression of AQP9 mRNA CTD PMID:28801915 Aqp9 Rat N-methyl-4-phenylpyridinium increases transport EXP 6480464 AQP9 protein results in increased transport of 1-Methyl-4-phenylpyridinium CTD PMID:29566083 Aqp9 Rat N-methyl-4-phenylpyridinium multiple interactions ISO Aqp9 (Mus musculus) 6480464 AQP9 gene mutant form inhibits the reaction [1-Methyl-4-phenylpyridinium results in decreased abundance of Homovanillic Acid] CTD PMID:29566083 Aqp9 Rat N-methyl-4-phenylpyridinium increases response to substance ISO AQP9 (Homo sapiens) 6480464 AQP9 protein results in increased susceptibility to 1-Methyl-4-phenylpyridinium CTD PMID:29566083 Aqp9 Rat N-methyl-4-phenylpyridinium decreases response to substance ISO Aqp9 (Mus musculus) 6480464 AQP9 gene mutant form results in decreased susceptibility to 1-Methyl-4-phenylpyridinium CTD PMID:29566083 Aqp9 Rat N-nitrosodiethylamine decreases expression EXP 6480464 Diethylnitrosamine results in decreased expression of AQP9 mRNA CTD PMID:19638242 Aqp9 Rat nickel sulfate decreases expression ISO AQP9 (Homo sapiens) 6480464 nickel sulfate results in decreased expression of AQP9 mRNA CTD PMID:18651567 Aqp9 Rat nigericin multiple interactions ISO AQP9 (Homo sapiens) 6480464 Nigericin inhibits the reaction [AQP9 protein results in increased uptake of Lactic Acid] and Nigericin inhibits the reaction [AQP9 protein results in increased uptake of Selenious Acid] CTD PMID:28798983 Aqp9 Rat nitrofen increases expression EXP 6480464 nitrofen results in increased expression of AQP9 mRNA CTD PMID:33484710 Aqp9 Rat O-methyleugenol decreases expression ISO AQP9 (Homo sapiens) 6480464 methyleugenol results in decreased expression of AQP9 mRNA CTD PMID:32234424 Aqp9 Rat orphenadrine affects expression EXP 6480464 Orphenadrine affects the expression of AQP9 mRNA CTD PMID:23665939 Aqp9 Rat oxaliplatin increases expression EXP 6480464 oxaliplatin results in increased expression of AQP9 mRNA CTD PMID:25729387 Aqp9 Rat oxaliplatin multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in increased expression of AQP9 mRNA CTD PMID:25729387 Aqp9 Rat ozone decreases expression EXP 6480464 Ozone results in decreased expression of AQP9 mRNA CTD PMID:26667333 Aqp9 Rat ozone multiple interactions ISO AQP9 (Homo sapiens) 6480464 [Air Pollutants results in increased abundance of Ozone] which affects the expression of AQP9 mRNA CTD PMID:35430440 Aqp9 Rat ozone multiple interactions ISO Aqp9 (Mus musculus) 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in decreased expression of AQP9 mRNA CTD PMID:34911549 Aqp9 Rat paracetamol decreases expression ISO AQP9 (Homo sapiens) 6480464 Acetaminophen results in decreased expression of AQP9 mRNA CTD PMID:21420995 and PMID:29067470 Aqp9 Rat perfluorononanoic acid decreases expression ISO AQP9 (Homo sapiens) 6480464 perfluoro-n-nonanoic acid results in decreased expression of AQP9 mRNA CTD PMID:32588087 Aqp9 Rat perfluorooctane-1-sulfonic acid affects expression ISO Aqp9 (Mus musculus) 6480464 perfluorooctane sulfonic acid affects the expression of AQP9 mRNA CTD PMID:19429403 Aqp9 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Aqp9 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of AQP9 mRNA and [perfluorooctane sulfonic acid co-treated with Pectins] results in decreased expression of AQP9 mRNA CTD PMID:36331819 Aqp9 Rat perfluorooctane-1-sulfonic acid decreases expression ISO AQP9 (Homo sapiens) 6480464 perfluorooctane sulfonic acid results in decreased expression of AQP9 mRNA CTD PMID:32588087 Aqp9 Rat perfluorooctane-1-sulfonic acid decreases expression EXP 6480464 perfluorooctane sulfonic acid results in decreased expression of AQP9 mRNA CTD PMID:18692542 Aqp9 Rat perfluorooctanoic acid affects expression ISO Aqp9 (Mus musculus) 6480464 perfluorooctanoic acid affects the expression of AQP9 mRNA CTD PMID:19429403 Aqp9 Rat perfluorooctanoic acid decreases expression ISO AQP9 (Homo sapiens) 6480464 perfluorooctanoic acid results in decreased expression of AQP9 mRNA CTD PMID:32588087 Aqp9 Rat perfluorooctanoic acid decreases expression EXP 6480464 perfluorooctanoic acid results in decreased expression of AQP9 mRNA CTD PMID:19162173 Aqp9 Rat phenformin increases expression EXP 6480464 Phenformin results in increased expression of AQP9 mRNA CTD PMID:31324951 Aqp9 Rat phloretin multiple interactions EXP 6480464 Phloretin inhibits the reaction [AQP9 protein results in increased transport of Water] and Phloretin inhibits the reaction [CFTR protein promotes the reaction [AQP9 protein affects the transport of Water]] CTD PMID:12606488 and PMID:9733774 Aqp9 Rat phloretin multiple