Advanced Search (OLGA)

Gene: Mtfr2 (mitochondrial fission regulator 2) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Mtfr2 (Ensembl: Bclaf1)

Name:

mitochondrial fission regulator 2 (Ensembl:BCL2-associated transcription factor 1)

RGD ID:

6494892

Description:

Predicted to be involved in aerobic respiration and mitochondrial fission. Predicted to be active in mitochondrion. Orthologous to human MTFR2 (mitochondrial fission regulator 2); INTERACTS WITH diethylstilbestrol; fenvalerate; (-)-demecolcine (ortholog).

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

DUF729 domain containing 1; Dufd1; LOC100911069; protein FAM54A-like

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	MTFR2 (mitochondrial fission regulator 2)	HGNC	HomoloGene, Inparanoid, NCBI, Panther, PhylomeDB
Mus musculus (house mouse):	Mtfr2 (mitochondrial fission regulator 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Mtfr2 (mitochondrial fission regulator 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	MTFR2 (mitochondrial fission regulator 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	MTFR2 (mitochondrial fission regulator 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Mtfr2 (mitochondrial fission regulator 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	MTFR2 (mitochondrial fission regulator 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	MTFR2 (mitochondrial fission regulator 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Mtfr2 (mitochondrial fission regulator 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Mus musculus (house mouse):	Mtfr2 (mitochondrial fission regulator 2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	MTFR2 (mitochondrial fission regulator 2)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	mtfr2 (mitochondrial fission regulator 2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	mtfr2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	16,942,814 - 16,958,218 (+)	NCBI		GRCr8
mRatBN7.2	1	15,123,232 - 15,138,632 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	15,070,894 - 15,148,832 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	14,877,372 - 14,892,479 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	20,879,304 - 20,894,408 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	15,103,132 - 15,118,478 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	15,834,779 - 15,850,424 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	15,782,477 - 15,860,624 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	17,379,823 - 17,394,566 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
Celera	1	13,553,856 - 13,569,459 (+)	NCBI		Celera
Cytogenetic Map	1	p12	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Mtfr2	Rat	Familial Behcet-Like Autoinflammatory Syndrome		ISO	MTFR2 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Autoinflammatory syndrome more ...	ClinVar	PMID:25741868
Mtfr2	Rat	immunodeficiency 27A		ISO	MTFR2 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Immunodeficiency 27A	ClinVar	PMID:28492532
Mtfr2	Rat	Peroxisome biogenesis disorder 9B		ISO	MTFR2 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Peroxisome biogenesis disorder 9B	ClinVar	PMID:12325024 more ...

