Symbol:
Zbtb7a
Name:
zinc finger and BTB domain containing 7a
RGD ID:
620946
Description:
Enables DNA-binding transcription factor activity. Involved in regulation of DNA-templated transcription and regulation of osteoclast differentiation. Predicted to be located in cytoplasm and site of double-strand break. Predicted to be part of DNA-dependent protein kinase complex. Predicted to be active in nucleus. Orthologous to human ZBTB7A (zinc finger and BTB domain containing 7A); INTERACTS WITH 2,2',4,4'-Tetrabromodiphenyl ether; 2,3,7,8-tetrachlorodibenzodioxine; 2,4-dinitrotoluene.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
leukemia/lymphoma related factor; leukemia/lymphoma-related factor; Lrf; OCZF; osteoclast-derived zinc finger; Zbtb7; zinc finger and BTB domain-containing protein 7A
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 7 9,211,733 - 9,229,273 (-) NCBI GRCr8 mRatBN7.2 7 8,561,015 - 8,578,243 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 7 8,563,779 - 8,576,539 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 7 11,448,841 - 11,461,603 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 7 13,324,328 - 13,337,091 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 7 11,190,783 - 11,203,558 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 7 11,429,266 - 11,446,119 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 7 11,432,049 - 11,444,786 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 7 11,596,630 - 11,613,467 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 7 10,047,586 - 10,060,456 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 7 10,047,608 - 10,052,982 (-) NCBI Celera 7 6,751,640 - 6,757,036 (-) NCBI Celera Cytogenetic Map 7 q11 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Zbtb7a Rat (1->4)-beta-D-glucan multiple interactions ISO Zbtb7a (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of ZBTB7A mRNA CTD PMID:36331819 Zbtb7a Rat 1,2-dichloroethane decreases expression ISO Zbtb7a (Mus musculus) 6480464 ethylene dichloride results in decreased expression of ZBTB7A mRNA CTD PMID:28960355 Zbtb7a Rat 1,2-dimethylhydrazine multiple interactions ISO Zbtb7a (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of ZBTB7A mRNA CTD PMID:22206623 Zbtb7a Rat 2,2',4,4'-Tetrabromodiphenyl ether decreases expression EXP 6480464 2 more ... CTD PMID:21394737 Zbtb7a Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Zbtb7a (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of ZBTB7A mRNA CTD PMID:21570461 and PMID:26377647 Zbtb7a Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of ZBTB7A mRNA CTD PMID:33387578 Zbtb7a Rat 2,4-dinitrotoluene affects expression EXP 6480464 2 and 4-dinitrotoluene affects the expression of ZBTB7A mRNA CTD PMID:21346803 Zbtb7a Rat 2,6-dinitrotoluene affects expression EXP 6480464 2 and 6-dinitrotoluene affects the expression of ZBTB7A mRNA CTD PMID:21346803 Zbtb7a Rat 2-palmitoylglycerol increases expression ISO ZBTB7A (Homo sapiens) 6480464 2-palmitoylglycerol results in increased expression of ZBTB7A mRNA CTD PMID:37199045 Zbtb7a Rat 3,4-methylenedioxymethamphetamine increases expression ISO Zbtb7a (Mus musculus) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in increased expression of ZBTB7A mRNA CTD PMID:20188158 Zbtb7a Rat 3,4-methylenedioxymethamphetamine decreases expression ISO Zbtb7a (Mus musculus) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in decreased expression of ZBTB7A mRNA CTD PMID:26251327 Zbtb7a Rat 4,4'-sulfonyldiphenol affects expression ISO Zbtb7a (Mus musculus) 6480464 bisphenol S affects the expression of ZBTB7A mRNA CTD PMID:39298647 Zbtb7a Rat 4,4'-sulfonyldiphenol decreases methylation