Symbol:
Acaa1a
Name:
acetyl-CoA acyltransferase 1A
RGD ID:
67379
Description:
Enables acetyl-CoA C-acyltransferase activity; acetyl-CoA C-myristoyltransferase activity; and palmitoyl-CoA oxidase activity. Involved in several processes, including monocarboxylic acid metabolic process; response to nutrient; and response to steroid hormone. Located in peroxisome. Orthologous to human ACAA1 (acetyl-CoA acyltransferase 1); PARTICIPATES IN eicosanoid signaling pathway via peroxisome proliferator-activated receptor gamma; fatty acid metabolic pathway; unsaturated fatty acid biosynthetic pathway; INTERACTS WITH (+)-schisandrin B; 2,3,7,8-tetrachlorodibenzodioxine; 2,4,6-trinitrotoluene.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
3-ketoacyl-CoA thiolase A, peroxisomal; Acaa; Acaa1; acetyl-CoA acyltransferase 1; acetyl-CoA acyltransferase 3-oxo acyl-CoA thiolase A; Acetyl-CoA acyltransferase 3-oxo acyl-CoA thiolase A 1 peroxisomal; Acetyl-CoA acyltransferase 3-oxo acyl-CoA thiolase A peroxisomal; acetyl-CoA acyltransferase A; acetyl-CoA acyltransferase, 3-oxo acyl-CoA thiolase A; acetyl-CoA C-myristoyltransferase; acetyl-Coenzyme A acyltransferase 1; acetyl-Coenzyme A acyltransferase 1 (peroxisomal 3-oxoacyl-Coenzyme A thiolase); acetyl-Coenzyme A acyltransferase 1A; beta-ketothiolase A; MGC108766; peroxisomal 3-oxoacyl-CoA thiolase A; Pktaa; thiolase A
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Is Marker For:
QTLs:
BpQTLcluster8
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 8 127,956,126 - 127,966,348 (+) NCBI GRCr8 mRatBN7.2 8 119,079,401 - 119,088,626 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 8 119,079,775 - 119,088,624 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 8 124,661,801 - 124,670,662 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 8 122,860,818 - 122,869,679 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 8 120,694,346 - 120,703,213 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 8 128,027,880 - 128,036,471 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 8 128,027,958 - 128,036,236 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 8 127,234,641 - 127,243,232 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 8 124,305,097 - 124,313,887 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 8 124,324,833 - 124,333,624 (+) NCBI Celera 8 118,231,008 - 118,239,798 (+) NCBI Celera Cytogenetic Map 8 q32 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Acaa1a Rat (+)-schisandrin B multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of ACAA1A mRNA] CTD PMID:31150632 Acaa1a Rat (1->4)-beta-D-glucan multiple interactions ISO Acaa1a (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of ACAA1A mRNA CTD PMID:36331819 Acaa1a Rat 1,2-dimethylhydrazine affects expression ISO Acaa1a (Mus musculus) 6480464 1 and 2-Dimethylhydrazine affects the expression of ACAA1A mRNA CTD PMID:22206623 Acaa1a Rat 1,2-dimethylhydrazine multiple interactions ISO Acaa1a (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in increased expression of ACAA1A mRNA CTD PMID:22206623 Acaa1a Rat 2,2',4,4',5,5'-hexachlorobiphenyl multiple interactions ISO Acaa1a (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with 2 more ... CTD PMID:28433925 Acaa1a Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of ACAA1 mRNA and Tetrachlorodibenzodioxin results in increased expression of ACAA1A mRNA CTD PMID:16054898 more ... Acaa1a Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Acaa1a (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with 2 more ... CTD PMID:28213091 and PMID:28433925 Acaa1a Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Acaa1a (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of ACAA1A mRNA CTD PMID:21570461 Acaa1a Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Acaa1a (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of ACAA1A mRNA CTD PMID:16960034 more ... Acaa1a Rat 2,4,6-trinitrotoluene affects expression EXP 6480464 Trinitrotoluene affects the expression of ACAA1 mRNA CTD PMID:21346803 Acaa1a Rat 2,6-dinitrotoluene affects expression EXP 6480464 2 and 6-dinitrotoluene affects the expression of ACAA1 mRNA CTD PMID:21346803 Acaa1a Rat 2-methyl-2-[4-(1,2,3,4-tetrahydronaphthalen-1-yl)phenoxy]propanoic acid multiple interactions EXP 6480464 [Nafenopin results in increased activity of PPARA protein] which results in increased expression of ACAA1 mRNA and [Nafenopin results in increased activity of PPARA protein] which results in increased expression of ACAA1 protein CTD PMID:15071170 Acaa1a Rat 3,3',4,4'-tetrachlorobiphenyl multiple interactions ISO Acaa1a (Mus musculus) 6480464 3 more ... CTD PMID:19467301 Acaa1a Rat 3-chloropropane-1,2-diol increases expression EXP 6480464 alpha-Chlorohydrin results in increased expression of ACAA1A mRNA CTD PMID:28522335 Acaa1a Rat 3H-1,2-dithiole-3-thione increases expression EXP 6480464 1 and 2-dithiol-3-thione results in increased expression of ACAA1 mRNA CTD PMID:19162173 Acaa1a Rat 4,4'-sulfonyldiphenol increases expression ISO Acaa1a (Mus musculus) 6480464 bisphenol S results in increased expression of ACAA1A mRNA CTD PMID:39298647 Acaa1a Rat 4,4'-sulfonyldiphenol multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of ACAA1A mRNA CTD PMID:36041667 Acaa1a Rat 4-amino-2,6-dinitrotoluene affects expression EXP 6480464 4-amino-2 and 6-dinitrotoluene affects the expression of ACAA1 mRNA CTD PMID:21346803 Acaa1a Rat actinomycin D multiple interactions ISO ACAA1 (Homo sapiens) 6480464 [Dactinomycin co-treated with nutlin 3] results in increased secretion of ACAA1 protein CTD PMID:38460933 Acaa1a Rat aflatoxin B1 affects expression ISO ACAA1 (Homo sapiens) 6480464 Aflatoxin B1 affects the expression of ACAA1 protein CTD PMID:20106945 Acaa1a Rat aflatoxin B1 decreases expression ISO ACAA1 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased expression of ACAA1 mRNA CTD PMID:22100608 Acaa1a Rat all-trans-retinoic acid increases expression ISO ACAA1 (Homo sapiens) 6480464 Tretinoin results in increased expression of ACAA1 mRNA CTD PMID:33167477 Acaa1a Rat aristolochic acid A increases expression