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Mtfr2	Rat	(-)-demecolcine	decreases expression	ISO	MTFR2 (Homo sapiens)	6480464	Demecolcine results in decreased expression of MTFR2 mRNA	CTD	PMID:23649840
Mtfr2	Rat	2,3,7,8-tetrachlorodibenzodioxine	increases expression	ISO	MTFR2 (Homo sapiens)	6480464	Tetrachlorodibenzodioxin results in increased expression of MTFR2 mRNA	CTD	PMID:27913140
Mtfr2	Rat	acrylamide	increases expression	ISO	MTFR2 (Homo sapiens)	6480464	Acrylamide results in increased expression of MTFR2 mRNA	CTD	PMID:32763439
Mtfr2	Rat	aflatoxin B1	increases expression	ISO	MTFR2 (Homo sapiens)	6480464	Aflatoxin B1 results in increased expression of MTFR2 mRNA	CTD	PMID:22100608
Mtfr2	Rat	all-trans-retinoic acid	decreases expression	ISO	MTFR2 (Homo sapiens)	6480464	Tretinoin results in decreased expression of MTFR2 mRNA	CTD	PMID:33167477
Mtfr2	Rat	antirheumatic drug	decreases expression	ISO	MTFR2 (Homo sapiens)	6480464	Antirheumatic Agents results in decreased expression of MTFR2 mRNA	CTD	PMID:24449571
Mtfr2	Rat	aristolochic acid A	decreases expression	ISO	MTFR2 (Homo sapiens)	6480464	aristolochic acid I results in decreased expression of MTFR2 mRNA	CTD	PMID:33212167
Mtfr2	Rat	arsenite(3-)	multiple interactions	ISO	MTFR2 (Homo sapiens)	6480464	arsenite promotes the reaction [G3BP1 protein binds to MTFR2 mRNA]	CTD	PMID:32406909
Mtfr2	Rat	azathioprine	decreases expression	ISO	MTFR2 (Homo sapiens)	6480464	Azathioprine results in decreased expression of MTFR2 mRNA	CTD	PMID:22623647
Mtfr2	Rat	benzo[a]pyrene	increases expression	ISO	MTFR2 (Homo sapiens)	6480464	Benzo(a)pyrene results in increased expression of MTFR2 mRNA	CTD	PMID:32234424
Mtfr2	Rat	benzo[a]pyrene diol epoxide I	decreases expression	ISO	MTFR2 (Homo sapiens)	6480464	7 more ...	CTD	PMID:19150397 and PMID:20382639
Mtfr2	Rat	bisphenol A	decreases expression	ISO	MTFR2 (Homo sapiens)	6480464	bisphenol A results in decreased expression of MTFR2 mRNA	CTD	PMID:29275510
Mtfr2	Rat	caffeine	affects phosphorylation	ISO	MTFR2 (Homo sapiens)	6480464	Caffeine affects the phosphorylation of MTFR2 protein	CTD	PMID:35688186
Mtfr2	Rat	calcitriol	decreases expression	ISO	MTFR2 (Homo sapiens)	6480464	Calcitriol results in decreased expression of MTFR2 mRNA	CTD	PMID:21592394
Mtfr2	Rat	calcitriol	multiple interactions	ISO	MTFR2 (Homo sapiens)	6480464	[Testosterone co-treated with Calcitriol] results in decreased expression of MTFR2 mRNA	CTD	PMID:21592394
Mtfr2	Rat	carbon nanotube	decreases expression	ISO	Mtfr2 (Mus musculus)	6480464	Nanotubes more ...	CTD	PMID:25554681
Mtfr2	Rat	CGP 52608	multiple interactions	ISO	MTFR2 (Homo sapiens)	6480464	CGP 52608 promotes the reaction [RORA protein binds to MTFR2 gene]	CTD	PMID:28238834
Mtfr2	Rat	chromium(6+)	multiple interactions	ISO	MTFR2 (Homo sapiens)	6480464	[zinc chromate results in increased abundance of chromium hexavalent ion] which results in decreased expression of MTFR2 mRNA	CTD	PMID:38479592
Mtfr2	Rat	copper(II) sulfate	decreases expression	ISO	MTFR2 (Homo sapiens)	6480464	Copper Sulfate results in decreased expression of MTFR2 mRNA	CTD	PMID:19549813
Mtfr2	Rat	coumestrol	multiple interactions	ISO	MTFR2 (Homo sapiens)	6480464	[Coumestrol co-treated with resveratrol] results in increased expression of MTFR2 mRNA	CTD	PMID:19167446
Mtfr2	Rat	coumestrol	increases expression	ISO	MTFR2 (Homo sapiens)	6480464	Coumestrol results in increased expression of MTFR2 mRNA	CTD	PMID:19167446
Mtfr2	Rat	cyclosporin A	decreases expression	ISO	MTFR2 (Homo sapiens)	6480464	Cyclosporine results in decreased expression of MTFR2 mRNA	CTD	PMID:20106945 more ...
Mtfr2	Rat	dichloroacetic acid	increases expression	ISO	Mtfr2 (Mus musculus)	6480464	Dichloroacetic Acid results in increased expression of MTFR2 mRNA	CTD	PMID:28962523
Mtfr2	Rat	dicrotophos	decreases expression	ISO	MTFR2 (Homo sapiens)	6480464	dicrotophos results in decreased expression of MTFR2 mRNA	CTD	PMID:28302478
Mtfr2	Rat	diethylstilbestrol	increases expression	EXP		6480464	Diethylstilbestrol results in increased expression of MTFR2 mRNA	CTD	PMID:36653537
Mtfr2	Rat	dioxygen	decreases expression	ISO	MTFR2 (Homo sapiens)	6480464	Oxygen deficiency results in decreased expression of MTFR2 mRNA	CTD	PMID:26516004
Mtfr2	Rat	epoxiconazole	decreases expression	ISO	Mtfr2 (Mus musculus)	6480464	epoxiconazole results in decreased expression of MTFR2 mRNA	CTD	PMID:35436446
Mtfr2	Rat	fenvalerate	increases expression	EXP		6480464	fenvalerate results in increased expression of MTFR2 mRNA	CTD	PMID:30307764
Mtfr2	Rat	FR900359	decreases phosphorylation	ISO	MTFR2 (Homo sapiens)	6480464	FR900359 results in decreased phosphorylation of MTFR2 protein	CTD	PMID:37730182