interactions ISO AQP9 (Homo sapiens) 6480464 Phloretin inhibits the reaction [AQP9 protein results in increased uptake of Lactic Acid] more ... CTD PMID:28798983 Aqp9 Rat phloretin decreases activity EXP 6480464 Phloretin results in decreased activity of AQP9 protein CTD PMID:21259319 and PMID:9733774 Aqp9 Rat piperonyl butoxide decreases expression EXP 6480464 Piperonyl Butoxide results in decreased expression of AQP9 mRNA CTD PMID:22484513 Aqp9 Rat pirinixic acid decreases expression ISO Aqp9 (Mus musculus) 6480464 pirinixic acid results in decreased expression of AQP9 mRNA CTD PMID:18445702 Aqp9 Rat pirinixic acid decreases expression EXP 6480464 pirinixic acid results in decreased expression of AQP9 mRNA CTD PMID:19162173 and PMID:22484513 Aqp9 Rat potassium dichromate decreases expression ISO Aqp9 (Mus musculus) 6480464 Potassium Dichromate results in decreased expression of AQP9 mRNA CTD PMID:23608068 Aqp9 Rat pregnenolone 16alpha-carbonitrile decreases expression EXP 6480464 Pregnenolone Carbonitrile results in decreased expression of AQP9 mRNA CTD PMID:19162173 Aqp9 Rat quercetin decreases expression EXP 6480464 Quercetin results in decreased expression of AQP9 mRNA and Quercetin results in decreased expression of AQP9 protein CTD PMID:28431985 Aqp9 Rat rac-lactic acid increases uptake EXP 6480464 AQP9 protein results in increased uptake of Lactic Acid CTD PMID:9733774 Aqp9 Rat rac-lactic acid multiple interactions ISO AQP9 (Homo sapiens) 6480464 arsenite inhibits the reaction [AQP9 protein results in increased uptake of Lactic Acid] more ... CTD PMID:28798983 Aqp9 Rat rac-lactic acid increases uptake ISO AQP9 (Homo sapiens) 6480464 AQP9 protein results in increased uptake of Lactic Acid CTD PMID:28798983 Aqp9 Rat rac-lactic acid decreases expression ISO AQP9 (Homo sapiens) 6480464 Lactic Acid results in decreased expression of AQP9 mRNA CTD PMID:30851411 Aqp9 Rat S-(1,2-dichlorovinyl)-L-cysteine multiple interactions ISO AQP9 (Homo sapiens) 6480464 [S-(1 more ... CTD PMID:35811015 Aqp9 Rat selenic acid increases uptake ISO AQP9 (Homo sapiens) 6480464 AQP9 protein results in increased uptake of Selenic Acid analog CTD PMID:28798983 Aqp9 Rat selenic acid multiple interactions ISO AQP9 (Homo sapiens) 6480464 arsenite inhibits the reaction [AQP9 protein results in increased uptake of Selenic Acid analog] and Phloretin inhibits the reaction [AQP9 protein results in increased uptake of Selenic Acid analog] CTD PMID:28798983 Aqp9 Rat selenous acid increases uptake ISO AQP9 (Homo sapiens) 6480464 AQP9 protein results in increased uptake of Selenious Acid CTD PMID:28798983 Aqp9 Rat selenous acid multiple interactions ISO AQP9 (Homo sapiens) 6480464 arsenite inhibits the reaction [AQP9 protein results in increased uptake of Selenious Acid] more ... CTD PMID:28798983 Aqp9 Rat serpentine asbestos increases expression ISO AQP9 (Homo sapiens) 6480464 Asbestos and Serpentine results in increased expression of AQP9 mRNA CTD PMID:24160326 Aqp9 Rat sodium arsenate multiple interactions ISO AQP9 (Homo sapiens) 6480464 [sodium arsenate results in increased abundance of Arsenic] which results in decreased expression of AQP9 mRNA CTD PMID:32525701 Aqp9 Rat sodium arsenite increases response to substance ISO Aqp9 (Mus musculus) 6480464 AQP9 gene mutant form results in increased susceptibility to sodium arsenite CTD PMID:19805235 Aqp9 Rat sodium arsenite multiple interactions ISO AQP9 (Homo sapiens) 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of AQP9 mRNA and Calcitriol inhibits the reaction [[sodium arsenite results in increased abundance of Arsenic] which results in increased expression of AQP9 mRNA] CTD PMID:36504884 Aqp9 Rat sodium arsenite increases expression ISO AQP9 (Homo sapiens) 6480464 sodium arsenite results in increased expression of AQP9 mRNA CTD PMID:38568856 Aqp9 Rat sodium arsenite decreases expression ISO AQP9 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of AQP9 mRNA CTD PMID:29301061 Aqp9 Rat sodium arsenite decreases expression ISO Aqp9 (Mus musculus) 6480464 sodium arsenite results in decreased expression of AQP9 mRNA CTD PMID:29108910 Aqp9 Rat sodium arsenite affects transport ISO Aqp9 (Mus musculus) 6480464 AQP9 protein affects the transport of sodium arsenite CTD PMID:19805235 Aqp9 Rat sodium arsenite increases expression ISO Aqp9 (Mus musculus) 6480464 sodium arsenite results in increased expression of AQP9 mRNA and sodium arsenite results in increased expression of AQP9 protein CTD PMID:19733843 Aqp9 Rat streptozocin increases expression EXP 6480464 Streptozocin results in increased expression