ISO ACAA1 (Homo sapiens) 6480464 aristolochic acid I results in increased expression of ACAA1 mRNA CTD PMID:33212167 Acaa1a Rat aspartame multiple interactions ISO Acaa1a (Mus musculus) 6480464 [Fats more ... CTD PMID:23783067 Acaa1a Rat Azoxymethane multiple interactions ISO Acaa1a (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in increased expression of ACAA1A mRNA CTD PMID:29950665 Acaa1a Rat benzo[a]pyrene increases expression ISO Acaa1a (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of ACAA1A mRNA CTD PMID:19770486 Acaa1a Rat benzo[a]pyrene decreases expression ISO ACAA1 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of ACAA1 mRNA CTD PMID:32234424 Acaa1a Rat benzo[a]pyrene increases methylation ISO ACAA1 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of ACAA1 promoter CTD PMID:27901495 Acaa1a Rat benzo[a]pyrene increases methylation ISO Acaa1a (Mus musculus) 6480464 Benzo(a)pyrene results in increased methylation of ACAA1A promoter CTD PMID:27901495 Acaa1a Rat beta-lapachone decreases expression ISO ACAA1 (Homo sapiens) 6480464 beta-lapachone results in decreased expression of ACAA1 mRNA CTD PMID:38218311 Acaa1a Rat bexarotene increases expression EXP 6480464 bexarotene results in increased expression of ACAA1 mRNA and bexarotene results in increased expression of ACAA1A mRNA CTD PMID:16648578 and PMID:17630414 Acaa1a Rat bexarotene multiple interactions EXP 6480464 [Tamoxifen co-treated with bexarotene] results in increased expression of ACAA1 mRNA CTD PMID:17630414 Acaa1a Rat bezafibrate multiple interactions ISO Acaa1a (Mus musculus) 6480464 PPARA protein affects the susceptibility to [Bezafibrate results in increased expression of ACAA1A mRNA] CTD PMID:19124612 Acaa1a Rat bezafibrate increases expression ISO Acaa1a (Mus musculus) 6480464 Bezafibrate results in increased expression of ACAA1A mRNA CTD PMID:19124612 Acaa1a Rat bis(2-ethylhexyl) phthalate multiple interactions ISO Acaa1a (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with 2 more ... CTD PMID:16332691 more ... Acaa1a Rat bis(2-ethylhexyl) phthalate decreases expression ISO Acaa1a (Mus musculus) 6480464 Diethylhexyl Phthalate results in decreased expression of ACAA1A mRNA CTD PMID:35550907 Acaa1a Rat bis(2-ethylhexyl) phthalate multiple interactions ISO ACAA1 (Homo sapiens) 6480464 [Diethylhexyl Phthalate results in increased abundance of mono-(2-ethylhexyl)phthalate] which results in increased methylation of ACAA1 gene CTD PMID:33872906 Acaa1a Rat bis(2-ethylhexyl) phthalate increases expression ISO ACAA1 (Homo sapiens) 6480464 Diethylhexyl Phthalate results in increased expression of ACAA1 mRNA CTD PMID:31163220 Acaa1a Rat bis(2-ethylhexyl) phthalate decreases expression ISO ACAA1 (Homo sapiens) 6480464 Diethylhexyl Phthalate results in decreased expression of ACAA1 protein CTD PMID:31163220 Acaa1a Rat bis(2-ethylhexyl) phthalate increases expression ISO Acaa1a (Mus musculus) 6480464 Diethylhexyl Phthalate results in increased expression of ACAA1A mRNA and Diethylhexyl Phthalate results in increased expression of ACAA1A protein CTD PMID:16332691 more ... Acaa1a Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of ACAA1 mRNA and bisphenol A results in increased expression of ACAA1A protein CTD PMID:25181051 and PMID:32145629 Acaa1a Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of ACAA1A mRNA CTD PMID:36041667 Acaa1a Rat bisphenol A decreases expression ISO ACAA1 (Homo sapiens) 6480464 bisphenol A results in decreased expression of ACAA1 protein CTD PMID:34186270 Acaa1a Rat bisphenol A increases expression ISO Acaa1a (Mus musculus) 6480464 bisphenol A results in increased expression of ACAA1A mRNA CTD PMID:33221593 Acaa1a Rat bisphenol A increases expression ISO ACAA1 (Homo sapiens) 6480464 bisphenol A results in increased expression of ACAA1 protein CTD PMID:37567409 Acaa1a Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of ACAA1A mRNA CTD PMID:32145629 Acaa1a Rat bisphenol A affects expression ISO ACAA1 (Homo sapiens) 6480464 bisphenol A affects the expression of ACAA1 mRNA CTD PMID:30903817 Acaa1a Rat bisphenol A multiple interactions ISO Acaa1a (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with 2 more ... CTD PMID:28433925 Acaa1a Rat bisphenol AF increases expression ISO ACAA1 (Homo sapiens) 6480464 bisphenol AF results in increased expression of ACAA1 protein CTD PMID:34186270 Acaa1a Rat Bisphenol B increases expression ISO ACAA1 (Homo sapiens) 6480464 bisphenol B results in increased expression of ACAA1 protein CTD PMID:34186270 Acaa1a Rat bisphenol F multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of ACAA1A mRNA CTD PMID:36041667 Acaa1a Rat bisphenol F increases expression ISO ACAA1 (Homo sapiens) 6480464 bisphenol F results in increased expression of ACAA1 protein CTD PMID:34186270 Acaa1a Rat C60 fullerene decreases expression EXP 6480464 fullerene C60 results in decreased expression of ACAA1 mRNA CTD PMID:19167457 Acaa1a Rat cadmium atom increases expression EXP 6480464 Cadmium results in increased expression of ACAA1 mRNA CTD PMID:17327699 Acaa1a Rat cadmium atom multiple interactions ISO ACAA1 (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of ACAA1 mRNA CTD PMID:35301059 Acaa1a Rat cadmium dichloride increases expression EXP 6480464 Cadmium Chloride results in increased expression of ACAA1 mRNA CTD PMID:17327699 Acaa1a Rat cadmium dichloride multiple interactions ISO ACAA1 (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of ACAA1 mRNA CTD PMID:35301059 Acaa1a Rat capecitabine increases response to substance ISO ACAA1 (Homo sapiens) 6480464 ACAA1 protein results in increased susceptibility to Capecitabine CTD PMID:16734730 Acaa1a Rat captan increases expression ISO Acaa1a (Mus musculus) 6480464 Captan results in increased expression of ACAA1A mRNA CTD PMID:31558096 Acaa1a Rat carbon nanotube increases expression ISO Acaa1a (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25620056 Acaa1a Rat carbon nanotube decreases expression ISO Acaa1a (Mus musculus) 6480464 Nanotubes and Carbon results in decreased expression of ACAA1A mRNA CTD PMID:25554681 Acaa1a Rat