Symbol:
Cript
Name:
CXXC repeat containing interactor of PDZ3 domain
RGD ID:
621545
Description:
Enables PDZ domain binding activity and microtubule binding activity. Involved in cytoplasmic microtubule organization; protein localization to microtubule; and regulation of postsynaptic density organization. Located in dendritic shaft; dendritic spine; and neuronal cell body. Is active in glutamatergic synapse and postsynaptic density, intracellular component. Human ortholog(s) of this gene implicated in Rothmund-Thomson syndrome. Orthologous to human CRIPT (CXXC repeat containing interactor of PDZ3 domain); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,6-dinitrotoluene; 3H-1,2-dithiole-3-thione.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
cysteine-rich interactor of PDZ three; cysteine-rich interactor of PDZ3; cysteine-rich PDZ-binding protein; postsynaptic protein Cript
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
CRIPT (CXXC repeat containing interactor of PDZ3 domain) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Cript (cysteine-rich PDZ-binding protein) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Cript (CXXC repeat containing interactor of PDZ3 domain) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
CRIPT (CXXC repeat containing interactor of PDZ3 domain) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
CRIPT (CXXC repeat containing interactor of PDZ3 domain) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Cript (CXXC repeat containing interactor of PDZ3 domain) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
CRIPT (CXXC repeat containing interactor of PDZ3 domain) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
CRIPT (CXXC repeat containing interactor of PDZ3 domain) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Cript (CXXC repeat containing interactor of PDZ3 domain) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
PRX (periaxin) HGNC
OMA
Alliance orthologs 3
Homo sapiens (human):
CRIPT (CXXC repeat containing interactor of PDZ3 domain)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Cript (cysteine-rich PDZ-binding protein)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
cript (cysteine-rich PDZ-binding protein)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
C36B1.14
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
CG4537
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
cript
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 6 13,334,978 - 13,342,934 (-) NCBI GRCr8 mRatBN7.2 6 7,581,428 - 7,589,384 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 6 7,580,703 - 7,589,399 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 6 7,859,902 - 7,867,890 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 6 8,169,313 - 8,177,303 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 6 7,696,427 - 7,704,417 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 6 10,594,147 - 10,602,103 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 6 10,594,122 - 10,602,085 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 6 20,582,664 - 20,590,620 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 6 10,475,037 - 10,482,993 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 6 10,475,036 - 10,482,992 (+) NCBI Celera 6 7,316,891 - 7,324,847 (-) NCBI Celera Cytogenetic Map 6 q12 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
1.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
3.
CRIPT, a novel postsynaptic protein that binds to the third PDZ domain of PSD-95/SAP90.
Niethammer M, etal., Neuron 1998 Apr;20(4):693-707.
4.
Microtubule binding by CRIPT and its potential role in the synaptic clustering of PSD-95.
Passafaro M, etal., Nat Neurosci. 1999 Dec;2(12):1063-9.
5.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
6.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
7.
Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
8.
Laminar organization of the NMDA receptor complex within the postsynaptic density.
Valtschanoff JG and Weinberg RJ, J Neurosci. 2001 Feb 15;21(4):1211-7.
Cript Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 6 13,334,978 - 13,342,934 (-) NCBI GRCr8 mRatBN7.2 6 7,581,428 - 7,589,384 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 6 7,580,703 - 7,589,399 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 6 7,859,902 - 7,867,890 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 6 8,169,313 - 8,177,303 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 6 7,696,427 - 7,704,417 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 6 10,594,147 - 10,602,103 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 6 10,594,122 - 10,602,085 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 6 20,582,664 - 20,590,620 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 6 10,475,037 - 10,482,993 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 6 10,475,036 - 10,482,992 (+) NCBI Celera 6 7,316,891 - 7,324,847 (-) NCBI Celera Cytogenetic Map 6 q12 NCBI