of AQP9 protein CTD PMID:22114114 Aqp9 Rat styrene increases expression EXP 6480464 Styrene results in increased expression of AQP9 mRNA CTD PMID:17654243 Aqp9 Rat tamoxifen multiple interactions ISO Aqp9 (Mus musculus) 6480464 Tamoxifen inhibits the reaction [ESR1 protein mutant form results in decreased expression of AQP9 mRNA] and Tamoxifen inhibits the reaction [ESR1 protein mutant form results in decreased expression of AQP9 protein] CTD PMID:23213263 Aqp9 Rat tamoxifen decreases expression ISO Aqp9 (Mus musculus) 6480464 Tamoxifen results in decreased expression of AQP9 mRNA CTD PMID:23213263 Aqp9 Rat Tanshinone I multiple interactions ISO Aqp9 (Mus musculus) 6480464 [[tetraarsenic tetrasulfide co-treated with tanshinone co-treated with indirubin] results in increased expression of AQP9 protein] which results in increased uptake of tetraarsenic tetrasulfide more ... CTD PMID:18344322 Aqp9 Rat Tesaglitazar decreases expression EXP 6480464 tesaglitazar results in decreased expression of AQP9 mRNA CTD PMID:21515302 Aqp9 Rat testosterone decreases expression ISO Aqp9 (Mus musculus) 6480464 Testosterone results in decreased expression of AQP9 mRNA CTD PMID:21669218 Aqp9 Rat tetrachloromethane increases expression EXP 6480464 Carbon Tetrachloride results in increased expression of AQP9 mRNA CTD PMID:16644059 Aqp9 Rat tetrachloromethane multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of AQP9 mRNA] CTD PMID:31150632 Aqp9 Rat tetrachloromethane decreases expression EXP 6480464 Carbon Tetrachloride results in decreased expression of AQP9 mRNA CTD PMID:31150632 Aqp9 Rat thiourea increases uptake EXP 6480464 AQP9 protein results in increased uptake of Thiourea CTD PMID:9733774 Aqp9 Rat titanium dioxide decreases expression ISO Aqp9 (Mus musculus) 6480464 titanium dioxide results in decreased expression of AQP9 mRNA CTD PMID:29264374 Aqp9 Rat titanium dioxide multiple interactions ISO Aqp9 (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of AQP9 mRNA CTD PMID:29950665 Aqp9 Rat topotecan multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in increased expression of AQP9 mRNA CTD PMID:25729387 Aqp9 Rat triphenyl phosphate affects expression EXP 6480464 triphenyl phosphate affects the expression of AQP9 mRNA CTD PMID:30589522 Aqp9 Rat triphenyl phosphate affects expression ISO AQP9 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of AQP9 mRNA CTD PMID:37042841 Aqp9 Rat triptonide increases expression ISO Aqp9 (Mus musculus) 6480464 triptonide results in increased expression of AQP9 mRNA CTD PMID:33045310 Aqp9 Rat troglitazone increases expression EXP 6480464 troglitazone results in increased expression of AQP9 mRNA CTD PMID:21515302 Aqp9 Rat troglitazone decreases expression ISO AQP9 (Homo sapiens) 6480464 troglitazone results in decreased expression of AQP9 mRNA CTD PMID:25572481 Aqp9 Rat trovafloxacin decreases expression ISO Aqp9 (Mus musculus) 6480464 trovafloxacin results in decreased expression of AQP9 mRNA CTD PMID:35537566 Aqp9 Rat Tungsten carbide multiple interactions ISO AQP9 (Homo sapiens) 6480464 [tungsten carbide co-treated with Cobalt] results in decreased expression of AQP9 mRNA CTD PMID:18078969 Aqp9 Rat undecane decreases expression EXP 6480464 undecane results in decreased expression of AQP9 protein CTD PMID:17337753 Aqp9 Rat urea increases transport EXP 6480464 AQP9 protein results in increased transport of Urea CTD PMID:10205677 and PMID:29566083 Aqp9 Rat urea increases transport ISO AQP9 (Homo sapiens) 6480464 AQP9 protein results in increased transport of Urea CTD PMID:9514918 Aqp9 Rat valdecoxib decreases expression EXP 6480464 valdecoxib results in decreased expression of AQP9 mRNA CTD PMID:24136188 Aqp9 Rat valproic acid affects expression ISO Aqp9 (Mus musculus) 6480464 Valproic Acid affects the expression of AQP9 mRNA CTD PMID:17963808 Aqp9 Rat vinclozolin affects expression EXP 6480464 vinclozolin affects the expression of AQP9 mRNA CTD PMID:19015723 Aqp9 Rat vincristine increases expression ISO AQP9 (Homo sapiens) 6480464 Vincristine results in increased expression of AQP9 mRNA CTD PMID:23649840 Aqp9 Rat vitamin D increases expression ISO AQP9 (Homo sapiens) 6480464 Vitamin D results in increased expression of AQP9 protein CTD PMID:15336539 Aqp9 Rat water multiple interactions EXP 6480464 CFTR protein promotes the reaction [AQP9 protein affects the transport of Water] more ... CTD PMID:10205677 more ... Aqp9 Rat water multiple interactions ISO AQP9 (Homo sapiens) 6480464 Mercuric Chloride inhibits the reaction [AQP9 protein results in increased transport of Water] CTD PMID:9514918 