ISO Zbtb7a (Mus musculus) 6480464 bisphenol S results in decreased methylation of ZBTB7A exon CTD PMID:33297965 Zbtb7a Rat 5-fluorouracil affects response to substance ISO ZBTB7A (Homo sapiens) 6480464 ZBTB7A protein affects the susceptibility to Fluorouracil CTD PMID:15352031 Zbtb7a Rat 5-fluorouracil decreases expression ISO ZBTB7A (Homo sapiens) 6480464 Fluorouracil results in decreased expression of ZBTB7A protein CTD PMID:15352031 Zbtb7a Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of ZBTB7A mRNA CTD PMID:24780913 Zbtb7a Rat aflatoxin B1 increases methylation ISO ZBTB7A (Homo sapiens) 6480464 Aflatoxin B1 results in increased methylation of ZBTB7A intron CTD PMID:30157460 Zbtb7a Rat Aflatoxin B2 alpha decreases methylation ISO ZBTB7A (Homo sapiens) 6480464 aflatoxin B2 results in decreased methylation of ZBTB7A intron CTD PMID:30157460 Zbtb7a Rat all-trans-retinoic acid increases expression ISO ZBTB7A (Homo sapiens) 6480464 Tretinoin results in increased expression of ZBTB7A mRNA CTD PMID:33167477 Zbtb7a Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of ZBTB7A mRNA CTD PMID:16483693 Zbtb7a Rat arsane affects methylation ISO ZBTB7A (Homo sapiens) 6480464 Arsenic affects the methylation of ZBTB7A gene CTD PMID:25304211 Zbtb7a Rat arsane multiple interactions ISO ZBTB7A (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of ZBTB7A mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of ZBTB7A mRNA CTD PMID:39836092 Zbtb7a Rat arsenic atom affects methylation ISO ZBTB7A (Homo sapiens) 6480464 Arsenic affects the methylation of ZBTB7A gene CTD PMID:25304211 Zbtb7a Rat arsenic atom multiple interactions ISO ZBTB7A (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of ZBTB7A mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of ZBTB7A mRNA CTD PMID:39836092 Zbtb7a Rat atrazine increases expression ISO ZBTB7A (Homo sapiens) 6480464 Atrazine results in increased expression of ZBTB7A mRNA CTD PMID:22378314 Zbtb7a Rat benzo[a]pyrene decreases expression ISO Zbtb7a (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of ZBTB7A mRNA CTD PMID:22228805 and PMID:27195522 Zbtb7a Rat benzo[a]pyrene increases methylation ISO ZBTB7A (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of ZBTB7A 5' UTR CTD PMID:27901495 Zbtb7a Rat benzo[e]pyrene increases methylation ISO ZBTB7A (Homo sapiens) 6480464 benzo(e)pyrene results in increased methylation of ZBTB7A intron CTD PMID:30157460 Zbtb7a Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of ZBTB7A mRNA CTD PMID:25181051 Zbtb7a Rat bisphenol A decreases expression ISO ZBTB7A (Homo sapiens) 6480464 bisphenol A results in decreased expression of ZBTB7A mRNA CTD PMID:36232920 Zbtb7a Rat bisphenol A decreases methylation ISO ZBTB7A (Homo sapiens) 6480464 bisphenol A results in decreased methylation of ZBTB7A gene CTD PMID:31601247 Zbtb7a Rat bisphenol A multiple interactions ISO ZBTB7A (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in increased methylation of ZBTB7A gene CTD PMID:31601247 Zbtb7a Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of ZBTB7A mRNA CTD PMID:34947998 Zbtb7a Rat butanal decreases expression ISO ZBTB7A (Homo sapiens) 6480464 butyraldehyde results in decreased expression of ZBTB7A mRNA CTD PMID:26079696 Zbtb7a Rat cadmium atom multiple interactions ISO ZBTB7A (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of ZBTB7A mRNA CTD PMID:35301059 Zbtb7a Rat cadmium dichloride increases expression ISO ZBTB7A (Homo sapiens) 6480464 Cadmium Chloride results in increased expression of ZBTB7A mRNA CTD PMID:38382870 Zbtb7a Rat cadmium dichloride multiple interactions ISO ZBTB7A (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of ZBTB7A