CRIPT Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 2 46,617,215 - 46,630,176 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 2 46,616,416 - 46,685,037 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 2 46,844,354 - 46,857,315 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 2 46,697,812 - 46,705,690 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 2 46,755,958 - 46,763,834 NCBI Celera 2 46,683,006 - 46,691,562 (+) NCBI Celera Cytogenetic Map 2 p21 NCBI HuRef 2 46,581,752 - 46,590,308 (+) NCBI HuRef CHM1_1 2 46,774,619 - 46,783,172 (+) NCBI CHM1_1 T2T-CHM13v2.0 2 46,622,209 - 46,635,170 (+) NCBI T2T-CHM13v2.0
Cript Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 17 87,332,989 - 87,343,236 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 17 87,332,978 - 87,343,238 (+) Ensembl GRCm39 Ensembl GRCm38 17 87,025,561 - 87,035,808 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 17 87,025,550 - 87,035,810 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 17 87,424,901 - 87,435,148 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 17 86,933,922 - 86,944,136 (+) NCBI MGSCv36 mm8 Celera 17 91,403,072 - 91,413,302 (+) NCBI Celera Cytogenetic Map 17 E4 NCBI cM Map 17 56.9 NCBI
Cript Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955441 13,525,686 - 13,533,458 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955441 13,525,686 - 13,533,458 (+) NCBI ChiLan1.0 ChiLan1.0
CRIPT Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 12 79,765,138 - 79,773,168 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 2A 79,769,117 - 79,777,125 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 2A 46,732,683 - 46,740,589 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 2A 47,663,304 - 47,671,463 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 2A 47,663,304 - 47,671,463 (+) Ensembl panpan1.1 panPan2
CRIPT Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 10 48,840,243 - 48,851,461 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 10 48,839,509 - 48,851,258 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 10 48,694,222 - 48,705,439 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 10 49,711,249 - 49,722,470 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 10 49,710,515 - 49,722,470 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 10 49,419,142 - 49,430,374 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 10 49,709,293 - 49,720,507 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 10 49,892,428 - 49,903,655 (+) NCBI UU_Cfam_GSD_1.0
Cript Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024406292 34,220,855 - 34,230,384 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936508 5,650,057 - 5,658,950 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936508 5,650,057 - 5,658,966 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
CRIPT
CRIPT
Cript
.
Predicted Target Of
Count of predictions: 123 Count of miRNA genes: 94 Interacting mature miRNAs: 109 Transcripts: ENSRNOT00000020534 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
8552962 Pigfal16 Plasma insulin-like growth factor 1 level QTL 16 9.4 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 6 1 41223769 Rat 7411603 Foco13 Food consumption QTL 13 5.5 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 6 1 41223769 Rat 1598843 Cm63 Cardiac mass QTL 63 2.6 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 6 1 39036266 Rat 738024 Sach5 Saccharine consumption QTL 5 3.9 0.00039 consumption behavior trait (VT:0002069) saccharin intake volume to total fluid intake volume ratio (CMO:0001601) 6 1 43394190 Rat 1549905 Stresp10 Stress response QTL 10 6.83 0.0066 stress-related behavior trait (VT:0010451) number of approaches toward negative stimulus before onset of defensive burying response (CMO:0001960) 6 1 27574569 Rat 7411542 Bw127 Body weight QTL 127 5.5 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 6 1 41223769 Rat 2293706 Bmd20 Bone mineral density QTL 20 4.3 0.0002 femur mineral mass (VT:0010011) total volumetric bone mineral density (CMO:0001728) 6 5074497 19988050 Rat 9589048 Scfw3 Subcutaneous fat weight QTL 3 4.57 0.001 subcutaneous adipose mass (VT:1000472) abdominal subcutaneous fat pad weight (CMO:0002069) 6 1 41223769 Rat 1331743 Uae28 Urinary albumin excretion QTL 28 4.5 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 6 1 34235784 Rat 738023 Alc17 Alcohol consumption QTL 17 3.1 0.003 consumption behavior trait (VT:0002069) ethanol drink intake rate to body weight ratio (CMO:0001616) 6 1 27574569 Rat 1354616 Despr12 Despair