Aqp9 Rat water increases transport ISO AQP9 (Homo sapiens) 6480464 AQP9 protein results in increased transport of Water CTD PMID:9514918 Aqp9 Rat water increases transport EXP 6480464 AQP9 protein results in increased transport of Water CTD PMID:10205677 more ... Aqp9 Rat water affects transport EXP 6480464 AQP9 protein affects the transport of Water CTD PMID:12606488 Aqp9 Rat zidovudine multiple interactions ISO AQP9 (Homo sapiens) 6480464 [Zidovudine co-treated with IFNA1 protein] results in increased expression of AQP9 mRNA CTD PMID:20370541 Aqp9 Rat zidovudine multiple interactions ISO Aqp9 (Mus musculus) 6480464 [Zidovudine co-treated with Lamivudine] results in increased expression of AQP9 mRNA CTD PMID:18313992 Aqp9 Rat zinc dichloride decreases expression ISO Aqp9 (Mus musculus) 6480464 zinc chloride results in decreased expression of AQP9 mRNA CTD PMID:37797845
Imported Annotations - KEGG (archival)
(+)-schisandrin B (EXP) (-)-demecolcine (ISO) (1->4)-beta-D-glucan (ISO) 17alpha-ethynylestradiol (EXP) 17beta-estradiol (EXP,ISO) 17beta-hydroxy-5alpha-androstan-3-one (EXP,ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3,4,7,8-Pentachlorodibenzofuran (EXP) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,3,7,8-Tetrachlorodibenzofuran (EXP) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO) 2-hydroxypropanoic acid (EXP,ISO) 3-hydroxybutyric acid (EXP) 4,4'-diaminodiphenylmethane (ISO) 4,4'-sulfonyldiphenol (ISO) 4-hydroxyphenyl retinamide (ISO) 5-azacytidine (ISO) 5-fluorouracil (EXP) 6-propyl-2-thiouracil (EXP) 7,9-dihydro-1H-purine-2,6,8(3H)-trione (ISO) acetamide (EXP) adenine (EXP) aflatoxin B1 (ISO) all-trans-retinoic acid (ISO) ammonium chloride (EXP) amphetamine (EXP) androstane-3,17-diol (EXP) antimony(0) (ISO) antirheumatic drug (ISO) arsane (ISO) arsenic atom (ISO) arsenite(3-) (ISO) arsenous acid (ISO) astragaloside IV (ISO) atrazine (EXP) Azoxymethane (ISO) benzo[a]pyrene (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP) buta-1,3-diene (ISO) calcitriol (ISO) cannabidiol (ISO) carbon nanotube (ISO) carbonyl cyanide p-trifluoromethoxyphenylhydrazone (ISO) CGP 52608 (ISO) cholesterol (ISO) choline (ISO) cobalt atom (ISO) copper(II) chloride (ISO) curcumin (ISO) cycloastragenol (ISO) cyclosporin A (ISO) D-glucitol (EXP,ISO) D-mannitol (EXP) dextran sulfate (ISO) diarsenic trioxide (ISO) Dibutyl phosphate (ISO) dibutyl phthalate (EXP) diclofenac (ISO) dieldrin (EXP) dioxygen (EXP) diprotium oxide (EXP,ISO) endosulfan (ISO) fenofibrate (ISO) fenthion (ISO) fipronil (EXP) folic acid (ISO) formaldehyde (ISO) genistein (EXP) glycerol (EXP,ISO) heptachlor (EXP) homovanillic acid (ISO) indirubin (ISO) indirubin-3'-monoxime (ISO) isoflavones (EXP) L-methionine (ISO) lamivudine (ISO) lipopolysaccharide (ISO) lonidamine (EXP) LY294002 (ISO) malathion (ISO) mercury atom (EXP) mercury dichloride (EXP,ISO) mercury(0) (EXP) mirex (EXP) N-methyl-4-phenylpyridinium (EXP,ISO) N-nitrosodiethylamine (EXP) nickel sulfate (ISO) nigericin (ISO) nitrofen (EXP) O-methyleugenol (ISO) orphenadrine (EXP) oxaliplatin (EXP) ozone (EXP,ISO) paracetamol (ISO) perfluorononanoic acid (ISO) perfluorooctane-1-sulfonic acid (EXP,ISO) perfluorooctanoic acid (EXP,ISO) phenformin (EXP) phloretin (EXP,ISO) piperonyl butoxide (EXP) pirinixic acid (EXP,ISO) potassium dichromate (ISO) pregnenolone 16alpha-carbonitrile (EXP) quercetin (EXP) rac-lactic acid (EXP,ISO) S-(1,2-dichlorovinyl)-L-cysteine (ISO) selenic acid (ISO) selenous acid (ISO) serpentine asbestos (ISO) sodium arsenate (ISO) sodium arsenite (ISO) streptozocin (EXP) styrene (EXP) tamoxifen (ISO) Tanshinone I (ISO) Tesaglitazar (EXP) testosterone (ISO) tetrachloromethane (EXP) thiourea (EXP) titanium dioxide (ISO) topotecan (EXP) triphenyl phosphate (EXP,ISO) triptonide (ISO) troglitazone (EXP,ISO) trovafloxacin (ISO) Tungsten carbide (ISO) undecane (EXP) urea (EXP,ISO) valdecoxib (EXP) valproic acid (ISO) vinclozolin (EXP) vincristine (ISO) vitamin D (ISO) water (EXP,ISO) zidovudine (ISO) zinc dichloride (ISO)
1.
Expression and regulation of aquaporins 1, 8, and 9 in the testis, efferent ducts, and epididymis of adult rats and during postnatal development.
Badran HH and Hermo LS, J Androl 2002 May-Jun;23(3):358-73.
2.
Changes in ocular aquaporin expression following optic nerve crush.
Dibas A, etal., Mol Vis. 2010 Mar 3;16:330-40.
3.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
4.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
5.
Expression and localization of aquaporin water channels in rat hepatocytes. Evidence for a role in canalicular bile secretion.