chlorpyrifos increases expression ISO Acaa1a (Mus musculus) 6480464 Chlorpyrifos results in increased expression of ACAA1A mRNA CTD PMID:37019170 Acaa1a Rat ciglitazone multiple interactions ISO ACAA1 (Homo sapiens) 6480464 [ciglitazone binds to PPARG protein] which results in increased expression of ACAA1 mRNA CTD PMID:16197558 Acaa1a Rat ciprofibrate increases expression ISO Acaa1a (Mus musculus) 6480464 ciprofibrate results in increased expression of ACAA1A mRNA CTD PMID:12771043 Acaa1a Rat cisplatin increases expression ISO ACAA1 (Homo sapiens) 6480464 Cisplatin results in increased expression of ACAA1 mRNA CTD PMID:27594783 Acaa1a Rat cisplatin multiple interactions ISO ACAA1 (Homo sapiens) 6480464 [Cisplatin co-treated with jinfukang] results in increased expression of ACAA1 mRNA CTD PMID:27392435 Acaa1a Rat clobetasol increases expression ISO Acaa1a (Mus musculus) 6480464 Clobetasol results in increased expression of ACAA1A mRNA CTD PMID:27462272 Acaa1a Rat clofibrate multiple interactions ISO Acaa1a (Mus musculus) 6480464 [Clofibrate co-treated with Acetaminophen] affects the expression of ACAA1A mRNA and PPARA affects the reaction [[Clofibrate co-treated with Acetaminophen] affects the expression of ACAA1A mRNA] CTD PMID:17585979 Acaa1a Rat clofibrate increases expression ISO Acaa1a (Mus musculus) 6480464 Clofibrate results in increased expression of ACAA1A mRNA CTD PMID:17585979 more ... Acaa1a Rat clofibrate increases expression EXP 6480464 Clofibrate results in increased expression of ACAA1A mRNA CTD PMID:12851107 more ... Acaa1a Rat copper(II) sulfate decreases expression ISO ACAA1 (Homo sapiens) 6480464 Copper Sulfate results in decreased expression of ACAA1 mRNA CTD PMID:19549813 Acaa1a Rat coumarin increases expression EXP 6480464 coumarin results in increased expression of ACAA1 mRNA CTD PMID:18480146 Acaa1a Rat cyclosporin A decreases expression ISO ACAA1 (Homo sapiens) 6480464 Cyclosporine results in decreased expression of ACAA1 mRNA CTD PMID:20106945 and PMID:25562108 Acaa1a Rat cyclosporin A decreases methylation ISO ACAA1 (Homo sapiens) 6480464 Cyclosporine results in decreased methylation of ACAA1 promoter CTD PMID:27989131 Acaa1a Rat dextran sulfate multiple interactions ISO Acaa1a (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in increased expression of ACAA1A mRNA CTD PMID:29950665 Acaa1a Rat dibutyl phthalate increases expression EXP 6480464 Dibutyl Phthalate results in increased expression of ACAA1 mRNA CTD PMID:21266533 Acaa1a Rat dichloroacetic acid increases expression ISO Acaa1a (Mus musculus) 6480464 Dichloroacetic Acid results in increased expression of ACAA1A mRNA CTD PMID:28962523 Acaa1a Rat diisononyl phthalate increases expression ISO Acaa1a (Mus musculus) 6480464 diisononyl phthalate results in increased expression of ACAA1A mRNA CTD PMID:31546122 Acaa1a Rat diuron increases expression EXP 6480464 Diuron results in increased expression of ACAA1A mRNA CTD PMID:21551480 and PMID:25152437 Acaa1a Rat dorsomorphin multiple interactions ISO ACAA1 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of ACAA1 mRNA CTD PMID:27188386 Acaa1a Rat doxifluridine increases response to substance ISO ACAA1 (Homo sapiens) 6480464 ACAA1 protein results in increased susceptibility to doxifluridine CTD PMID:16734730 Acaa1a Rat doxorubicin decreases expression EXP 6480464 Doxorubicin results in decreased expression of ACAA1A mRNA CTD PMID:32289291 Acaa1a Rat epoxiconazole decreases expression ISO Acaa1a (Mus musculus) 6480464 epoxiconazole results in decreased expression of ACAA1A mRNA CTD PMID:35436446 Acaa1a Rat ethanol decreases expression EXP 6480464 Ethanol results in decreased expression of ACAA1A mRNA CTD PMID:26115886 Acaa1a Rat ethanol multiple interactions EXP 6480464 Scopoletin inhibits the reaction [Ethanol results in decreased expression of ACAA1A mRNA] and Silymarin inhibits the reaction [Ethanol results in decreased expression of ACAA1A mRNA] CTD PMID:26115886 Acaa1a Rat etomoxir increases expression EXP 6480464 etomoxir results in increased expression of ACAA1A mRNA CTD PMID:19234235 Acaa1a Rat farnesol multiple interactions ISO ACAA1 (Homo sapiens) 6480464 [Farnesol analog co-treated with Oleic Acid] results in increased expression of ACAA1 mRNA CTD PMID:30611723 Acaa1a Rat fenofibrate increases expression ISO Acaa1a (Mus musculus) 6480464 Fenofibrate results in increased expression of ACAA1A mRNA CTD PMID:11798191 Acaa1a Rat fenofibrate increases expression ISO ACAA1 (Homo sapiens) 6480464 Fenofibrate results in increased expression of ACAA1 mRNA CTD PMID:24752549 Acaa1a Rat fenofibrate increases expression EXP 6480464 Fenofibrate results in increased expression of ACAA1 mRNA and Fenofibrate results in increased expression of ACAA1A mRNA CTD PMID:27071702 and PMID:32741897 Acaa1a Rat fenofibrate multiple interactions EXP 6480464 Fenofibrate promotes the reaction [Pyrazinamide results in increased expression of ACAA1 mRNA] and Pyrazinamide promotes the reaction [Fenofibrate results in increased expression of ACAA1 mRNA] CTD PMID:27071702 Acaa1a Rat fenofibrate affects expression EXP 6480464 Fenofibrate affects the expression of ACAA1A mRNA CTD PMID:20801182 Acaa1a Rat finasteride increases expression EXP 6480464 Finasteride results in increased expression of ACAA1 mRNA CTD PMID:24136188 Acaa1a Rat flutamide increases expression EXP 6480464 Flutamide results in increased expression of ACAA1 mRNA CTD PMID:24136188 Acaa1a Rat folic acid multiple interactions ISO Acaa1a (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in increased expression of ACAA1A mRNA CTD PMID:22206623 Acaa1a Rat folpet increases expression ISO Acaa1a (Mus musculus) 6480464 folpet results in increased expression of ACAA1A mRNA CTD PMID:31558096 Acaa1a Rat furan decreases expression EXP 6480464 furan results in decreased expression of ACAA1 mRNA CTD PMID:15120968 Acaa1a Rat glafenine decreases expression EXP 6480464 Glafenine results in decreased expression of ACAA1 mRNA CTD PMID:24136188 Acaa1a Rat gold atom decreases expression ISO ACAA1 (Homo sapiens) 6480464 Gold analog results in decreased expression of ACAA1 