mRNA CTD PMID:35301059 Zbtb7a Rat cadmium dichloride decreases expression ISO ZBTB7A (Homo sapiens) 6480464 Cadmium Chloride results in decreased expression of ZBTB7A mRNA CTD PMID:38568856 Zbtb7a Rat caffeine increases phosphorylation ISO ZBTB7A (Homo sapiens) 6480464 Caffeine results in increased phosphorylation of ZBTB7A protein CTD PMID:35688186 Zbtb7a Rat carbon nanotube decreases expression ISO Zbtb7a (Mus musculus) 6480464 Nanotubes and Carbon results in decreased expression of ZBTB7A mRNA CTD PMID:25554681 Zbtb7a Rat cisplatin decreases expression ISO ZBTB7A (Homo sapiens) 6480464 Cisplatin results in decreased expression of ZBTB7A mRNA CTD PMID:27594783 Zbtb7a Rat copper(II) chloride increases expression ISO ZBTB7A (Homo sapiens) 6480464 cupric chloride results in increased expression of ZBTB7A mRNA CTD PMID:38568856 Zbtb7a Rat copper(II) sulfate increases expression ISO ZBTB7A (Homo sapiens) 6480464 Copper Sulfate results in increased expression of ZBTB7A mRNA CTD PMID:19549813 Zbtb7a Rat coumarin decreases phosphorylation ISO ZBTB7A (Homo sapiens) 6480464 coumarin results in decreased phosphorylation of ZBTB7A protein CTD PMID:35688186 Zbtb7a Rat cyclosporin A increases expression ISO ZBTB7A (Homo sapiens) 6480464 Cyclosporine results in increased expression of ZBTB7A mRNA CTD PMID:25562108 Zbtb7a Rat dexamethasone increases expression ISO Zbtb7a (Mus musculus) 6480464 Dexamethasone results in increased expression of ZBTB7A mRNA CTD PMID:22733784 Zbtb7a Rat dicrotophos increases expression ISO ZBTB7A (Homo sapiens) 6480464 dicrotophos results in increased expression of ZBTB7A mRNA CTD PMID:28302478 Zbtb7a Rat doxorubicin decreases expression ISO ZBTB7A (Homo sapiens) 6480464 Doxorubicin results in decreased expression of ZBTB7A mRNA CTD PMID:29803840 Zbtb7a Rat epoxiconazole decreases expression ISO Zbtb7a (Mus musculus) 6480464 epoxiconazole results in decreased expression of ZBTB7A mRNA CTD PMID:35436446 Zbtb7a Rat ethanol affects splicing ISO Zbtb7a (Mus musculus) 6480464 Ethanol affects the splicing of ZBTB7A mRNA CTD PMID:30319688 Zbtb7a Rat fenthion increases expression ISO Zbtb7a (Mus musculus) 6480464 Fenthion results in increased expression of ZBTB7A mRNA CTD PMID:34813904 Zbtb7a Rat folic acid multiple interactions ISO Zbtb7a (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of ZBTB7A mRNA CTD PMID:22206623 Zbtb7a Rat FR900359 increases phosphorylation ISO ZBTB7A (Homo sapiens) 6480464 FR900359 results in increased phosphorylation of ZBTB7A protein CTD PMID:37730182 Zbtb7a Rat fulvestrant multiple interactions ISO ZBTB7A (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in increased methylation of ZBTB7A gene CTD PMID:31601247 Zbtb7a Rat genistein increases expression EXP 6480464 Genistein results in increased expression of ZBTB7A protein CTD PMID:24552547 Zbtb7a Rat hydrogen cyanide decreases expression ISO Zbtb7a (Mus musculus) 6480464 Hydrogen Cyanide results in decreased expression of ZBTB7A mRNA CTD PMID:33914522 Zbtb7a Rat leflunomide decreases expression ISO ZBTB7A (Homo sapiens) 6480464 leflunomide results in decreased expression of ZBTB7A mRNA CTD PMID:28988120 Zbtb7a Rat manganese atom multiple interactions ISO ZBTB7A (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of ZBTB7A mRNA CTD PMID:39836092 Zbtb7a Rat manganese(0) multiple interactions ISO ZBTB7A (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of ZBTB7A mRNA CTD PMID:39836092 Zbtb7a Rat manganese(II) chloride multiple interactions ISO ZBTB7A (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of ZBTB7A mRNA CTD PMID:39836092 Zbtb7a Rat methapyrilene increases methylation ISO ZBTB7A (Homo sapiens) 6480464 