Huebert RC, etal., J Biol Chem 2002 Jun 21;277(25):22710-7.
6.
Aquaporin-9 is expressed in rat Sertoli cells and interacts with the cystic fibrosis transmembrane conductance regulator.
Jesus TT, etal., IUBMB Life. 2014 Sep;66(9):639-44. doi: 10.1002/iub.1312. Epub 2014 Oct 1.
7.
Cloning and functional expression of rAOP9L a new member of aquaporin family from rat liver.
Ko SB, etal., Biochem Mol Biol Int. 1999 Feb;47(2):309-18. doi: 10.1080/15216549900201333.
8.
Aquaporins in the kidney.
Kwon TH, etal., Handb Exp Pharmacol. 2009;(190):95-132. doi: 10.1007/978-3-540-79885-9_5.
9.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
10.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
11.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
12.
Expression of aquaporin 9 in the adult rat epididymal epithelium is modulated by androgens.
Pastor-Soler N, etal., Biol Reprod 2002 Jun;66(6):1716-22.
13.
At low doses ethanol maintains blood-brain barrier (BBB) integrity after hypoxia and reoxygenation: a brain slice study.
Peng C, etal., Neurol Res. 2013 Oct;35(8):790-7. doi: 10.1179/1743132813Y.0000000198. Epub 2013 Apr 12.
14.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
15.
GOA pipeline
RGD automated data pipeline
16.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
17.
Tentative Sequence Identification Numbers
Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
18.
Molecular characterization of a broad selectivity neutral solute channel.
Tsukaguchi H, etal., J Biol Chem 1998 Sep 18;273(38):24737-43.
19.
LncRNA MALAT1 promotes neuropathic pain progression through the miR‑154‑5p/AQP9 axis in CCI rat models.
Wu J, etal., Mol Med Rep. 2020 Jan;21(1):291-303. doi: 10.3892/mmr.2019.10829. Epub 2019 Nov 20.
Aqp9 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 8 80,678,027 - 80,718,273 (-) NCBI GRCr8 mRatBN7.2 8 71,797,231 - 71,837,485 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 8 71,797,234 - 71,837,395 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 8 77,331,526 - 77,371,805 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 8 75,604,495 - 75,644,778 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 8 73,441,536 - 73,481,821 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 8 77,559,621 - 77,599,781 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 8 77,559,624 - 77,599,781 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 8 75,483,006 - 75,523,423 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 8 75,611,485 - 75,651,646 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 8 75,630,541 - 75,670,700 (-) NCBI Celera 8 69,899,442 - 69,939,523 (+) NCBI Celera Cytogenetic Map 8 q24 NCBI
AQP9 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 15 58,138,169 - 58,185,911 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 15 58,138,169 - 58,185,911 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 15 58,430,368 - 58,478,110 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 15 56,217,700 - 56,265,402 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 15 56,217,770 - 56,265,401 NCBI Celera 15 35,319,964 - 35,368,212 (+) NCBI Celera Cytogenetic Map 15 q21.3 NCBI HuRef 15 35,253,376 - 35,301,102 (+) NCBI HuRef CHM1_1 15 58,548,384 - 58,596,089 (+) NCBI CHM1_1 T2T-CHM13v2.0 15 55,940,466 - 55,988,212 (+) NCBI T2T-CHM13v2.0
Aqp9 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 9 71,017,941 - 71,075,170 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 9 71,017,941 - 71,075,964 (-) Ensembl GRCm39 Ensembl GRCm38 9 71,110,659 - 71,167,849 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 9 71,110,659 - 71,168,682 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 9 70,958,468 - 71,011,096 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 9 70,909,221 - 70,961,849 (-) NCBI MGSCv36 mm8 Celera 9 68,318,271 - 68,366,608 (-) NCBI Celera Cytogenetic Map 9 D NCBI cM Map 9 39.85 NCBI
Aqp9 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955450 16,253,571 - 16,302,657 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955450 16,253,706 - 16,346,602 (-) NCBI ChiLan1.0 ChiLan1.0
AQP9 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 16 47,401,033 - 47,449,700 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 15 51,583,319 - 51,631,999 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 15 37,107,061 - 37,154,887 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 15 55,418,767 - 55,466,541 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 15 55,418,767 - 55,466,541 (+) Ensembl panpan1.1 panPan2
AQP9 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 30 23,223,413 - 23,271,893 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 30 23,225,331 - 23,269,076 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 30 23,195,554 - 23,244,048 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 30 23,381,591 - 23,430,109 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 30 23,383,410 - 23,429,056 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 30 23,314,125 - 23,361,613 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 30 23,398,650 - 23,446,048 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 30 23,540,476 - 23,589,012 (+) NCBI UU_Cfam_GSD_1.0
Aqp9 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024408640 101,473,023 - 101,514,878 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936471 19,321,426 - 19,362,146 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936471 19,321,366 - 19,361,227 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
AQP9 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 1 113,794,040 - 113,848,683 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 1 113,798,380 - 113,848,452 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 1 125,897,935 - 125,959,201 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
AQP9 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 26 25,326,108 - 25,374,743 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 26 25,326,087 - 25,373,336 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666048 115,941,107 - 115,988,513 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Aqp9
.