related QTL 12 0.0012 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 6 1 27574569 Rat 2293709 Bss23 Bone structure and strength QTL 23 5.18 0.0001 femur morphology trait (VT:0000559) femur cross-sectional area (CMO:0001661) 6 1 42487980 Rat 2293650 Bss31 Bone structure and strength QTL 31 5.05 0.0001 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 6 1 42487980 Rat 7411584 Foco4 Food consumption QTL 4 4.3 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 6 1 42838846 Rat 2300176 Bmd51 Bone mineral density QTL 51 11.7 0.0001 femur mineral mass (VT:0010011) bone mineral density (CMO:0001226) 6 1 27574569 Rat 1300128 Rf16 Renal function QTL 16 3.89 renal blood flow trait (VT:2000006) absolute change in renal blood flow rate (CMO:0001168) 6 5074497 34434305 Rat 2301972 Bp325 Blood pressure QTL 325 4.8 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 6 1 72227641 Rat 1300164 Rf15 Renal function QTL 15 3.12 renal blood flow trait (VT:2000006) absolute change in renal blood flow rate (CMO:0001168) 6 5074497 54641141 Rat 2293656 Bss28 Bone structure and strength QTL 28 6.79 0.0001 femur morphology trait (VT:0000559) femur midshaft cortical cross-sectional area (CMO:0001663) 6 1 42487980 Rat 9589129 Insul24 Insulin level QTL 24 19.06 0.001 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 6 1 41223769 Rat 2300190 Bmd52 Bone mineral density QTL 52 11.2 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 6 1 27574569 Rat 1578758 Tcas9 Tongue tumor susceptibility QTL 9 3.29 tongue integrity trait (VT:0010553) number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950) 6 1 37618905 Rat
RH141427
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 6 7,581,554 - 7,581,769 (-) MAPPER mRatBN7.2 Rnor_6.0 6 10,601,762 - 10,601,976 NCBI Rnor6.0 Rnor_5.0 6 20,590,279 - 20,590,493 UniSTS Rnor5.0 RGSC_v3.4 6 10,482,652 - 10,482,866 UniSTS RGSC3.4 Celera 6 7,317,018 - 7,317,232 UniSTS Cytogenetic Map 6 q12 UniSTS
RH132997
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 6 7,586,602 - 7,586,783 (-) MAPPER mRatBN7.2 Rnor_6.0 6 10,596,748 - 10,596,928 NCBI Rnor6.0 Rnor_5.0 6 20,585,265 - 20,585,445 UniSTS Rnor5.0 RGSC_v3.4 6 10,477,638 - 10,477,818 UniSTS RGSC3.4 Celera 6 7,322,066 - 7,322,246 UniSTS Cytogenetic Map 6 q12 UniSTS
RH138667
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 6 7,582,227 - 7,582,373 (-) MAPPER mRatBN7.2 Rnor_6.0 6 10,601,158 - 10,601,303 NCBI Rnor6.0 Rnor_5.0 6 20,589,675 - 20,589,820 UniSTS Rnor5.0 RGSC_v3.4 6 10,482,048 - 10,482,193 UniSTS RGSC3.4 Celera 6 7,317,691 - 7,317,836 UniSTS Cytogenetic Map 6 q12 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000020534 ⟹ ENSRNOP00000020534
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 6 7,580,703 - 7,589,399 (-) Ensembl Rnor_6.0 Ensembl 6 10,594,122 - 10,602,085 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000113445 ⟹ ENSRNOP00000097693
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 6 7,580,703 - 7,587,117 (-) Ensembl
RefSeq Acc Id:
NM_019907 ⟹ NP_063972
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 13,334,978 - 13,342,934 (-) NCBI mRatBN7.2 6 7,581,428 - 7,589,384 (-) NCBI Rnor_6.0 6 10,594,147 - 10,602,103 (+) NCBI Rnor_5.0 6 20,582,664 - 20,590,620 (+) NCBI RGSC_v3.4 6 10,475,037 - 10,482,993 (+) RGD Celera 6 7,316,891 - 7,324,847 (-) RGD
Sequence:
TGATGTATTTTGGCAGCTGCTCCTGCTTTGCGGGTTGAGGGGGACAGGACGACCCGTGGAAGGATGGTGTGTGAAAAGTGTGAAAAGAAACTCGGCAGGGTTATCACTCCAGACACATGGAAGGACGG
hide sequence
RefSeq Acc Id:
NP_063972 ⟸ NM_019907
- UniProtKB:
Q792Q4 (UniProtKB/Swiss-Prot), A6H9E9 (UniProtKB/TrEMBL), A0A8I6AVC2 (UniProtKB/TrEMBL)
- Sequence:
MVCEKCEKKLGRVITPDTWKDGARNTTESGGRKLNENKALTSKKARFDPYGKNKFSTCRICKSSVHQPGSHYCQGCAYKKGICAMCGKKVLDTKNYKQTSV
hide sequence
Ensembl Acc Id:
ENSRNOP00000020534 ⟸ ENSRNOT00000020534
Ensembl Acc Id:
ENSRNOP00000097693 ⟸ ENSRNOT00000113445
RGD ID: 13694389 Promoter ID: EPDNEW_R4914 Type: initiation region Name: Cript_1 Description: CXXC repeat containing interactor of PDZ3 domain SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 6 10,594,140 - 10,594,200 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-02-03
Cript
CXXC repeat containing interactor of PDZ3 domain
Cript
cysteine-rich PDZ-binding protein
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-02-25
Cript
cysteine-rich PDZ-binding protein
Cript
postsynaptic protein Cript
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2005-01-20
Cript
postsynaptic protein Cript
Symbol and Name status set to approved
1299863 APPROVED
2002-08-07
Cript
Symbol and Name status set to provisional
70820 PROVISIONAL
Note Type
Note
Reference
gene_cellular_localization
localized to the postsynaptic density
632510
gene_physical_interaction
binds to the third PDZ domain of PSD-95 via its C terminus
632510