mRNA CTD PMID:36057382 Acaa1a Rat gold(0) decreases expression ISO ACAA1 (Homo sapiens) 6480464 Gold analog results in decreased expression of ACAA1 mRNA CTD PMID:36057382 Acaa1a Rat GW 7647 increases expression ISO ACAA1 (Homo sapiens) 6480464 GW 7647 results in increased expression of ACAA1 mRNA CTD PMID:30611723 Acaa1a Rat GW 7647 multiple interactions ISO ACAA1 (Homo sapiens) 6480464 [GW 7647 co-treated with Oleic Acid] results in increased expression of ACAA1 mRNA CTD PMID:30611723 Acaa1a Rat hydralazine multiple interactions ISO ACAA1 (Homo sapiens) 6480464 [Hydralazine co-treated with Valproic Acid] results in increased expression of ACAA1 mRNA CTD PMID:17183730 Acaa1a Rat hydrogen peroxide multiple interactions ISO ACAA1 (Homo sapiens) 6480464 [Hydrogen Peroxide co-treated with Theophylline] results in decreased expression of ACAA1 protein CTD PMID:18951874 Acaa1a Rat isotretinoin decreases expression ISO ACAA1 (Homo sapiens) 6480464 Isotretinoin results in decreased expression of ACAA1 mRNA CTD PMID:20436886 Acaa1a Rat ivermectin decreases expression ISO ACAA1 (Homo sapiens) 6480464 Ivermectin results in decreased expression of ACAA1 protein CTD PMID:32959892 Acaa1a Rat ketoconazole increases expression EXP 6480464 Ketoconazole results in increased expression of ACAA1 mRNA CTD PMID:37077353 Acaa1a Rat leflunomide increases expression EXP 6480464 leflunomide results in increased expression of ACAA1 mRNA CTD PMID:24136188 Acaa1a Rat methapyrilene decreases expression EXP 6480464 Methapyrilene results in decreased expression of ACAA1 mRNA CTD PMID:15120968 Acaa1a Rat methotrexate decreases expression EXP 6480464 Methotrexate results in decreased expression of ACAA1 mRNA CTD PMID:15120968 Acaa1a Rat mono(2-ethylhexyl) phthalate multiple interactions ISO ACAA1 (Homo sapiens) 6480464 [Diethylhexyl Phthalate results in increased abundance of mono-(2-ethylhexyl)phthalate] which results in increased methylation of ACAA1 gene CTD PMID:33872906 Acaa1a Rat monosodium L-glutamate multiple interactions ISO Acaa1a (Mus musculus) 6480464 [Fats more ... CTD PMID:23783067 Acaa1a Rat Muraglitazar increases expression EXP 6480464 muraglitazar results in increased expression of ACAA1 mRNA CTD PMID:21515302 Acaa1a Rat N-methyl-4-phenylpyridinium increases expression ISO Acaa1a (Mus musculus) 6480464 1-Methyl-4-phenylpyridinium results in increased expression of ACAA1A mRNA CTD PMID:22776087 Acaa1a Rat nafenopin multiple interactions EXP 6480464 [Nafenopin results in increased activity of PPARA protein] which results in increased expression of ACAA1 mRNA and [Nafenopin results in increased activity of PPARA protein] which results in increased expression of ACAA1 protein CTD PMID:15071170 Acaa1a Rat nefazodone increases expression EXP 6480464 nefazodone results in increased expression of ACAA1 mRNA CTD PMID:24136188 Acaa1a Rat nimesulide increases expression EXP 6480464 nimesulide results in increased expression of ACAA1 mRNA CTD PMID:24136188 Acaa1a Rat Nutlin-3 multiple interactions ISO ACAA1 (Homo sapiens) 6480464 [Dactinomycin co-treated with nutlin 3] results in increased secretion of ACAA1 protein CTD PMID:38460933 Acaa1a Rat O-methyleugenol decreases expression ISO ACAA1 (Homo sapiens) 6480464 methyleugenol results in decreased expression of ACAA1 mRNA CTD PMID:32234424 Acaa1a Rat obeticholic acid increases expression ISO ACAA1 (Homo sapiens) 6480464 obeticholic acid results in increased expression of ACAA1 mRNA CTD PMID:27939613 Acaa1a Rat ochratoxin A decreases expression ISO ACAA1 (Homo sapiens) 6480464 ochratoxin A results in decreased expression of ACAA1 mRNA CTD PMID:19287073 Acaa1a Rat ochratoxin A decreases expression EXP 6480464 ochratoxin A results in decreased expression of ACAA1A mRNA CTD PMID:12700408 Acaa1a Rat oleic acid multiple interactions ISO ACAA1 (Homo sapiens) 6480464 [Farnesol analog co-treated with Oleic Acid] results in increased expression of ACAA1 mRNA and [GW 7647 co-treated with Oleic Acid] results in increased expression of ACAA1 mRNA CTD PMID:30611723 Acaa1a Rat paracetamol multiple interactions ISO Acaa1a (Mus musculus) 6480464 [Clofibrate co-treated with Acetaminophen] affects the expression of ACAA1A mRNA more ... CTD PMID:17585979 and PMID:29246445 Acaa1a Rat paracetamol decreases expression ISO Acaa1a (Mus musculus) 6480464 Acetaminophen results in decreased expression of ACAA1A mRNA CTD PMID:29246445 Acaa1a Rat paracetamol decreases expression ISO ACAA1 (Homo sapiens) 6480464 Acetaminophen results in decreased expression of ACAA1 mRNA CTD PMID:22230336 and PMID:29067470 Acaa1a Rat paracetamol affects expression ISO Acaa1a (Mus musculus) 6480464 Acetaminophen affects the expression of ACAA1A mRNA CTD PMID:15606129 and PMID:17562736 Acaa1a Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of ACAA1 mRNA CTD PMID:15084756 Acaa1a Rat perfluorohexanesulfonic acid increases expression ISO Acaa1a (Mus musculus) 6480464 perfluorohexanesulfonic acid results in increased expression of ACAA1A mRNA CTD PMID:21705711 Acaa1a Rat perfluorooctane-1-sulfonic acid multiple interactions EXP 6480464 [perfluorooctane sulfonic acid results in increased activity of PPARA protein] which results in increased expression of ACAA1A mRNA and [perfluorooctane sulfonic acid results in increased activity of PPARA protein] which results in increased expression of ACAA1A protein CTD PMID:15071170 Acaa1a Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Acaa1a (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of ACAA1A mRNA and [perfluorooctane sulfonic acid co-treated with Dietary Fats co-treated with Dietary Carbohydrates] results in increased expression of ACAA1A protein CTD PMID:32991729 and PMID:36331819 Acaa1a Rat perfluorooctane-1-sulfonic acid increases expression ISO Acaa1a (Mus musculus) 6480464 perfluorooctane sulfonic acid results in increased expression of ACAA1A mRNA CTD PMID:19429403 more ... Acaa1a Rat perfluorooctane-1-sulfonic acid increases expression EXP 6480464 perfluorooctane sulfonic acid results in increased expression of ACAA1 mRNA CTD PMID:16221955 more ... Acaa1a Rat perfluorooctanesulfonamide