Mtfr2	Rat	isobutanol	multiple interactions	ISO	MTFR2 (Homo sapiens)	6480464	[[Gasoline co-treated with isobutyl alcohol] results in increased abundance of [Particulate Matter co-treated with Polycyclic Aromatic Hydrocarbons]] which results in decreased expression of MTFR2 mRNA	CTD	PMID:29432896
Mtfr2	Rat	lucanthone	decreases expression	ISO	MTFR2 (Homo sapiens)	6480464	Lucanthone results in decreased expression of MTFR2 mRNA	CTD	PMID:21148553
Mtfr2	Rat	nickel atom	increases expression	ISO	MTFR2 (Homo sapiens)	6480464	Nickel results in increased expression of MTFR2 mRNA	CTD	PMID:25583101
Mtfr2	Rat	ozone	multiple interactions	ISO	Mtfr2 (Mus musculus)	6480464	[Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in increased expression of MTFR2 mRNA and [Air Pollutants results in increased abundance of Ozone] which results in increased expression of MTFR2 mRNA	CTD	PMID:34911549
Mtfr2	Rat	ozone	multiple interactions	ISO	MTFR2 (Homo sapiens)	6480464	[Air Pollutants results in increased abundance of Ozone] which affects the expression of MTFR2 mRNA	CTD	PMID:35430440
Mtfr2	Rat	paracetamol	increases expression	ISO	MTFR2 (Homo sapiens)	6480464	Acetaminophen results in increased expression of MTFR2 mRNA	CTD	PMID:22230336
Mtfr2	Rat	perfluorononanoic acid	decreases expression	ISO	MTFR2 (Homo sapiens)	6480464	perfluoro-n-nonanoic acid results in decreased expression of MTFR2 mRNA	CTD	PMID:32588087
Mtfr2	Rat	quercetin	increases expression	ISO	MTFR2 (Homo sapiens)	6480464	Quercetin results in increased expression of MTFR2 mRNA	CTD	PMID:21632981
Mtfr2	Rat	resveratrol	multiple interactions	ISO	MTFR2 (Homo sapiens)	6480464	[Coumestrol co-treated with resveratrol] results in increased expression of MTFR2 mRNA	CTD	PMID:19167446
Mtfr2	Rat	rotenone	decreases expression	ISO	MTFR2 (Homo sapiens)	6480464	Rotenone results in decreased expression of MTFR2 mRNA	CTD	PMID:29955902
Mtfr2	Rat	silicon dioxide	increases expression	ISO	Mtfr2 (Mus musculus)	6480464	Silicon Dioxide results in increased expression of MTFR2 mRNA	CTD	PMID:29341224
Mtfr2	Rat	sodium arsenite	decreases expression	ISO	MTFR2 (Homo sapiens)	6480464	sodium arsenite results in decreased expression of MTFR2 mRNA	CTD	PMID:38568856
Mtfr2	Rat	sodium arsenite	increases expression	ISO	MTFR2 (Homo sapiens)	6480464	sodium arsenite results in increased expression of MTFR2 mRNA	CTD	PMID:29301061
Mtfr2	Rat	temozolomide	increases expression	ISO	MTFR2 (Homo sapiens)	6480464	Temozolomide results in increased expression of MTFR2 mRNA	CTD	PMID:31758290
Mtfr2	Rat	teriflunomide	decreases expression	ISO	MTFR2 (Homo sapiens)	6480464	teriflunomide results in decreased expression of MTFR2 mRNA	CTD	PMID:29427785
Mtfr2	Rat	testosterone	multiple interactions	ISO	MTFR2 (Homo sapiens)	6480464	[Testosterone co-treated with Calcitriol] results in decreased expression of MTFR2 mRNA	CTD	PMID:21592394
Mtfr2	Rat	testosterone	decreases expression	ISO	MTFR2 (Homo sapiens)	6480464	Testosterone results in decreased expression of MTFR2 mRNA	CTD	PMID:21592394
Mtfr2	Rat	thalidomide	decreases expression	ISO	Mtfr2 (Mus musculus)	6480464	Thalidomide results in decreased expression of MTFR2 mRNA	CTD	PMID:26217789
Mtfr2	Rat	Theaflavin 3,3'-digallate	affects expression	ISO	MTFR2 (Homo sapiens)	6480464	theaflavin-3 and 3'-digallate affects the expression of MTFR2 mRNA	CTD	PMID:34925699
Mtfr2	Rat	titanium dioxide	decreases methylation	ISO	Mtfr2 (Mus musculus)	6480464	titanium dioxide results in decreased methylation of MTFR2 gene	CTD	PMID:35295148
Mtfr2	Rat	trimellitic anhydride	increases expression	ISO	Mtfr2 (Mus musculus)	6480464	trimellitic anhydride results in increased expression of MTFR2 mRNA	CTD	PMID:19042947
Mtfr2	Rat	triptonide	increases expression	ISO	Mtfr2 (Mus musculus)	6480464	triptonide results in increased expression of MTFR2 mRNA	CTD	PMID:33045310
Mtfr2	Rat	trovafloxacin	decreases expression	ISO	Mtfr2 (Mus musculus)	6480464	trovafloxacin results in decreased expression of MTFR2 mRNA	CTD	PMID:35537566
Mtfr2	Rat	tungsten	increases expression	ISO	Mtfr2 (Mus musculus)	6480464	Tungsten results in increased expression of MTFR2 mRNA	CTD	PMID:30912803
Mtfr2	Rat	urethane	decreases expression	ISO	MTFR2 (Homo sapiens)	6480464	Urethane results in decreased expression of MTFR2 mRNA	CTD	PMID:28818685
Mtfr2	Rat	valproic acid	decreases methylation	ISO	MTFR2 (Homo sapiens)	6480464	Valproic Acid results in decreased methylation of MTFR2 gene	CTD	PMID:29154799
Mtfr2	Rat	valproic acid	increases expression	ISO	MTFR2 (Homo sapiens)	6480464	Valproic Acid results in increased expression of MTFR2 mRNA	CTD	PMID:23179753
Mtfr2	Rat	vincristine	decreases expression	ISO	MTFR2 (Homo sapiens)	6480464	Vincristine results in decreased expression of MTFR2 mRNA	CTD	PMID:23649840
Mtfr2	Rat	vorinostat	increases expression	ISO	MTFR2 (Homo sapiens)	6480464	vorinostat results in increased expression of MTFR2 mRNA	CTD	PMID:27188386

