Symbol:
Mtnr1a
Name:
melatonin receptor 1A
RGD ID:
620797
Description:
Predicted to enable hormone binding activity and melatonin receptor activity. Involved in camera-type eye development; circadian rhythm; and negative regulation of insulin secretion. Located in neuronal cell body. Biomarker of type 2 diabetes mellitus. Orthologous to human MTNR1A (melatonin receptor 1A); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,3,7,8-Tetrachlorodibenzofuran; 6-propyl-2-thiouracil.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
mel-1A-R; mel1a melatonin receptor; mel1a receptor; melatonin receptor type 1A
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 16 53,876,964 - 53,896,421 (-) NCBI GRCr8 mRatBN7.2 16 47,144,461 - 47,163,919 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 16 47,144,461 - 47,163,919 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 16 52,537,231 - 52,556,697 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 16 55,914,702 - 55,934,153 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 16 51,176,623 - 51,196,091 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 16 50,339,358 - 50,358,809 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 16 50,339,358 - 50,358,809 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 16 50,060,173 - 50,079,905 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 16 50,439,407 - 50,458,585 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 16 50,440,049 - 50,458,436 (-) NCBI Celera 16 45,133,125 - 45,152,577 (-) NCBI Celera Cytogenetic Map 16 q11 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Mtnr1a Rat 1,2-dichloroethane affects expression ISO Mtnr1a (Mus musculus) 6480464 ethylene dichloride affects the expression of MTNR1A mRNA CTD PMID:28960355 Mtnr1a Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Mtnr1a (Mus musculus) 6480464 [TIPARP gene mutant form results in increased susceptibility to Tetrachlorodibenzodioxin] which results in increased expression of MTNR1A mRNA CTD PMID:25975270 Mtnr1a Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of MTNR1A mRNA CTD PMID:32109520 Mtnr1a Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Mtnr1a (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of MTNR1A mRNA CTD PMID:28922406 Mtnr1a Rat 2,3,7,8-Tetrachlorodibenzofuran decreases expression EXP 6480464 2 more ... CTD PMID:32109520 Mtnr1a Rat 4',5,7-trihydroxy-3'-methoxyflavone affects binding ISO MTNR1A (Homo sapiens) 6480464 chrysoeriol binds to MTNR1A protein CTD PMID:20399199 Mtnr1a Rat 4,4'-sulfonyldiphenol increases methylation ISO Mtnr1a (Mus musculus) 6480464 bisphenol S results in increased methylation of MTNR1A exon CTD PMID:33297965 Mtnr1a Rat 4,4'-sulfonyldiphenol decreases methylation ISO MTNR1A (Homo sapiens) 6480464 bisphenol S results in decreased methylation of MTNR1A gene CTD PMID:31601247 Mtnr1a Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of MTNR1A mRNA CTD PMID:24780913 Mtnr1a Rat acenaphthenes affects binding ISO MTNR1A (Homo sapiens) 6480464 Acenaphthenes analog binds to MTNR1A protein CTD PMID:11063602 Mtnr1a Rat acrylamide increases expression ISO Mtnr1a (Mus musculus) 6480464 Acrylamide results in increased expression of MTNR1A mRNA CTD PMID:30807115 Mtnr1a Rat agomelatine multiple interactions ISO MTNR1A (Homo sapiens) 6480464 agomelatine analog binds to and results in increased activity of MTNR1A protein CTD PMID:22301214 Mtnr1a Rat agomelatine affects binding ISO MTNR1A (Homo sapiens) 6480464 agomelatine binds to MTNR1A protein CTD PMID:11063602 and PMID:22301214 Mtnr1a Rat alcohol multiple interactions EXP 6480464 Acetaminophen inhibits the reaction [Alcohols results in decreased expression of MTNR1A mRNA] CTD PMID:36572547 Mtnr1a Rat alcohol decreases expression EXP 6480464 Alcohols results in decreased expression of MTNR1A mRNA CTD PMID:36572547 Mtnr1a Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of MTNR1A mRNA CTD PMID:16483693 Mtnr1a Rat Azoxymethane multiple interactions ISO Mtnr1a (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of MTNR1A mRNA CTD PMID:29950665 Mtnr1a Rat benzo[a]pyrene increases methylation ISO MTNR1A (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of MTNR1A promoter CTD PMID:27901495 Mtnr1a Rat benzo[a]pyrene multiple interactions EXP 6480464 Benzo(a)pyrene results in decreased expression of and affects the localization of MTNR1A protein and ramelteon inhibits the reaction [Benzo(a)pyrene results in decreased expression of and affects the localization of MTNR1A protein] CTD PMID:35940284 Mtnr1a Rat benzo[a]pyrene diol epoxide I multiple interactions ISO MTNR1A (Homo sapiens) 6480464 7 more ... CTD PMID:35940284 Mtnr1a Rat bis(2-ethylhexyl) phthalate decreases expression ISO Mtnr1a (Mus musculus) 6480464 Diethylhexyl Phthalate results in decreased expression of MTNR1A mRNA CTD