multiple interactions EXP 6480464 [perfluorooctanesulfonamide results in increased activity of PPARA protein] which results in increased expression of ACAA1A mRNA and [perfluorooctanesulfonamide results in increased activity of PPARA protein] which results in increased expression of ACAA1A protein CTD PMID:15071170 Acaa1a Rat perfluorooctanoic acid increases expression EXP 6480464 perfluorooctanoic acid results in increased expression of ACAA1 mRNA more ... CTD PMID:16221955 more ... Acaa1a Rat perfluorooctanoic acid increases expression ISO Acaa1a (Mus musculus) 6480464 perfluorooctanoic acid results in increased expression of ACAA1A mRNA and perfluorooctanoic acid results in increased expression of ACAA1A protein CTD PMID:17681415 more ... Acaa1a Rat perfluorooctanoic acid multiple interactions ISO Acaa1a (Mus musculus) 6480464 PPARA gene mutant form inhibits the reaction [perfluorooctanoic acid results in increased expression of ACAA1A mRNA] more ... CTD PMID:19751795 and PMID:20936131 Acaa1a Rat perfluorooctanoic acid multiple interactions ISO ACAA1 (Homo sapiens) 6480464 PPARA inhibits the reaction [perfluorooctanoic acid results in increased expression of ACAA1A mRNA] and PPARA inhibits the reaction [perfluorooctanoic acid results in increased expression of ACAA1A protein] CTD PMID:19751795 Acaa1a Rat permethrin increases expression ISO Acaa1a (Mus musculus) 6480464 Permethrin results in increased expression of ACAA1A mRNA CTD PMID:30629241 Acaa1a Rat phenobarbital affects expression ISO Acaa1a (Mus musculus) 6480464 Phenobarbital affects the expression of ACAA1A mRNA CTD PMID:23091169 Acaa1a Rat phenylmercury acetate increases expression ISO ACAA1 (Homo sapiens) 6480464 Phenylmercuric Acetate results in increased expression of ACAA1 mRNA CTD PMID:26272509 Acaa1a Rat phenylmercury acetate multiple interactions ISO ACAA1 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of ACAA1 mRNA CTD PMID:27188386 Acaa1a Rat PhIP decreases expression EXP 6480464 2-amino-1-methyl-6-phenylimidazo(4 and 5-b)pyridine results in decreased expression of ACAA1A mRNA CTD PMID:33945839 Acaa1a Rat pirinixic acid increases expression EXP 6480464 pirinixic acid results in increased expression of ACAA1 mRNA and pirinixic acid results in increased expression of ACAA1A mRNA CTD PMID:16940010 more ... Acaa1a Rat pirinixic acid increases expression ISO Acaa1a (Mus musculus) 6480464 pirinixic acid results in increased expression of ACAA1A mRNA CTD PMID:11798191 more ... Acaa1a Rat pyrazinecarboxamide multiple interactions EXP 6480464 Fenofibrate promotes the reaction [Pyrazinamide results in increased expression of ACAA1 mRNA] and Pyrazinamide promotes the reaction [Fenofibrate results in increased expression of ACAA1 mRNA] CTD PMID:27071702 Acaa1a Rat pyrazinecarboxamide increases expression EXP 6480464 Pyrazinamide results in increased expression of ACAA1 mRNA CTD PMID:22431067 and PMID:27071702 Acaa1a Rat resveratrol increases expression ISO Acaa1a (Mus musculus) 6480464 resveratrol results in increased expression of ACAA1A protein CTD PMID:25505154 Acaa1a Rat rotenone increases expression EXP 6480464 Rotenone results in increased expression of ACAA1A mRNA CTD PMID:28374803 Acaa1a Rat SB 431542 multiple interactions ISO ACAA1 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of ACAA1 mRNA CTD PMID:27188386 Acaa1a Rat scopoletin multiple interactions EXP 6480464 Scopoletin inhibits the reaction [Ethanol results in decreased expression of ACAA1A mRNA] CTD PMID:26115886 Acaa1a Rat senecionine increases expression ISO Acaa1a (Mus musculus) 6480464 senecionine results in increased expression of ACAA1A protein CTD PMID:35357534 Acaa1a Rat sodium arsenite decreases expression ISO ACAA1 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of ACAA1 mRNA CTD PMID:29301061 Acaa1a Rat sodium dichromate increases expression ISO Acaa1a (Mus musculus) 6480464 sodium bichromate results in increased expression of ACAA1A mRNA CTD PMID:31558096 Acaa1a Rat sodium fluoride decreases expression ISO Acaa1a (Mus musculus) 6480464 Sodium Fluoride results in decreased expression of ACAA1A protein CTD PMID:28918527 Acaa1a Rat succimer multiple interactions ISO Acaa1a (Mus musculus) 6480464 [Succimer binds to Magnetite Nanoparticles] which results in decreased expression of ACAA1A mRNA and [Succimer co-treated with Magnetite Nanoparticles] results in decreased expression of ACAA1A mRNA CTD PMID:21641980 and PMID:26378955 Acaa1a Rat tamoxifen multiple interactions EXP 6480464 [Tamoxifen co-treated with bexarotene] results in increased expression of ACAA1 mRNA CTD PMID:17630414 Acaa1a Rat tamoxifen increases expression EXP 6480464 Tamoxifen results in increased expression of ACAA1 mRNA CTD PMID:17630414 Acaa1a Rat Tesaglitazar increases expression EXP 6480464 tesaglitazar results in increased expression of ACAA1 mRNA CTD PMID:21515302 Acaa1a Rat tetrachloroethene increases expression ISO Acaa1a (Mus musculus) 6480464 Tetrachloroethylene results in increased expression of ACAA1A mRNA CTD PMID:28973375 Acaa1a Rat tetrachloromethane decreases expression ISO Acaa1a (Mus musculus) 6480464 Carbon Tetrachloride results in decreased expression of ACAA1A mRNA CTD PMID:27339419 and PMID:31919559 Acaa1a Rat tetrachloromethane multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of ACAA1A mRNA] CTD PMID:31150632 Acaa1a Rat tetrachloromethane decreases expression EXP 6480464 Carbon Tetrachloride results in decreased expression of ACAA1A mRNA CTD PMID:31150632 Acaa1a Rat theophylline multiple interactions ISO ACAA1 (Homo sapiens) 6480464 [Hydrogen Peroxide co-treated with Theophylline] results in decreased expression of ACAA1 protein CTD PMID:18951874 Acaa1a Rat thioacetamide decreases expression EXP 6480464 Thioacetamide results in decreased expression of ACAA1A mRNA CTD PMID:34492290 Acaa1a Rat thiram decreases expression ISO ACAA1 (Homo sapiens) 6480464 Thiram results in decreased expression of ACAA1 mRNA CTD PMID:38568856 Acaa1a Rat titanium dioxide multiple interactions ISO Acaa1a (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in increased expression of ACAA1A mRNA CTD