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Mtfr2	Rat	aerobic respiration	involved_in	IEA	UniRule:UR001693760	1600115	GO_REF:0000104	UniProt	GO_REF:0000104
Mtfr2	Rat	aerobic respiration	involved_in	IBA	MGI:1914722 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Mtfr2	Rat	aerobic respiration	involved_in	ISO	Mtfr2 (Mus musculus)	1624291	PMID:20568109	RGD	PMID:20568109
Mtfr2	Rat	cellular response to leukemia inhibitory factor	acts_upstream_of_or_within	IEA	UniProtKB:Q8K019 and ensembl:ENSMUSP00000043583	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Mtfr2	Rat	DNA damage response	involved_in	IEA	UniProtKB:Q9NYF8 and ensembl:ENSP00000435210	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Mtfr2	Rat	mitochondrial fission	involved_in	IEA	UniRule:UR001693760	1600115	GO_REF:0000104	UniProt	GO_REF:0000104
Mtfr2	Rat	mitochondrial fission	involved_in	IBA	MGI:1919054 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Mtfr2	Rat	mitochondrial fission	involved_in	ISO	Mtfr2 (Mus musculus)	1624291	PMID:20568109	RGD	PMID:20568109
Mtfr2	Rat	mitochondrion organization	involved_in	ISO	Mtfr2 (Mus musculus)	1624291	PMID:20568109	RGD	PMID:20568109
Mtfr2	Rat	negative regulation of DNA-templated transcription	acts_upstream_of_or_within	IEA	UniProtKB:Q9NYF8 and ensembl:ENSP00000435210	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Mtfr2	Rat	positive regulation of apoptotic process	acts_upstream_of_or_within	IEA	UniProtKB:Q9NYF8 and ensembl:ENSP00000435210	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Mtfr2	Rat	positive regulation of DNA-templated transcription initiation	involved_in	IEA	UniProtKB:Q9NYF8 and ensembl:ENSP00000435210	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Mtfr2	Rat	positive regulation of intrinsic apoptotic signaling pathway	involved_in	IEA	UniProtKB:Q9NYF8 and ensembl:ENSP00000435210	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Mtfr2	Rat	mitochondrion	located_in	IEA	UniProtKB-SubCell:SL-0173	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Mtfr2	Rat	mitochondrion	located_in	IEA	UniRule:UR001693760	1600115	GO_REF:0000104	UniProt	GO_REF:0000104
Mtfr2	Rat	mitochondrion	is_active_in	IBA	MGI:1919054 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Mtfr2	Rat	mitochondrion	located_in	IEA	UniProtKB-KW:KW-0496	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Mtfr2	Rat	mitochondrion	located_in	ISO	Mtfr2 (Mus musculus)	1624291	PMID:20568109	RGD	PMID:20568109
Mtfr2	Rat	nuclear speck	located_in	IEA	UniProtKB:Q9NYF8 and ensembl:ENSP00000435210	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Mtfr2	Rat	nucleoplasm	located_in	IEA	UniProtKB:Q9NYF8 and ensembl:ENSP00000435210	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Mtfr2	Rat	nucleus	located_in	IEA	UniProtKB:Q9NYF8 and ensembl:ENSP00000435210	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Mtfr2	Rat	DNA binding	enables	IEA	UniProtKB:Q9NYF8 and ensembl:ENSP00000435210	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Mtfr2	Rat	protein binding	enables	ISO	MTFR2 (Homo sapiens)	1624291	UniProtKB:P13196 more ...	RGD	PMID:25416956