Methapyrilene results in increased methylation of ZBTB7A intron CTD PMID:30157460 Zbtb7a Rat methidathion increases expression ISO Zbtb7a (Mus musculus) 6480464 methidathion results in increased expression of ZBTB7A mRNA CTD PMID:34813904 Zbtb7a Rat nitrates multiple interactions ISO Zbtb7a (Mus musculus) 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of ZBTB7A mRNA CTD PMID:35964746 Zbtb7a Rat ozone multiple interactions ISO Zbtb7a (Mus musculus) 6480464 [Air Pollutants results in increased abundance of Ozone] which results in increased expression of ZBTB7A mRNA CTD PMID:27106289 Zbtb7a Rat ozone multiple interactions ISO ZBTB7A (Homo sapiens) 6480464 [Air Pollutants results in increased abundance of Ozone] which affects the expression of ZBTB7A mRNA CTD PMID:35430440 Zbtb7a Rat paracetamol decreases expression ISO ZBTB7A (Homo sapiens) 6480464 Acetaminophen results in decreased expression of ZBTB7A mRNA CTD PMID:21420995 Zbtb7a Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Zbtb7a (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of ZBTB7A mRNA CTD PMID:36331819 Zbtb7a Rat phenobarbital affects expression ISO Zbtb7a (Mus musculus) 6480464 Phenobarbital affects the expression of ZBTB7A mRNA CTD PMID:23091169 Zbtb7a Rat potassium cyanide increases expression ISO Zbtb7a (Mus musculus) 6480464 Potassium Cyanide results in increased expression of ZBTB7A mRNA CTD PMID:33914522 Zbtb7a Rat resveratrol decreases expression ISO ZBTB7A (Homo sapiens) 6480464 resveratrol results in decreased expression of ZBTB7A mRNA and resveratrol results in decreased expression of ZBTB7A protein CTD PMID:25875864 Zbtb7a Rat resveratrol multiple interactions ISO ZBTB7A (Homo sapiens) 6480464 EP300 protein inhibits the reaction [resveratrol results in decreased expression of ZBTB7A mRNA] more ... CTD PMID:25875864 Zbtb7a Rat resveratrol decreases response to substance ISO ZBTB7A (Homo sapiens) 6480464 ZBTB7A protein results in decreased susceptibility to resveratrol CTD PMID:25875864 Zbtb7a Rat sodium arsenite increases expression ISO ZBTB7A (Homo sapiens) 6480464 sodium arsenite results in increased expression of ZBTB7A mRNA CTD PMID:38568856 Zbtb7a Rat sodium arsenite multiple interactions ISO ZBTB7A (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of ZBTB7A mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of ZBTB7A mRNA CTD PMID:39836092 Zbtb7a Rat succimer multiple interactions ISO Zbtb7a (Mus musculus) 6480464 [Succimer co-treated with Magnetite Nanoparticles] results in decreased expression of ZBTB7A mRNA CTD PMID:26378955 Zbtb7a Rat temozolomide multiple interactions ISO ZBTB7A (Homo sapiens) 6480464 temozolomide promotes the reaction [resveratrol results in decreased expression of ZBTB7A protein] CTD PMID:25875864 Zbtb7a Rat thioacetamide decreases expression EXP 6480464 Thioacetamide results in decreased expression of ZBTB7A mRNA CTD PMID:34492290 Zbtb7a Rat thiram increases expression ISO ZBTB7A (Homo sapiens) 6480464 Thiram results in increased expression of ZBTB7A mRNA CTD PMID:38568856 Zbtb7a Rat titanium dioxide decreases methylation ISO Zbtb7a (Mus musculus) 6480464 titanium dioxide results in decreased methylation of ZBTB7A gene and titanium dioxide results in decreased methylation of ZBTB7A promoter CTD PMID:35295148 Zbtb7a Rat titanium dioxide increases methylation ISO Zbtb7a (Mus musculus) 6480464 titanium dioxide results in increased methylation of ZBTB7A gene and titanium dioxide results in increased methylation of ZBTB7A promoter CTD PMID:35295148 Zbtb7a Rat tungsten decreases expression ISO Zbtb7a (Mus musculus) 6480464 Tungsten results in decreased expression of ZBTB7A mRNA CTD PMID:30912803 Zbtb7a Rat valproic acid increases methylation ISO ZBTB7A (Homo sapiens) 6480464 Valproic Acid results in increased methylation of ZBTB7A gene CTD PMID:29154799