PMID:29950665 Acaa1a Rat trichloroacetic acid increases expression ISO Acaa1a (Mus musculus) 6480464 Trichloroacetic Acid results in increased expression of ACAA1A mRNA CTD PMID:23575800 Acaa1a Rat trichloroethene increases expression ISO Acaa1a (Mus musculus) 6480464 Trichloroethylene results in increased expression of ACAA1A mRNA CTD PMID:23575800 and PMID:28973375 Acaa1a Rat triphenyl phosphate affects expression ISO ACAA1 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of ACAA1 mRNA CTD PMID:37042841 Acaa1a Rat troglitazone decreases expression ISO Acaa1a (Mus musculus) 6480464 troglitazone results in decreased expression of ACAA1A protein CTD PMID:18495193 Acaa1a Rat troglitazone increases expression EXP 6480464 troglitazone results in increased expression of ACAA1 mRNA CTD PMID:21515302 Acaa1a Rat valproic acid multiple interactions ISO ACAA1 (Homo sapiens) 6480464 [Hydralazine co-treated with Valproic Acid] results in increased expression of ACAA1 mRNA CTD PMID:17183730 Acaa1a Rat valproic acid affects expression ISO ACAA1 (Homo sapiens) 6480464 Valproic Acid affects the expression of ACAA1 mRNA CTD PMID:25979313 Acaa1a Rat valproic acid increases expression ISO ACAA1 (Homo sapiens) 6480464 Valproic Acid results in increased expression of ACAA1 mRNA CTD PMID:23179753 Acaa1a Rat valproic acid decreases methylation ISO ACAA1 (Homo sapiens) 6480464 Valproic Acid results in decreased methylation of ACAA1 gene CTD PMID:29154799 Acaa1a Rat zinc atom affects expression EXP 6480464 Zinc affects the expression of ACAA1A mRNA CTD PMID:16413754 Acaa1a Rat zinc atom decreases expression EXP 6480464 Zinc deficiency results in decreased expression of ACAA1A mRNA CTD PMID:12672911 and PMID:15671213 Acaa1a Rat zinc(0) affects expression EXP 6480464 Zinc affects the expression of ACAA1A mRNA CTD PMID:16413754 Acaa1a Rat zinc(0) decreases expression EXP 6480464 Zinc deficiency results in decreased expression of ACAA1A mRNA CTD PMID:12672911 and PMID:15671213
Imported Annotations - KEGG (archival)
(+)-schisandrin B (EXP) (1->4)-beta-D-glucan (ISO) 1,2-dimethylhydrazine (ISO) 2,2',4,4',5,5'-hexachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4,6-trinitrotoluene (EXP) 2,6-dinitrotoluene (EXP) 2-methyl-2-[4-(1,2,3,4-tetrahydronaphthalen-1-yl)phenoxy]propanoic acid (EXP) 3,3',4,4'-tetrachlorobiphenyl (ISO) 3-chloropropane-1,2-diol (EXP) 3H-1,2-dithiole-3-thione (EXP) 4,4'-sulfonyldiphenol (EXP,ISO) 4-amino-2,6-dinitrotoluene (EXP) actinomycin D (ISO) aflatoxin B1 (ISO) all-trans-retinoic acid (ISO) aristolochic acid A (ISO) aspartame (ISO) Azoxymethane (ISO) benzo[a]pyrene (ISO) beta-lapachone (ISO) bexarotene (EXP) bezafibrate (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol AF (ISO) Bisphenol B (ISO) bisphenol F (EXP,ISO) C60 fullerene (EXP) cadmium atom (EXP,ISO) cadmium dichloride (EXP,ISO) capecitabine (ISO) captan (ISO) carbon nanotube (ISO) chlorpyrifos (ISO) ciglitazone (ISO) ciprofibrate (ISO) cisplatin (ISO) clobetasol (ISO) clofibrate (EXP,ISO) copper(II) sulfate (ISO) coumarin (EXP) cyclosporin A (ISO) dextran sulfate (ISO) dibutyl phthalate (EXP) dichloroacetic acid (ISO) diisononyl phthalate (ISO) diuron (EXP) dorsomorphin (ISO) doxifluridine (ISO) doxorubicin (EXP) epoxiconazole (ISO) ethanol (EXP) etomoxir (EXP) farnesol (ISO) fenofibrate (EXP,ISO) finasteride (EXP) flutamide (EXP) folic acid (ISO) folpet (ISO) furan (EXP) glafenine (EXP) gold atom (ISO) gold(0) (ISO) GW 7647 (ISO) hydralazine (ISO) hydrogen peroxide (ISO) isotretinoin (ISO) ivermectin (ISO) ketoconazole (EXP) leflunomide (EXP) methapyrilene (EXP) methotrexate (EXP) mono(2-ethylhexyl) phthalate (ISO) monosodium L-glutamate (ISO) Muraglitazar (EXP) N-methyl-4-phenylpyridinium (ISO) nafenopin (EXP) nefazodone (EXP) nimesulide (EXP) Nutlin-3 (ISO) O-methyleugenol (ISO) obeticholic acid (ISO) ochratoxin A (EXP,ISO) oleic acid (ISO) paracetamol (EXP,ISO) perfluorohexanesulfonic acid (ISO) perfluorooctane-1-sulfonic acid (EXP,ISO) perfluorooctanesulfonamide (EXP) perfluorooctanoic acid (EXP,ISO) permethrin (ISO) phenobarbital (ISO) phenylmercury acetate (ISO) PhIP (EXP) pirinixic acid (EXP,ISO) pyrazinecarboxamide (EXP) resveratrol (ISO) rotenone (EXP) SB 431542 (ISO) scopoletin (EXP) senecionine (ISO) sodium arsenite (ISO) sodium dichromate (ISO) sodium fluoride (ISO) succimer (ISO) tamoxifen (EXP) Tesaglitazar (EXP) tetrachloroethene (ISO) tetrachloromethane (EXP,ISO) theophylline (ISO) thioacetamide (EXP) thiram (ISO) titanium dioxide (ISO) trichloroacetic acid (ISO) trichloroethene (ISO) triphenyl phosphate (ISO) troglitazone (EXP,ISO) valproic acid (ISO) zinc atom (EXP) zinc(0) (EXP)
1.
Correlation between genetic and cytogenetic maps of the rat.
Andoh Y, etal., Mamm Genome 1998 Apr;9(4):287-93.
2.
Substrate specificities of 3-oxoacyl-CoA thiolase A and sterol carrier protein 2/3-oxoacyl-CoA thiolase purified from normal rat liver peroxisomes. Sterol carrier protein 2/3-oxoacyl-CoA thiolase is involved in the metabolism of 2-methyl-branched fatty acids and bile acid intermediates.
Antonenkov VD, etal., J Biol Chem. 1997 Oct 10;272(41):26023-31. doi: 10.1074/jbc.272.41.26023.
3.
Cloning and sequence determination of cDNA encoding a second rat liver peroxisomal 3-ketoacyl-CoA thiolase.
Bodnar AG and Rachubinski RA, Gene. 1990 Jul 16;91(2):193-9.
4.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
5.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
6.
Structural analysis of cDNA for rat peroxisomal 3-ketoacyl-CoA thiolase.
Hijikata M, etal., J Biol Chem 1987 Jun 15;262(17):8151-8.
7.
Rat peroxisomal 3-ketoacyl-CoA thiolase gene. Occurrence of two closely related but differentially regulated genes.
Hijikata M, etal., J Biol Chem 1990 Mar 15;265(8):4600-6.
8.
Activity of hepatic fatty acid oxidation enzymes in rats fed alpha-linolenic acid.
Kabir Y and Ide T, Biochim Biophys Acta. 1996 Nov 22;1304(2):105-19.
9.
KEGG: Kyoto Encyclopedia of Genes and Genomes
KEGG
10.
Effects of ubiquinone and mevalonic acid on hepatic peroxisomal enzymes induced by dehydroepiandrosterone.
Khan SA and Nyce JW, Pharmacol Toxicol. 1997 Mar;80(3):118-21.