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
3.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

PMID:12477932	PMID:15489334	PMID:20568109

Mtfr2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	16,942,814 - 16,958,218 (+)	NCBI		GRCr8
mRatBN7.2	1	15,123,232 - 15,138,632 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	15,070,894 - 15,148,832 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	14,877,372 - 14,892,479 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	20,879,304 - 20,894,408 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	15,103,132 - 15,118,478 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	15,834,779 - 15,850,424 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	15,782,477 - 15,860,624 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	17,379,823 - 17,394,566 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
Celera	1	13,553,856 - 13,569,459 (+)	NCBI		Celera
Cytogenetic Map	1	p12	NCBI

MTFR2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	6	136,231,034 - 136,250,311 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	6	136,231,024 - 136,250,335 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	6	136,552,172 - 136,571,449 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	6	136,593,861 - 136,613,142 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	6	136,593,860 - 136,613,142	NCBI
Celera	6	137,292,609 - 137,311,889 (-)	NCBI		Celera
Cytogenetic Map	6	q23.3	NCBI
HuRef	6	134,116,804 - 134,136,084 (-)	NCBI		HuRef
CHM1_1	6	136,814,686 - 136,833,971 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	6	137,419,143 - 137,438,419 (-)	NCBI		T2T-CHM13v2.0

Mtfr2
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	10	20,223,491 - 20,237,415 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	10	20,223,516 - 20,237,050 (+)	Ensembl		GRCm39 Ensembl
GRCm38	10	20,344,653 - 20,361,669 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	10	20,347,770 - 20,361,304 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	10	20,067,625 - 20,081,475 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	10	20,037,241 - 20,050,735 (+)	NCBI		MGSCv36	mm8
Celera	10	20,236,666 - 20,250,342 (+)	NCBI		Celera
Cytogenetic Map	10	A3	NCBI
cM Map	10	9.75	NCBI

Mtfr2
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955439	646,432 - 663,033 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955439	643,289 - 662,921 (+)	NCBI	ChiLan1.0	ChiLan1.0

MTFR2
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	5	156,201,929 - 156,226,277 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	6	154,100,726 - 154,124,456 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	6	133,995,679 - 134,014,947 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	6	138,085,517 - 138,104,764 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	6	138,084,908 - 138,104,740 (-)	Ensembl	panpan1.1		panPan2

MTFR2
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	1	28,830,818 - 28,844,875 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	1	28,830,867 - 28,844,710 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	1	29,708,976 - 29,723,038 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	1	28,986,198 - 29,000,267 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	1	28,984,794 - 29,000,115 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	1	28,872,409 - 28,886,470 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	1	28,755,384 - 28,769,446 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	1	29,056,087 - 29,070,152 (-)	NCBI		UU_Cfam_GSD_1.0

Mtfr2
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404946	123,881,482 - 123,893,809 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936560	3,660,705 - 3,671,917 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936560	3,656,639 - 3,670,923 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

MTFR2
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	1	27,908,824 - 28,015,101 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	1	27,906,162 - 27,998,861 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	1	31,398,310 - 31,486,257 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

MTFR2
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	13	37,173,430 - 37,192,734 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	13	37,174,438 - 37,192,790 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666040	9,361,104 - 9,383,691 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Mtfr2
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624886	1,434,253 - 1,444,462 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624886	1,431,171 - 1,446,007 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Mtfr2
108 total Variants

Assembly: Rnor_6.0

Chromosome	Start Pos	End Pos	Reference Nucleotide	Variant Nucleotide	Variant Type	Strain	Variant Page
1	15835926	15835927	C	G	snv	ACI/N (MCW), BN/SsN (MCW), WKY/N (MCW), MR/N (MCW), M520/N (MCW)	View more Information