(1->4)-beta-D-glucan (ISO) 1,2-dichloroethane (ISO) 1,2-dimethylhydrazine (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (EXP) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-dinitrotoluene (EXP) 2,6-dinitrotoluene (EXP) 2-palmitoylglycerol (ISO) 3,4-methylenedioxymethamphetamine (ISO) 4,4'-sulfonyldiphenol (ISO) 5-fluorouracil (ISO) 6-propyl-2-thiouracil (EXP) aflatoxin B1 (ISO) Aflatoxin B2 alpha (ISO) all-trans-retinoic acid (ISO) ammonium chloride (EXP) arsane (ISO) arsenic atom (ISO) atrazine (ISO) benzo[a]pyrene (ISO) benzo[e]pyrene (ISO) bisphenol A (EXP,ISO) butanal (ISO) cadmium atom (ISO) cadmium dichloride (ISO) caffeine (ISO) carbon nanotube (ISO) cisplatin (ISO) copper(II) chloride (ISO) copper(II) sulfate (ISO) coumarin (ISO) cyclosporin A (ISO) dexamethasone (ISO) dicrotophos (ISO) doxorubicin (ISO) epoxiconazole (ISO) ethanol (ISO) fenthion (ISO) folic acid (ISO) FR900359 (ISO) fulvestrant (ISO) genistein (EXP) hydrogen cyanide (ISO) leflunomide (ISO) manganese atom (ISO) manganese(0) (ISO) manganese(II) chloride (ISO) methapyrilene (ISO) methidathion (ISO) nitrates (ISO) ozone (ISO) paracetamol (ISO) perfluorooctane-1-sulfonic acid (ISO) phenobarbital (ISO) potassium cyanide (ISO) resveratrol (ISO) sodium arsenite (ISO) succimer (ISO) temozolomide (ISO) thioacetamide (EXP) thiram (ISO) titanium dioxide (ISO) tungsten (ISO) valproic acid (ISO)
Biological Process
B cell differentiation (IEA,ISO,ISS) cell differentiation (IEA) chromatin organization (IEA,ISO) chromatin remodeling (IEA,ISO,ISS) DNA-templated transcription (IEA,ISO) double-strand break repair via classical nonhomologous end joining (IEA,ISO,ISS) erythrocyte maturation (IEA,ISO,ISS) fat cell differentiation (IEA,ISO,ISS) negative regulation of androgen receptor signaling pathway (IEA,ISO,ISS) negative regulation of DNA-templated transcription (IEA,ISO,ISS) negative regulation of Notch signaling pathway (IEA,ISO,ISS) negative regulation of transcription by RNA polymerase II (IEA,ISO,ISS) negative regulation of transforming growth factor beta receptor signaling pathway (IEA,ISO,ISS) positive regulation of NF-kappaB transcription factor activity (ISO,ISS) protein localization to nucleus (IEA,ISO) regulation of alternative mRNA splicing, via spliceosome (IEA,ISO,ISS) regulation of apoptotic process (IEA,ISO,ISS) regulation of DNA-binding transcription factor activity (ISO,ISS) regulation of DNA-templated transcription (IDA) regulation of glycolytic process (IEA,ISO,ISS) regulation of osteoclast differentiation (IDA) regulation of transcription by RNA polymerase II (IBA,IEA,ISO)
Molecular Function
DNA binding (IEA,ISO,ISS) DNA-binding transcription factor activity (IDA,IEA,ISO) DNA-binding transcription factor activity, RNA polymerase II-specific (IBA) DNA-binding transcription factor binding (IEA,ISO) DNA-binding transcription repressor activity, RNA polymerase II-specific (IEA,ISO) histone acetyltransferase binding (IEA,ISO,ISS) metal ion binding (IEA) nuclear androgen receptor binding (IEA,ISO,ISS) protein binding (ISO) RNA polymerase II cis-regulatory region sequence-specific DNA binding (IBA,IEA,ISO) sequence-specific DNA binding (IEA,ISO) sequence-specific double-stranded DNA binding (IEA,ISO) SMAD binding (IEA,ISO,ISS) transcription corepressor binding (IEA,ISO,ISS) zinc ion binding (IEA)
1.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.
Osteoclast-derived zinc finger (OCZF) protein with POZ domain, a possible transcriptional repressor, is involved in osteoclastogenesis.