11.
Proteomic analysis of rat liver peroxisome: presence of peroxisome-specific isozyme of Lon protease.
Kikuchi M, etal., J Biol Chem. 2004 Jan 2;279(1):421-8. Epub 2003 Oct 15.
12.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
13.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
14.
The effects of chronic trimetazidine treatment on mechanical function and fatty acid oxidation in diabetic rat hearts.
Onay-Besikci A, etal., Can J Physiol Pharmacol. 2007 May;85(5):527-35.
15.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
16.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
17.
Human peroxisomal 3-oxoacyl-coenzyme A thiolase deficiency.
Schram AW, etal., Proc Natl Acad Sci U S A. 1987 Apr;84(8):2494-6.
18.
Gene-based anchoring of the rat genetic linkage and cytogenetic maps: new regional localizations, orientation of the linkage groups, and insights into mammalian chromosome evolution.
Szpirer C, etal., Mamm Genome 1998 Sep;9(9):721-34
19.
Tentative Sequence Identification Numbers
Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
Acaa1a Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 8 127,956,126 - 127,966,348 (+) NCBI GRCr8 mRatBN7.2 8 119,079,401 - 119,088,626 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 8 119,079,775 - 119,088,624 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 8 124,661,801 - 124,670,662 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 8 122,860,818 - 122,869,679 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 8 120,694,346 - 120,703,213 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 8 128,027,880 - 128,036,471 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 8 128,027,958 - 128,036,236 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 8 127,234,641 - 127,243,232 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 8 124,305,097 - 124,313,887 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 8 124,324,833 - 124,333,624 (+) NCBI Celera 8 118,231,008 - 118,239,798 (+) NCBI Celera Cytogenetic Map 8 q32 NCBI
ACAA1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 3 38,122,715 - 38,137,127 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 3 38,103,129 - 38,137,242 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 3 38,164,206 - 38,178,618 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 3 38,139,211 - 38,153,619 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 3 38,139,210 - 38,153,619 NCBI Celera 3 38,100,002 - 38,114,534 (-) NCBI Celera Cytogenetic Map 3 p22.2 ENTREZGENE HuRef 3 38,205,163 - 38,219,695 (-) NCBI HuRef CHM1_1 3 38,116,181 - 38,130,713 (-) NCBI CHM1_1 T2T-CHM13v2.0 3 38,128,384 - 38,142,796 (-) NCBI T2T-CHM13v2.0
Acaa1a Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 9 119,170,113 - 119,179,361 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 9 119,168,742 - 119,179,365 (+) Ensembl GRCm39 Ensembl GRCm38 9 119,341,028 - 119,350,296 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 9 119,339,676 - 119,350,299 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 9 119,250,412 - 119,259,413 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 9 119,189,992 - 119,198,993 (+) NCBI MGSCv36 mm8 Celera 9 119,810,424 - 119,819,473 (+) NCBI Celera Cytogenetic Map 9 F3 NCBI cM Map 9 71.33 NCBI
ACAA1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 2 38,075,928 - 38,090,823 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 3 38,080,692 - 38,095,705 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 3 38,020,439 - 38,035,341 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 3 38,302,976 - 38,317,009 (-) NCBI panpan1.1 PanPan1.1 panPan2
ACAA1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 23 7,889,481 - 7,901,324 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 23 7,889,500 - 7,901,229 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 23 7,931,439 - 7,943,297 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 23 8,179,036 - 8,190,917 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 23 8,179,041 - 8,190,806 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 23 7,992,930 - 8,004,823 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 23 8,134,083 - 8,145,938 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 23 8,126,342 - 8,138,206 (-) NCBI UU_Cfam_GSD_1.0
ACAA1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 13 22,964,875 - 23,020,143 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 13 22,964,844 - 23,020,138 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 13 25,168,888 - 25,179,542 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
ACAA1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 15 1,282,556 - 1,297,154 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 15 1,282,650 - 1,297,832 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666063 10,012,294 - 10,026,718 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Acaa1
.
Predicted Target Of
Count of predictions: 295 Count of miRNA genes: 197 Interacting mature miRNAs: 218 Transcripts: ENSRNOT00000045049, ENSRNOT00000055919 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
2303171 Bp331 Blood pressure QTL 331 5.57 0.005 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 8 61290298 119084929 Rat 738011 Anxrr9 Anxiety related response QTL 9 6.1 exploratory behavior trait (VT:0010471) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 8 93535351 123900184 Rat 724539 Cm19 Cardiac mass QTL 19 2.6 heart mass (VT:0007028) calculated heart weight (CMO:0000073) 8 100149864 120994388 Rat 1358903 Bp252 Blood pressure QTL 252 7 0.0001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 8 93965141 123900184 Rat 70197 BpQTLcluster8 Blood pressure QTL cluster 8 3.482 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 8 46531639 119088626 Rat 738014 Anxrr15 Anxiety related response QTL 15 3.6 0.005 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 8 95718998 123900184 Rat 2300182 Bmd56 Bone mineral density QTL 56 5.4 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 8 95718998 123900184 Rat 1554321 Bmd3 Bone mineral density QTL 3 7.9 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 8 40952565 123900184 Rat 2300181 Bmd55 Bone mineral density QTL 55 5.7 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 8 76468691 121468691 Rat 1358893 Bp263 Blood pressure QTL 263 5.01 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 8 93965141 123900184 Rat 61437 Cia6 Collagen induced arthritis QTL 6 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 8 82460758 122812818 Rat