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
631688	Hcas2	Hepatocarcinoma susceptibility QTL 2	3	0.0001	liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	1	5925874	115540829	Rat
1578650	Bmd6	Bone mineral density QTL 6	12.2		femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	1	509108	43284926	Rat
1354647	Despr8	Despair related QTL 8		0.0000341	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	1	1	24744506	Rat
1578651	Bmd7	Bone mineral density QTL 7	14.2		femur mineral mass (VT:0010011)	compact volumetric bone mineral density (CMO:0001730)	1	509108	43284926	Rat
2313062	Bmd73	Bone mineral density QTL 73	3.9	0.0001	tibia mineral mass (VT:1000283)	compact volumetric bone mineral density (CMO:0001730)	1	11481312	82174945	Rat
1554320	Bmd1	Bone mineral density QTL 1	12.2	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	1	509108	86060548	Rat
2313065	Bss67	Bone structure and strength QTL 67	3.1	0.0001	tibia area (VT:1000281)	tibia total energy absorbed before break (CMO:0001736)	1	11481312	82174945	Rat
7421626	Bp360	Blood pressure QTL 360		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	4393289	49393289	Rat
2313070	Bss52	Bone structure and strength QTL 52	4.4	0.0001	body length (VT:0001256)	body length (CMO:0000013)	1	1	32356093	Rat
2313069	Bss68	Bone structure and strength QTL 68	2.9	0.0001	tibia size trait (VT:0100001)	tibia total energy absorbed before break (CMO:0001736)	1	11481312	82174945	Rat
2313075	Bss66	Bone structure and strength QTL 66	3.4	0.0001	tibia length (VT:0004357)	tibia length (CMO:0000450)	1	11481312	82174945	Rat
2298546	Neuinf4	Neuroinflammation QTL 4	5.1		nervous system integrity trait (VT:0010566)	spinal cord RT1-B protein level (CMO:0002132)	1	1	28736750	Rat
1300167	Hrtrt2	Heart rate QTL 2	4.35		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	1	11481312	75088344	Rat
2313077	Bss69	Bone structure and strength QTL 69	3.5	0.0001	tibia strength trait (VT:1000284)	bone polar moment of inertia (CMO:0001558)	1	11481312	82174945	Rat
2317755	Glom22	Glomerulus QTL 22	3.8		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	1	11481482	32355910	Rat
1578756	Iddm22	Insulin dependent diabetes mellitus QTL 22	2.7		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	11835181	56835181	Rat
631508	Sald1	Serum aldosterone level QTL 1	3.7		blood aldosterone amount (VT:0005346)	serum aldosterone level (CMO:0000487)	1	9856001	54856001	Rat
2313090	Bmd69	Bone mineral density QTL 69	4.4	0.0001	tibia mineral mass (VT:1000283)	compact volumetric bone mineral density (CMO:0001730)	1	1	32356093	Rat
4889451	Eae29	Experimental allergic encephalomyelitis QTL 29	5.51		nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis severity score (CMO:0001419)	1	5925877	24697545	Rat
2313092	Bmd72	Bone mineral density QTL 72	2.5	0.0001	tibia mineral mass (VT:1000283)	total volumetric bone mineral density (CMO:0001728)	1	11481312	82174945	Rat
2313097	Bss70	Bone structure and strength QTL 70	3.5	0.0001	tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	1	11481312	82174945	Rat
738020	Pia8	Pristane induced arthritis QTL 8	4.7		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	1	1	65833076	Rat
1600360	Mcs16	Mammary carcinoma susceptibility QTL 16	2.4		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	1	2244390	43433040	Rat
1578669	Bss9	Bone structure and strength QTL 9	6.3		femur morphology trait (VT:0000559)	bone trabecular cross-sectional area (CMO:0002311)	1	509108	43284926	Rat
2302038	Pia31	Pristane induced arthritis QTL 31	5.5	0.001	blood autoantibody amount (VT:0003725)	serum immunoglobulin M-type rheumatoid factor level relative to an arbitrary reference serum (CMO:0002111)	1	10992065	55992065	Rat
2313053	Bss51	Bone structure and strength QTL 51	3.8	0.0001	tibia length (VT:0004357)	tibia length (CMO:0000450)	1	1	32356093	Rat

RH132072

Rat Assembly	Chr	Position (strand)	Source	JBrowse
Cytogenetic Map	1	p12	UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
3	11	43	82	57	60	41	19	41	160	73	74	35	41	19


RefSeq Transcripts	NM_001290110	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039103500	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063284133	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC159435	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000001	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000078589 ⟹ ENSRNOP00000068911