Kukita A, etal., Blood 1999 Sep 15;94(6):1987-97.
3.
Leukemia/lymphoma-related factor, a POZ domain-containing transcriptional repressor, interacts with histone deacetylase-1 and inhibits cartilage oligomeric matrix protein gene expression and chondrogenesis.
Liu CJ, etal., J Biol Chem. 2004 Nov 5;279(45):47081-91. Epub 2004 Aug 26.
4.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
5.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
6.
GOA pipeline
RGD automated data pipeline
7.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
8.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
Zbtb7a Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 7 9,211,733 - 9,229,273 (-) NCBI GRCr8 mRatBN7.2 7 8,561,015 - 8,578,243 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 7 8,563,779 - 8,576,539 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 7 11,448,841 - 11,461,603 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 7 13,324,328 - 13,337,091 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 7 11,190,783 - 11,203,558 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 7 11,429,266 - 11,446,119 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 7 11,432,049 - 11,444,786 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 7 11,596,630 - 11,613,467 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 7 10,047,586 - 10,060,456 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 7 10,047,608 - 10,052,982 (-) NCBI Celera 7 6,751,640 - 6,757,036 (-) NCBI Celera Cytogenetic Map 7 q11 NCBI
ZBTB7A Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 19 4,043,303 - 4,066,899 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 19 4,043,303 - 4,066,899 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 19 4,043,301 - 4,066,897 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 19 3,996,216 - 4,017,816 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 19 3,996,216 - 4,017,816 NCBI Celera 19 3,984,710 - 4,006,260 (-) NCBI Celera Cytogenetic Map 19 p13.3 NCBI HuRef 19 3,809,524 - 3,824,110 (-) NCBI HuRef CHM1_1 19 4,044,801 - 4,066,422 (-) NCBI CHM1_1 T2T-CHM13v2.0 19 4,026,415 - 4,050,025 (-) NCBI T2T-CHM13v2.0
Zbtb7a Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 10 80,971,113 - 80,988,056 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 10 80,971,054 - 80,988,829 (+) Ensembl GRCm39 Ensembl GRCm38 10 81,135,225 - 81,152,222 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 10 81,135,220 - 81,152,995 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 10 80,599,016 - 80,614,402 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 10 80,539,400 - 80,554,393 (+) NCBI MGSCv36 mm8 Celera 10 82,156,627 - 82,172,013 (+) NCBI Celera Cytogenetic Map 10 C1 NCBI cM Map 10 39.72 NCBI
Zbtb7a Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955495 4,740,901 - 4,753,992 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955495 4,747,905 - 4,754,066 (+) NCBI ChiLan1.0 ChiLan1.0
ZBTB7A Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 20 8,440,492 - 8,466,499 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 19 7,670,621 - 7,694,593 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 19 3,066,554 - 3,090,285 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 19 4,013,208 - 4,037,630 (-) NCBI panpan1.1 PanPan1.1 panPan2
ZBTB7A Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 20 55,517,531 - 55,527,071 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 20 55,505,916 - 55,523,736 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 20 55,233,807 - 55,252,980 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 20 56,169,484 - 56,187,224 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 20 56,166,283 - 56,182,676 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 20 55,224,406 - 55,243,571 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 20 55,705,817 - 55,724,966 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 20 55,904,666 - 55,923,869 (+) NCBI UU_Cfam_GSD_1.0
Zbtb7a Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405118 215,512,758 - 215,525,208 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936588 2,311,727 - 2,321,372 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936588 2,310,975 - 2,321,790 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
ZBTB7A Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 2 74,681,193 - 74,694,869 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 2 74,678,293 - 74,699,347 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 2 75,223,154 - 75,243,600 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
ZBTB7A Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 6 3,802,171 - 3,824,552 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 6 3,801,046 - 3,812,884 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666081 4,418,198 - 4,441,462 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Zbtb7a
.