Predicted Target Of
Count of predictions: 200 Count of miRNA genes: 145 Interacting mature miRNAs: 158 Transcripts: ENSRNOT00000021442 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1298065 Scl16 Serum cholesterol level QTL 16 3.8 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 8 30856404 75856404 Rat 1554321 Bmd3 Bone mineral density QTL 3 7.9 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 8 40952565 123900184 Rat 1578769 Uae31 Urinary albumin excretion QTL 31 3.3 0.001 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 8 30848154 101699754 Rat 1298079 Activ2 Activity QTL 2 9.5 0.000001 voluntary movement trait (VT:0003491) rearing measurement (CMO:0001515) 8 41866876 86866876 Rat 70161 Bp62 Blood pressure QTL 62 2.9 0.001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 8 42692684 90165460 Rat 1578765 Klgr1 Kidney lesion grade QTL 1 3.3 0.0001 kidney morphology trait (VT:0002135) organ lesion measurement (CMO:0000677) 8 30848154 101699754 Rat 1582222 Epfw2 Epididymal fat weight QTL 2 3.2 0.0005 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 8 31737729 76737729 Rat 61464 Niddm11 Non-insulin dependent diabetes mellitus QTL 11 3.1 0.001 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 8 35582032 80582032 Rat 4889938 Bss89 Bone structure and strength QTL 89 3.8 tibia size trait (VT:0100001) tibia cortical bone volume (CMO:0001725) 8 50095249 82460899 Rat 1578755 Pur5 Proteinuria QTL 5 3.3 0.0001 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 8 30848154 101699754 Rat 1300146 Rf17 Renal function QTL 17 2.9 renal blood flow trait (VT:2000006) absolute change in renal blood flow rate (CMO:0001168) 8 28242912 73242912 Rat 8662823 Vetf5 Vascular elastic tissue fragility QTL 5 1.9 artery integrity trait (VT:0010639) patent ductus arteriosus score (CMO:0002566) 8 28242912 99525068 Rat 2313088 Bss75 Bone structure and strength QTL 75 3.1 0.0001 body length (VT:0001256) body length, nose to rump (CMO:0000079) 8 30848154 82460899 Rat 631210 Bw3 Body weight QTL3 5.9 mesenteric fat pad mass (VT:0010427) mesenteric fat pad weight to body weight ratio (CMO:0000654) 8 69349194 112783834 Rat 1358896 Bp262 Blood pressure QTL 262 2.89 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 8 27205715 99103503 Rat 731182 Uae24 Urinary albumin excretion QTL 24 6.4 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 8 19331152 93965294 Rat 737824 Hcar10 Hepatocarcinoma resistance QTL 10 2.9 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 8 40713066 82925667 Rat 1331769 Rf39 Renal function QTL 39 3.871 urine output (VT:0003620) timed urine volume (CMO:0000260) 8 41866876 75097878 Rat 61358 Bp39 Blood pressure QTL 39 2 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 8 35551938 80551938 Rat 1358906 Bp253 Blood pressure QTL 253 4 0.0004 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 8 40713066 93965294 Rat 1358907 Cm40 Cardiac mass QTL 40 1.89 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 8 27205715 99103503 Rat 70197 BpQTLcluster8 Blood pressure QTL cluster 8 3.482 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 8 46531639 119088626 Rat 2316950 Scl66 Serum cholesterol level QTL 66 4.1 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 8 30848259 105647037 Rat 1582254 Kidm31 Kidney mass QTL 31 3 kidney mass (VT:0002707) both kidneys wet weight (CMO:0000085) 8 54237644 85365202 Rat 10402857 Bp380 Blood pressure QTL 380 0.95 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 8 53968765 98968765 Rat 1358892 Kidm26 Kidney mass QTL 26 3.69 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 8 27205715 99103503 Rat 5684973 Bss100 Bone structure and strength QTL 100 4.7 tibia area (VT:1000281) tibia area measurement (CMO:0001382) 8 50095249 82460899 Rat 1582243 Bw66 Body weight QTL 66 3.4 0.0048 body mass (VT:0001259) body weight (CMO:0000012) 8 54237644 85365202 Rat 2313057 Bss76 Bone structure and strength QTL 76 3 0.0001 tibia size trait (VT:0100001) tibia midshaft cross-sectional area (CMO:0001717) 8 30848154 82460899 Rat 12879878 Bw183 Body weight QTL 183 0.001 body mass (VT:0001259) body weight (CMO:0000012) 8 43296169 98968765 Rat 1300177 Cm2 Cardiac mass QTL 2 3.65 heart mass (VT:0007028) heart weight (CMO:0000017) 8 54259986 100382532 Rat 1549908 Neudeg1 Neurodegradation QTL 1 5.5 0 nervous system integrity trait (VT:0010566) logarithm of the ratio of the lesioned side motor neuron count to contralateral side motor neuron count (CMO:0001986) 8 30188867 94457446 Rat 12879879 Cm99 Cardiac mass QTL 99 0.001 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 8 43296169 98968765 Rat 2313067 Bss77 