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	15,088,575 - 15,115,298 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000079069 ⟹ ENSRNOP00000072258

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	15,123,232 - 15,138,630 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000088025 ⟹ ENSRNOP00000071825

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	15,070,894 - 15,148,832 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000089966 ⟹ ENSRNOP00000072352

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	15,070,894 - 15,146,586 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000094509 ⟹ ENSRNOP00000097938

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	15,086,571 - 15,117,520 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000100188 ⟹ ENSRNOP00000076713

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	15,088,529 - 15,117,519 (+)	Ensembl

RefSeq Acc Id:

NM_001290110 ⟹ NP_001277039

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	16,942,814 - 16,958,214 (+)	NCBI
mRatBN7.2	1	15,123,232 - 15,138,632 (+)	NCBI
Rnor_6.0	1	15,834,779 - 15,850,424 (+)	NCBI
Celera	1	13,553,856 - 13,569,459 (+)	NCBI

Sequence:

show sequence

CGAGCGGTTCCGGTACGAAGTTGCTTGGCGGCTGTCGGCGGGCCGGCCGCCCCGCTTTGCGTCTAGAGAGTTTCCCCGGCCGCCGGCGGCGTGCAATGCAGCGGGACGGTACCAACGAACAATGTTTT
CTTGAACTTGCTTCACCAATGTCTTTCATTCTGAATATATTAAGAAACATGCTGGCATATTTTGGTGTTCCCGTAGATCAGGATTTGCTGATTTTTCAAAATAAAGATTATGGGTCAGCTCGGAGTAT
TGTCCGTGTTATTGGAAGAATGCTTCCTTTAGAGCCTTGCCGAAGACCTCGTTTTGAGTTGACCCCACCTGCGAACGCTAAGGAGGTGGATGACTATGAACTTGCGGTTCCGTCTTTTGCTGATGTTT
TGTGTGTGGCAGATGATGGAGAAGCCGGTTGTCTCAGATTTCGACACAGTCTATGGAAAAAGGCGGAAGGGAAAGCTGCTCTCTTCCATCCTTCAAAACTACCTTGGGACCTGTCGTCCCCTGCTCTA
AGTCAGAACAGAACAGTGGCCGATGACCTTCCTGTAAGCGAAGCTGCCATTAAAAAGATAGCCGCCCTTGAAGATGAGCTGACTTCTCTCCGGGCTCAGATCGCGGCCATTGTGGCCATGCAGGACCT
GGGAGGGGGTGGGGAGACTGGCTTCATCAGCTTGAGCGATGGACCCAGCATGGAGCAGGTGCCACCATCATCAGCGACCGCTCGGCTGAGTGTGGAACCAGACCATGTTCCAAGTGTGGTGCTTTCTC
CTCCTCCCCTTCCTCCTCCTCCTCCCCCACTTCCTCCTCCTCAGTTTTCTCTGCAGCCTCCCAGTTCTCTTCCCGTGCCACCCGGATCTGCGAATACACGTGGCATAGATAATCTGGCTGCTGAAATG
AAAAAGCGCCCTTCTGGTGTTAAGAAGACTGACGGCAGCCATCATTCAGAAAGCCAGAGAGTAAGTGACGTTCCGAACATGTTGGATGTTCTGAAGGACATGAATAAGGTCAAACTTCGGCCAGTGGA
AAGGTCACCGGGTGGTAGACCCATTCAGAAGAGGAGAAGACAGAGTTCACAATGGGATCCAGTGTCTCTAATTTCTAATGCACTGAAACAGAAGTTTGCCTTTCAAGATGATTCCTTTGATAGTGAAA
ATAGGTCTTGGCAAGGTTCTCCATTTTCTAGTCCAGAAACTTCCAGAAATGGTTCCAGGTTTTGACGTCACATTACTCCACCAGAGAGTCAGCGAGTGACCTAAGGGAAGGACCGATGATATAAAAGC
CGTAATCCAGGGTATCAGAAGCAAAAGCTGGACTACACTTGGAAGGACAGATCAGGCTTGCCCTGTGGTATCCTTCACTGCCTGTCAGGGAATTACCACCTCTGTTAGGGTCATCAGGCTGTACTCTG
GGACCAGTATCCGCCCAGCCCGAGGAAGACATCTGTGAACACTGTCTCTGCTTTTGGAAGATGTGGCATTTGACTGACTACTGAAAAGAGTTGGGTGTAGATTCCCCATATGAGTGCTACTGAAATAC
GTGGTTCCGTGATGTTCCTAAAACTATGGCTTCCTACGGAGGCTCCTTTCAGTCTTGTGAGTTGCTGTGATACAGTTTACGTGGCTTTCAGTAACTTGTAGATTTCTTAGTGAGCAGAAGATGATGAT
TTTCATTAAGATAGAGTTTTAGTCACATAGGGCTGAACTTCCTAGAACTTCCTGCAGTAGTAAATTATTTGATCGTAAAGTACTACACGTAGAAGTAGACCCTTGATAGATTTCCTGCACACTGGCTT
TGCACACGCAGATGGCTTTGGTGTGTTCCCTTTGTTCTCTGTTATGTTTATAACCTGTATATATGTATATTCTTTTGTAAGTAGATTTTATAATAAATGGATCTTTTGAAAAAAAAAAAAAAAAAAAA
AAAAA