Predicted Target Of
Count of predictions: 117 Count of miRNA genes: 81 Interacting mature miRNAs: 94 Transcripts: ENSRNOT00000027323 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
61410 Bw19 Body weight QTL 19 6.2 0.001 body mass (VT:0001259) body weight (CMO:0000012) 7 1 44782185 Rat 1300176 Hrtrt10 Heart rate QTL 10 3.19 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 7 664270 26029351 Rat 9590102 Sffal5 Serum free fatty acids level QTL 5 8.62 0.001 blood free fatty acid amount (VT:0001553) plasma free fatty acids level (CMO:0000546) 7 5329019 50329019 Rat 631503 Bp102 Blood pressure QTL 102 1.9 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 7 1 44822433 Rat 634336 Anxrr17 Anxiety related response QTL 17 3.66 locomotor behavior trait (VT:0001392) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 7 924703 115097879 Rat 10755438 Coatc9 Coat color QTL 9 0 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 7 3529280 48529280 Rat 9590142 Scort5 Serum corticosterone level QTL 5 24.4 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 7 1 31962314 Rat 10059592 Kidm45 Kidney mass QTL 45 3.95 0.025 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 7 7573985 52573985 Rat 2317047 Wbc4 White blood cell count QTL 4 0.01 leukocyte quantity (VT:0000217) white blood cell count (CMO:0000027) 7 1 35342956 Rat 10755440 Coatc10 Coat color QTL 10 0 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 7 7496499 52496499 Rat 2298550 Neuinf6 Neuroinflammation QTL 6 3.3 nervous system integrity trait (VT:0010566) spinal cord RT1-B protein level (CMO:0002132) 7 1 27829089 Rat 724560 Plsm3 Polydactyly-luxate syndrome (PLS) morphotypes QTL 3 0.0003 tibia length (VT:0004357) tibia length (CMO:0000450) 7 1 34000259 Rat 7411566 Bw136 Body weight QTL 136 10.4 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 7 1 31962314 Rat
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000027323 ⟹ ENSRNOP00000027323
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 8,563,799 - 8,576,539 (-) Ensembl Rnor_6.0 Ensembl 7 11,432,049 - 11,444,786 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000082126 ⟹ ENSRNOP00000073998
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 8,563,779 - 8,575,536 (-) Ensembl Rnor_6.0 Ensembl 7 11,432,049 - 11,443,357 (-) Ensembl
RefSeq Acc Id:
NM_054002 ⟹ NP_446454
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 9,214,493 - 9,227,252 (-) NCBI mRatBN7.2 7 8,563,776 - 8,576,539 (-) NCBI Rnor_6.0 7 11,432,026 - 11,444,786 (-) NCBI Rnor_5.0 7 11,596,630 - 11,613,467 (-) NCBI RGSC_v3.4 7 10,047,586 - 10,060,456 (-) RGD Celera 7 6,751,640 - 6,757,036 (-) RGD
Sequence:
CGGCACGAGCCCGCCCGAGCGAGGTCCGCGCCGCGGCTGCCCCGATCGCGCGTCCTCCGGGCCCGGGTCCCCGCGAGGTAAGCTGCCTGGGCTGAAGGGGAGCCCTCTCCCGGAGAGGTGTCGCGGAA
hide sequence
RefSeq Acc Id:
XM_006240836 ⟹ XP_006240898
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 9,211,733 - 9,226,570 (-) NCBI mRatBN7.2 7 8,561,015 - 8,575,859 (-) NCBI Rnor_6.0 7 11,429,266 - 11,444,082 (-) NCBI Rnor_5.0 7 11,596,630 - 11,613,467 (-) NCBI
Sequence:
GGTGGAGTGTGGAGTGTCTGGGAGGCGGACGCGTCTTCGCGGTTCTCCTGGGCGCTGTAGTTCT
hide sequence
RefSeq Acc Id:
XM_006240837 ⟹ XP_006240899