D8Wox10
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 8 127,962,512 - 127,962,651 (+) Marker Load Pipeline mRatBN7.2 8 119,084,790 - 119,084,929 (+) MAPPER mRatBN7.2 Rnor_6.0 8 128,032,912 - 128,033,050 NCBI Rnor6.0 Rnor_5.0 8 127,239,673 - 127,239,811 UniSTS Rnor5.0 RGSC_v3.4 8 124,310,080 - 124,310,219 RGD RGSC3.4 RGSC_v3.4 8 124,310,081 - 124,310,219 UniSTS RGSC3.4 RGSC_v3.1 8 124,329,817 - 124,329,956 RGD Celera 8 118,235,992 - 118,236,130 UniSTS RH 3.4 Map 8 1312.6 UniSTS RH 3.4 Map 8 1312.6 RGD RH 2.0 Map 8 1012.2 RGD Cytogenetic Map 8 q32 UniSTS
D8Arb22
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 8 119,084,715 - 119,085,047 (+) MAPPER mRatBN7.2 Rnor_6.0 8 128,032,837 - 128,033,168 NCBI Rnor6.0 Rnor_5.0 8 127,239,598 - 127,239,929 UniSTS Rnor5.0 RGSC_v3.4 8 124,310,006 - 124,310,337 UniSTS RGSC3.4 RGSC_v3.1 8 124,329,742 - 124,330,074 RGD Celera 8 118,235,917 - 118,236,248 UniSTS Cytogenetic Map 8 q32 UniSTS
BI274607
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 8 119,088,454 - 119,088,605 (+) MAPPER mRatBN7.2 Rnor_6.0 8 128,036,329 - 128,036,479 NCBI Rnor6.0 Rnor_5.0 8 127,243,090 - 127,243,240 UniSTS Rnor5.0 RGSC_v3.4 8 124,313,745 - 124,313,895 UniSTS RGSC3.4 Celera 8 118,239,656 - 118,239,806 UniSTS RH 3.4 Map 8 1287.3 UniSTS Cytogenetic Map 8 q32 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000045049 ⟹ ENSRNOP00000050691
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 8 119,079,820 - 119,088,624 (+) Ensembl Rnor_6.0 Ensembl 8 128,027,958 - 128,036,236 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000103723 ⟹ ENSRNOP00000092329
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 8 119,079,807 - 119,088,597 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000107742 ⟹ ENSRNOP00000079249
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 8 119,079,820 - 119,088,624 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000112098 ⟹ ENSRNOP00000092720
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 8 119,079,775 - 119,088,597 (+) Ensembl
RefSeq Acc Id:
NM_001395662 ⟹ NP_001382591
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 127,957,481 - 127,966,348 (+) NCBI mRatBN7.2 8 119,079,759 - 119,088,626 (+) NCBI
RefSeq Acc Id:
NM_012489 ⟹ NP_036621
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 127,957,481 - 127,966,348 (+) NCBI mRatBN7.2 8 119,079,759 - 119,088,626 (+) NCBI Rnor_6.0 8 128,027,880 - 128,036,471 (+) NCBI Rnor_5.0 8 127,234,641 - 127,243,232 (+) NCBI RGSC_v3.4 8 124,305,097 - 124,313,887 (+) RGD Celera 8 118,231,008 - 118,239,798 (+) RGD
Sequence:
ACTTTCAGGCCTCGTGAGGTAGAGGGCTGGCCTGCGCCTGCGCCTGCCATCATTTTGGTTTGTTAAGCAAGGCAGAGCATGAGCGAGTCGGTGGGACGCACCTCCGCGATGCATCGGCTGCAGGTAGT
hide sequence
RefSeq Acc Id:
XM_039080786 ⟹ XP_038936714
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 127,957,123 - 127,966,344 (+) NCBI mRatBN7.2 8 119,079,401 - 119,088,623 (+) NCBI
RefSeq Acc Id:
XM_063264886 ⟹ XP_063120956
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 127,956,126 - 127,966,344 (+) NCBI
RefSeq Acc Id:
XM_063264887 ⟹ XP_063120957
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 127,957,210 - 127,966,344 (+) NCBI
RefSeq Acc Id:
XM_063264888 ⟹ XP_063120958
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 127,957,240 - 127,966,344 (+) NCBI
RefSeq Acc Id:
NP_036621 ⟸ NM_012489
- Peptide Label:
isoform 1
- UniProtKB:
Q5FVR9 (UniProtKB/Swiss-Prot), P21775 (UniProtKB/Swiss-Prot), A0A8I6AHC5 (UniProtKB/TrEMBL), A6I3W1 (UniProtKB/TrEMBL)
- Sequence:
MSESVGRTSAMHRLQVVLGHLAGRPESSSALQAAPCSATFPQASASDVVVVHGRRTPIGRAGRGGFKDTTPDELLSAVLTAVLQDVKLKPECLGDISVGNVLEPGAGAVMARIAQFLSGIPETVPLSA
hide sequence
Ensembl Acc Id:
ENSRNOP00000050691 ⟸ ENSRNOT00000045049
RefSeq Acc Id:
XP_038936714 ⟸ XM_039080786
- Peptide Label:
isoform X1
- UniProtKB:
Q5FVR9 (UniProtKB/Swiss-Prot), P21775 (UniProtKB/Swiss-Prot), A0A8I6AHC5 (UniProtKB/TrEMBL), A6I3W1 (UniProtKB/TrEMBL)
Ensembl Acc Id:
ENSRNOP00000092329 ⟸ ENSRNOT00000103723
Ensembl Acc Id:
ENSRNOP00000079249 ⟸ ENSRNOT00000107742
Ensembl Acc Id:
ENSRNOP00000092720 ⟸ ENSRNOT00000112098
RefSeq Acc Id:
NP_001382591 ⟸ NM_001395662
- Peptide Label:
isoform 2
- UniProtKB:
A0A8I6G309 (UniProtKB/TrEMBL), F1LPD6 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063120956 ⟸ XM_063264886
- Peptide Label:
isoform X1
- UniProtKB:
Q5FVR9 (UniProtKB/Swiss-Prot), P21775 (UniProtKB/Swiss-Prot), A0A8I6AHC5 (UniProtKB/TrEMBL), A6I3W1 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063120957 ⟸ XM_063264887
- Peptide Label:
isoform X1
- UniProtKB:
Q5FVR9 (UniProtKB/Swiss-Prot), P21775 (UniProtKB/Swiss-Prot), A0A8I6AHC5 (UniProtKB/TrEMBL), A6I3W1 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063120958 ⟸ XM_063264888
- Peptide Label:
isoform X1
- UniProtKB:
Q5FVR9 (UniProtKB/Swiss-Prot), P21775 (UniProtKB/Swiss-Prot), A0A8I6AHC5 (UniProtKB/TrEMBL), A6I3W1 (UniProtKB/TrEMBL)
RGD ID: 13696370 Promoter ID: EPDNEW_R6895 Type: initiation region Name: Acaa1a_1 Description: acetyl-CoA acyltransferase 1A SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 8 128,027,875 - 128,027,935 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2017-08-24
Acaa1a
acetyl-CoA acyltransferase 1A
Acaa1
acetyl-CoA acyltransferase 1A
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2017-08-22
Acaa1
acetyl-CoA acyltransferase 1A
Acaa1a
acetyl-CoA acyltransferase 1
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2016-08-18
Acaa1a
acetyl-CoA acyltransferase 1
Acaa1
acetyl-CoA acyltransferase 1A
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2015-08-11
Acaa1
acetyl-CoA acyltransferase 1A
Acaa1a
acetyl-CoA acyltransferase 1
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2013-07-23
Acaa1a
acetyl-CoA acyltransferase 1
Acaa1
acetyl-CoA acyltransferase 1A
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2013-07-18
Acaa1
acetyl-CoA acyltransferase 1A
Acaa1a
acetyl-Coenzyme A acyltransferase 1A
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2005-11-17
Acaa1
acetyl-Coenzyme A acyltransferase 1
Acaa1
acetyl-Coenzyme A acyltransferase 1 (peroxisomal 3-oxoacyl-Coenzyme A thiolase)
Name updated
1299863 APPROVED
2003-01-28
Acaa1
acetyl-Coenzyme A acyltransferase 1 (peroxisomal 3-oxoacyl-Coenzyme A thiolase)
Acaa
acetyl-CoA acyltransferase, 3-oxo acyl-CoA thiolase A
Data merged from RGD:2010
628472 PROVISIONAL
Note Type
Note
Reference
gene_process
functions in peroxisomal beta-oxidation of fatty acids
1299138
gene_protein
mature enzyme is composed of 398 amino acids and the molecular weight is 41,074
1299140