hide sequence

RefSeq Acc Id:

XM_039103500 ⟹ XP_038959428

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	16,949,195 - 16,958,218 (+)	NCBI
mRatBN7.2	1	15,129,992 - 15,138,322 (+)	NCBI

RefSeq Acc Id:

XM_063284133 ⟹ XP_063140203

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	16,949,079 - 16,958,218 (+)	NCBI


Protein RefSeqs	NP_001277039	(Get FASTA)	NCBI Sequence Viewer
	XP_038959428	(Get FASTA)	NCBI Sequence Viewer
	XP_063140203	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAI59436	(Get FASTA)	NCBI Sequence Viewer
	B0K035	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000072258
	ENSRNOP00000072258.1

RefSeq Acc Id:

NP_001277039 ⟸ NM_001290110

- UniProtKB:

B0K035 (UniProtKB/Swiss-Prot)

- Sequence:

show sequence

MQRDGTNEQCFLELASPMSFILNILRNMLAYFGVPVDQDLLIFQNKDYGSARSIVRVIGRMLPLEPCRRPRFELTPPANAKEVDDYELAVPSFADVLCVADDGEAGCLRFRHSLWKKAEGKAALFHPS
KLPWDLSSPALSQNRTVADDLPVSEAAIKKIAALEDELTSLRAQIAAIVAMQDLGGGGETGFISLSDGPSMEQVPPSSATARLSVEPDHVPSVVLSPPPLPPPPPPLPPPQFSLQPPSSLPVPPGSAN
TRGIDNLAAEMKKRPSGVKKTDGSHHSESQRVSDVPNMLDVLKDMNKVKLRPVERSPGGRPIQKRRRQSSQWDPVSLISNALKQKFAFQDDSFDSENRSWQGSPFSSPETSRNGSRF

hide sequence

RefSeq Acc Id:	XP_038959428 ⟸ XM_039103500
- Peptide Label:	isoform X1

Ensembl Acc Id:

ENSRNOP00000072352 ⟸ ENSRNOT00000089966

Ensembl Acc Id:

ENSRNOP00000072258 ⟸ ENSRNOT00000079069

Ensembl Acc Id:

ENSRNOP00000071825 ⟸ ENSRNOT00000088025

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-B0K035-F1-model_v2	AlphaFold	B0K035	1-373	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-62194	BioCyc
Ensembl Genes	ENSRNOG00000058050	Ensembl, UniProtKB/Swiss-Prot
	ENSRNOG00000078862	ENTREZGENE
Ensembl Transcript	ENSRNOT00000079069	ENTREZGENE
	ENSRNOT00000079069.2	UniProtKB/Swiss-Prot
InterPro	Mtfr1	UniProtKB/Swiss-Prot
KEGG Report	rno:100911069	UniProtKB/Swiss-Prot
NCBI Gene	LOC100911069	ENTREZGENE
PANTHER	MITOCHONDRIAL FISSION REGULATOR 2	UniProtKB/Swiss-Prot
	PTHR14215	UniProtKB/Swiss-Prot
Pfam	Mito_fiss_reg	UniProtKB/Swiss-Prot
PhenoGen	Mtfr2	PhenoGen
RatGTEx	ENSRNOG00000058050	RatGTEx
	ENSRNOG00000078862	RatGTEx
UniProt	A0A0G2K1G0_RAT	UniProtKB/TrEMBL
	A0A0G2K2S3_RAT	UniProtKB/TrEMBL
	B0K035	ENTREZGENE, UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2015-06-12	Mtfr2	mitochondrial fission regulator 2	LOC100911069	protein FAM54A-like	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2012-07-05	LOC100911069	protein FAM54A-like			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Send us a Message

Imported Disease Annotations - ClinVar