Bone structure and strength QTL 77 3.1 0.0001 tibia size trait (VT:0100001) tibia midshaft endosteal cross-sectional area (CMO:0001716) 8 30848154 82460899 Rat 12879880 Cm100 Cardiac mass QTL 100 0.001 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 8 43296169 98968765 Rat 12879881 Cm101 Cardiac mass QTL 101 0.001 heart right ventricle mass (VT:0007033) heart right ventricle weight to body weight ratio (CMO:0000914) 8 43296169 98968765 Rat 12879882 Am8 Aortic mass QTL 8 0.001 aorta mass (VT:0002845) aorta weight to aorta length to body weight ratio (CMO:0002722) 8 43296169 98968765 Rat 12879883 Kidm65 Kidney mass QTL 65 0.001 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 8 43296169 98968765 Rat 1358912 Bw51 Body weight QTL 51 2.95 body mass (VT:0001259) body weight (CMO:0000012) 8 51351728 107062046 Rat 1300171 Bp184 Blood pressure QTL 184 3.66 arterial blood pressure trait (VT:2000000) blood pressure time series experimental set point of the baroreceptor response (CMO:0002593) 8 70513503 118219066 Rat 2313086 Bss60 Bone structure and strength QTL 60 4.1 0.0001 tibia length (VT:0004357) tibia length (CMO:0000450) 8 50095249 82460899 Rat 2303171 Bp331 Blood pressure QTL 331 5.57 0.005 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 8 61290298 119084929 Rat 2293697 Bmd39 Bone mineral density QTL 39 femur strength trait (VT:0010010) femur total energy absorbed before break (CMO:0001677) 8 54043744 98968765 Rat 1331837 Bw23 Body weight QTL 23 4.19 0.00007 body mass (VT:0001259) body weight (CMO:0000012) 8 46531722 99083736 Rat 1331838 Niddm61 Non-insulin dependent diabetes mellitus QTL 61 3.53 0.0004 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 8 36469535 99083736 Rat 631650 Stl6 Serum triglyceride level QTL 6 4 0.0019 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 8 10378157 112202585 Rat 631653 Bp125 Blood pressure QTL 125 3.3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 8 66142385 111142385 Rat 1581557 Eae16 Experimental allergic encephalomyelitis QTL 16 3.8 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046) 8 8462195 110921472 Rat 631271 Lecl1 Lens clarity QTL 1 0.001 lens clarity trait (VT:0001304) age of onset/diagnosis of cataract (CMO:0001584) 8 18984168 84531599 Rat 2303570 Gluco48 Glucose level QTL 48 2 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 8 49805831 94805831 Rat 2313046 Bss78 Bone structure and strength QTL 78 3.5 0.0001 tibia strength trait (VT:1000284) tibia total energy absorbed before break (CMO:0001736) 8 30848154 82460899 Rat 2301402 Bp316 Blood pressure QTL 316 0.005 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 8 53968765 98968765 Rat 631664 Hcar3 Hepatocarcinoma resistance QTL 3 2.9 0.0005 liver integrity trait (VT:0010547) volume of individual liver tumorous lesion (CMO:0001078) 8 54237644 99103503 Rat
RH141275
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 8 71,797,376 - 71,797,582 (+) MAPPER mRatBN7.2 Rnor_6.0 8 77,559,767 - 77,559,972 NCBI Rnor6.0 Rnor_5.0 8 75,523,072 - 75,523,277 UniSTS Rnor5.0 RGSC_v3.4 8 75,611,631 - 75,611,836 UniSTS RGSC3.4 Celera 8 69,939,172 - 69,939,377 UniSTS Cytogenetic Map 8 q24 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
8
22
79
88
90
59
25
59
6
183
64
61
44
59
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000087980 ⟹ ENSRNOP00000069377
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 8 71,797,234 - 71,837,395 (-) Ensembl Rnor_6.0 Ensembl 8 77,559,624 - 77,599,781 (-) Ensembl
RefSeq Acc Id:
NM_022960 ⟹ NP_075249
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 80,678,027 - 80,718,188 (-) NCBI mRatBN7.2 8 71,797,231 - 71,837,395 (-) NCBI Rnor_6.0 8 77,559,621 - 77,599,781 (-) NCBI Rnor_5.0 8 75,483,006 - 75,523,423 (+) NCBI RGSC_v3.4 8 75,611,485 - 75,651,646 (-) RGD Celera 8 69,899,442 - 69,939,523 (+) RGD
Sequence:
CTTAGGAAGTCCCCACAGTTGCCTGGGGAAGTCAATACAATTATATGAGTTTCCCTCATATCATCCAGCTGTCTGAGGAGAGAAGACTTGAGGAAAAACCCATGGCCAAGCGTACCCAGAGTTGGGCT
hide sequence
RefSeq Acc Id:
XM_006243362 ⟹ XP_006243424
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 80,678,027 - 80,718,273 (-) NCBI mRatBN7.2 8 71,797,231 - 71,837,485 (-) NCBI Rnor_6.0 8 77,559,621 - 77,598,767 (-) NCBI Rnor_5.0 8 75,483,006 - 75,523,423 (+) NCBI
Sequence:
TATGAGTTTCCCTCATATCATCCAGCTGTCTGAGGAGAGAAGACTTGAGGAAAAACCCATGGCCAAGCGTACCCAGAGTTGGGCTTGGGTATCAAGGGTATAGACAAGAGCCAGCAGCTTGGGTGTTT
hide sequence
RefSeq Acc Id:
XM_039082095 ⟹ XP_038938023
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 80,678,027 - 80,718,273 (-) NCBI mRatBN7.2 8 71,797,231 - 71,837,485 (-) NCBI
RefSeq Acc Id:
XM_039082096 ⟹ XP_038938024