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 9,211,733 - 9,228,134 (-) NCBI mRatBN7.2 7 8,561,015 - 8,576,978 (-) NCBI Rnor_6.0 7 11,429,266 - 11,445,233 (-) NCBI Rnor_5.0 7 11,596,630 - 11,613,467 (-) NCBI
Sequence:
GGCCGGGGCTGTTTATCTGCGGCCCCCACCCCCTGCACCCGAGGGGCCCCTCTTGCCCGCCCCC
hide sequence
RefSeq Acc Id:
XM_006240838 ⟹ XP_006240900
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 9,211,733 - 9,229,273 (-) NCBI mRatBN7.2 7 8,561,015 - 8,578,243 (-) NCBI Rnor_6.0 7 11,429,266 - 11,446,119 (-) NCBI Rnor_5.0 7 11,596,630 - 11,613,467 (-) NCBI
Sequence:
AAGGAAAACAAAAGCCGTTGGGTTGCTCCGCACTTTCCCACTCCCCACCTCCGTCCTGCCCGGC
hide sequence
RefSeq Acc Id:
XM_063262898 ⟹ XP_063118968
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 9,211,733 - 9,226,898 (-) NCBI
RefSeq Acc Id:
NP_446454 ⟸ NM_054002
- UniProtKB:
Q9QZ48 (UniProtKB/Swiss-Prot), G3V8P6 (UniProtKB/TrEMBL), A6K8C0 (UniProtKB/TrEMBL)
- Sequence:
MAGGVDGPIGIPFPDHSSDILSGLNEQRTQGLLCDVVILVEGREFPTHRSVLAACSQYFKKLFTSGAVVDQQNVYEIDFVSAEALTALMDFAYTATLTVSTANVGDILSAARLLEIPAVSRVCTDLLE
hide sequence
RefSeq Acc Id:
XP_006240900 ⟸ XM_006240838
- Peptide Label:
isoform X2
- UniProtKB:
Q9QZ48 (UniProtKB/Swiss-Prot), G3V8P6 (UniProtKB/TrEMBL), A6K8C0 (UniProtKB/TrEMBL)
- Sequence:
MAGGVDGPIGIPFPDHSSDILSGLNEQRTQGLLCDVVILVEGREFPTHRSVLAACSQYFKKLFT
hide sequence
RefSeq Acc Id:
XP_006240899 ⟸ XM_006240837
- Peptide Label:
isoform X2
- UniProtKB:
Q9QZ48 (UniProtKB/Swiss-Prot), G3V8P6 (UniProtKB/TrEMBL), A6K8C0 (UniProtKB/TrEMBL)
- Sequence:
MAGGVDGPIGIPFPDHSSDILSGLNEQRTQGLLCDVVILVEGREFPTHRSVLAACSQYFKKLFTSGAVVDQQNVYEIDFVSAEALTALMDFAYTATLTVSTANVGDILSAARLLEIPAVSRVCTDLLE
hide sequence
RefSeq Acc Id:
XP_006240898 ⟸ XM_006240836
- Peptide Label:
isoform X1
- UniProtKB:
Q9QZ48 (UniProtKB/Swiss-Prot), A0A0G2K6Z3 (UniProtKB/TrEMBL)
- Sequence:
MRGLARAGPGAGEVTGGPRSGVICIALPPARVGIGRAAAEGGAGPGSASPAGARSHQPAAAIVP
hide sequence
Ensembl Acc Id:
ENSRNOP00000073998 ⟸ ENSRNOT00000082126
Ensembl Acc Id:
ENSRNOP00000027323 ⟸ ENSRNOT00000027323
RefSeq Acc Id:
XP_063118968 ⟸ XM_063262898
- Peptide Label:
isoform X2
- UniProtKB:
Q9QZ48 (UniProtKB/Swiss-Prot), A6K8C0 (UniProtKB/TrEMBL), G3V8P6 (UniProtKB/TrEMBL)
RGD ID: 13694997 Promoter ID: EPDNEW_R5512 Type: single initiation site Name: Zbtb7a_2 Description: zinc finger and BTB domain containing 7a SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_R5513 Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 7 11,443,373 - 11,443,433 EPDNEW
RGD ID: 13694988 Promoter ID: EPDNEW_R5513 Type: initiation region Name: Zbtb7a_1 Description: zinc finger and BTB domain containing 7a SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_R5512 Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 7 11,444,798 - 11,444,858 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2005-11-17
Zbtb7a
zinc finger and BTB domain containing 7a
Symbol and Name updated
1299863 APPROVED
2004-09-10
Zbtb7
leukemia/lymphoma related factor
Lrf
Symbol and Name updated
1299863 APPROVED
2002-08-07
Lrf
leukemia/lymphoma related factor
Symbol and Name status set to provisional
70820 PROVISIONAL
Note Type
Note
Reference
gene_domains
contains an N-terminal POZ domain and C-terminal Kruppel-like zinc fingers
633299
gene_expression
expressed in osteoclasts and kidney cells
633299