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 80,678,027 - 80,718,254 (-) NCBI mRatBN7.2 8 71,797,231 - 71,836,728 (-) NCBI
RefSeq Acc Id:
XM_039082097 ⟹ XP_038938025
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 80,678,027 - 80,718,273 (-) NCBI mRatBN7.2 8 71,797,231 - 71,837,485 (-) NCBI
RefSeq Acc Id:
XM_039082099 ⟹ XP_038938027
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 80,678,027 - 80,718,273 (-) NCBI mRatBN7.2 8 71,797,231 - 71,837,485 (-) NCBI
RefSeq Acc Id:
XM_039082100 ⟹ XP_038938028
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 80,678,027 - 80,717,749 (-) NCBI mRatBN7.2 8 71,797,231 - 71,836,728 (-) NCBI
RefSeq Acc Id:
XM_063266081 ⟹ XP_063122151
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 80,678,027 - 80,714,765 (-) NCBI
RefSeq Acc Id:
XM_063266082 ⟹ XP_063122152
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 80,678,027 - 80,717,749 (-) NCBI
RefSeq Acc Id:
XM_063266083 ⟹ XP_063122153
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 80,678,027 - 80,717,749 (-) NCBI
RefSeq Acc Id:
XM_063266084 ⟹ XP_063122154
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 80,678,027 - 80,718,273 (-) NCBI
RefSeq Acc Id:
XM_063266085 ⟹ XP_063122155
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 80,678,027 - 80,714,765 (-) NCBI
RefSeq Acc Id:
XM_063266086 ⟹ XP_063122156
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 80,678,027 - 80,714,770 (-) NCBI
RefSeq Acc Id:
NP_075249 ⟸ NM_022960
- UniProtKB:
O88815 (UniProtKB/Swiss-Prot), P56627 (UniProtKB/Swiss-Prot), A6KER7 (UniProtKB/TrEMBL), A6KER9 (UniProtKB/TrEMBL)
- Sequence:
MPSEKDGAKKSLMQRLALKSRIAKETLSEFLGTFIMIVLGCSSIAQAVLSRERFGGIITINIGFASAVVMALYVTFGISGGHINPAVSFAMCAFGRMEWFKFPFYVGAQFLGAFVGAATVFGIYYDGL
hide sequence
RefSeq Acc Id:
XP_006243424 ⟸ XM_006243362
- Peptide Label:
isoform X1
- UniProtKB:
O88815 (UniProtKB/Swiss-Prot), P56627 (UniProtKB/Swiss-Prot), A6KER7 (UniProtKB/TrEMBL), A6KER9 (UniProtKB/TrEMBL)
- Sequence:
MPSEKDGAKKSLMQRLALKSRIAKETLSEFLGTFIMIVLGCSSIAQAVLSRERFGGIITINIGF
hide sequence
Ensembl Acc Id:
ENSRNOP00000069377 ⟸ ENSRNOT00000087980
RefSeq Acc Id:
XP_038938025 ⟸ XM_039082097
- Peptide Label:
isoform X1
- UniProtKB:
P56627 (UniProtKB/Swiss-Prot), O88815 (UniProtKB/Swiss-Prot), A6KER7 (UniProtKB/TrEMBL), A6KER9 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038938023 ⟸ XM_039082095
- Peptide Label:
isoform X1
- UniProtKB:
P56627 (UniProtKB/Swiss-Prot), O88815 (UniProtKB/Swiss-Prot), A6KER7 (UniProtKB/TrEMBL), A6KER9 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038938027 ⟸ XM_039082099
- Peptide Label:
isoform X1
- UniProtKB:
P56627 (UniProtKB/Swiss-Prot), O88815 (UniProtKB/Swiss-Prot), A6KER7 (UniProtKB/TrEMBL), A6KER9 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038938028 ⟸ XM_039082100
- Peptide Label:
isoform X1
- UniProtKB:
P56627 (UniProtKB/Swiss-Prot), O88815 (UniProtKB/Swiss-Prot), A6KER7 (UniProtKB/TrEMBL), A6KER9 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038938024 ⟸ XM_039082096
- Peptide Label:
isoform X1
- UniProtKB:
P56627 (UniProtKB/Swiss-Prot), O88815 (UniProtKB/Swiss-Prot), A6KER7 (UniProtKB/TrEMBL), A6KER9 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063122154 ⟸ XM_063266084
- Peptide Label:
isoform X1
- UniProtKB:
P56627 (UniProtKB/Swiss-Prot), O88815 (UniProtKB/Swiss-Prot), A6KER7 (UniProtKB/TrEMBL), A6KER9 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063122152 ⟸ XM_063266082
- Peptide Label:
isoform X1
- UniProtKB:
P56627 (UniProtKB/Swiss-Prot), O88815 (UniProtKB/Swiss-Prot), A6KER7 (UniProtKB/TrEMBL), A6KER9 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063122153 ⟸ XM_063266083
- Peptide Label:
isoform X1
- UniProtKB:
P56627 (UniProtKB/Swiss-Prot), O88815 (UniProtKB/Swiss-Prot), A6KER7 (UniProtKB/TrEMBL), A6KER9 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063122156 ⟸ XM_063266086
- Peptide Label:
isoform X2
RefSeq Acc Id:
XP_063122151 ⟸ XM_063266081
- Peptide Label:
isoform X1
- UniProtKB:
P56627 (UniProtKB/Swiss-Prot), O88815 (UniProtKB/Swiss-Prot), A6KER7 (UniProtKB/TrEMBL), A6KER9 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063122155 ⟸ XM_063266085
- Peptide Label:
isoform X1
- UniProtKB:
P56627 (UniProtKB/Swiss-Prot), O88815 (UniProtKB/Swiss-Prot), A6KER7 (UniProtKB/TrEMBL), A6KER9 (UniProtKB/TrEMBL)
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2002-06-10
Aqp9
aquaporin 9
Name updated
70584 APPROVED
Note Type
Note
Reference
gene_cellular_localization
enriched in basolateral plasma membranes of hepatocytes
625402
gene_cellular_localization
localized to the apical membrane
727570
gene_expression
expressed in epididymal epithelium
727570