PMID:34319233 Mtnr1a Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of MTNR1A mRNA CTD PMID:25181051 Mtnr1a Rat bisphenol A decreases expression ISO Mtnr1a (Mus musculus) 6480464 bisphenol A results in decreased expression of MTNR1A protein CTD PMID:38440074 and PMID:38538260 Mtnr1a Rat bisphenol A multiple interactions ISO Mtnr1a (Mus musculus) 6480464 Melatonin inhibits the reaction [bisphenol A results in decreased expression of MTNR1A protein] CTD PMID:38440074 and PMID:38538260 Mtnr1a Rat bisphenol A multiple interactions ISO MTNR1A (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in increased methylation of MTNR1A gene CTD PMID:31601247 Mtnr1a Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of MTNR1A mRNA CTD PMID:34947998 Mtnr1a Rat cadmium dichloride increases expression ISO MTNR1A (Homo sapiens) 6480464 Cadmium Chloride results in increased expression of MTNR1A mRNA CTD PMID:12160620 Mtnr1a Rat carbaryl affects binding ISO MTNR1A (Homo sapiens) 6480464 Carbaryl binds to MTNR1A protein CTD PMID:28027439 Mtnr1a Rat carbaryl multiple interactions ISO MTNR1A (Homo sapiens) 6480464 Carbaryl inhibits the reaction [Melatonin binds to MTNR1A protein] CTD PMID:28027439 Mtnr1a Rat carbofuran affects binding ISO MTNR1A (Homo sapiens) 6480464 Carbofuran binds to MTNR1A protein CTD PMID:28027439 Mtnr1a Rat carbofuran multiple interactions ISO MTNR1A (Homo sapiens) 6480464 Carbofuran inhibits the reaction [Melatonin binds to MTNR1A protein] CTD PMID:28027439 Mtnr1a Rat chlorpyrifos increases expression ISO Mtnr1a (Mus musculus) 6480464 Chlorpyrifos results in increased expression of MTNR1A mRNA CTD PMID:32715474 Mtnr1a Rat dextran sulfate multiple interactions ISO Mtnr1a (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of MTNR1A mRNA CTD PMID:29950665 Mtnr1a Rat dibenz[a,h]anthracene decreases expression ISO Mtnr1a (Mus musculus) 6480464 1 more ... CTD PMID:26377693 Mtnr1a Rat dichlorine decreases expression EXP 6480464 Chlorine results in decreased expression of MTNR1A mRNA CTD PMID:18636392 Mtnr1a Rat dichlorine multiple interactions EXP 6480464 [Ozone co-treated with Chlorine] results in increased expression of MTNR1A mRNA CTD PMID:18636392 Mtnr1a Rat dichloroacetic acid increases expression ISO Mtnr1a (Mus musculus) 6480464 Dichloroacetic Acid results in increased expression of MTNR1A mRNA CTD PMID:28962523 Mtnr1a Rat disodium selenite decreases expression ISO MTNR1A (Homo sapiens) 6480464 Sodium Selenite results in decreased expression of MTNR1A mRNA CTD PMID:18175754 Mtnr1a Rat epoxiconazole affects expression ISO Mtnr1a (Mus musculus) 6480464 epoxiconazole affects the expression of MTNR1A mRNA CTD PMID:35436446 Mtnr1a Rat ethanol multiple interactions EXP 6480464 [Ethanol co-treated with Melatonin] results in increased expression of MTNR1A protein CTD PMID:23591044 Mtnr1a Rat fonofos increases methylation ISO MTNR1A (Homo sapiens) 6480464 Fonofos results in increased methylation of MTNR1A promoter CTD PMID:22847954 Mtnr1a Rat fulvestrant multiple interactions ISO MTNR1A (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in increased methylation of MTNR1A gene CTD PMID:31601247 Mtnr1a Rat furan increases expression ISO Mtnr1a (Mus musculus) 6480464 furan results in increased expression of MTNR1A mRNA CTD PMID:24183702 Mtnr1a Rat inulin multiple interactions ISO Mtnr1a (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of MTNR1A mRNA CTD PMID:36331819 Mtnr1a Rat ketorolac tromethamine increases localization EXP 6480464 Ketorolac Tromethamine results in increased localization of MTNR1A protein CTD PMID:37348669 Mtnr1a Rat luzindole multiple interactions EXP 6480464 luzindole inhibits the reaction [Melatonin results in increased expression of MTNR1A protein] CTD PMID:28238930 Mtnr1a Rat melatonin affects binding ISO MTNR1A (Homo sapiens) 6480464 Melatonin analog binds to MTNR1A protein and Melatonin binds to MTNR1A protein CTD PMID:11063602 more ... Mtnr1a Rat melatonin multiple interactions ISO Mtnr1a (Mus musculus) 6480464 Melatonin inhibits the reaction [bisphenol A results in decreased expression of MTNR1A protein] CTD PMID:38440074 and PMID:38538260 Mtnr1a Rat melatonin increases expression ISO MTNR1A (Homo sapiens) 6480464 Melatonin results in increased expression of MTNR1A protein CTD PMID:29330934 Mtnr1a Rat melatonin multiple interactions ISO MTNR1A (Homo sapiens) 6480464 Carbaryl inhibits the reaction [Melatonin binds to MTNR1A protein] and Carbofuran inhibits the reaction [Melatonin binds to MTNR1A protein] CTD PMID:28027439 Mtnr1a Rat melatonin multiple interactions EXP 6480464 [Ethanol co-treated with Melatonin] results in increased expression of MTNR1A protein and luzindole inhibits the reaction [Melatonin results in increased expression of MTNR1A protein] CTD PMID:23591044 and PMID:28238930 Mtnr1a Rat melatonin increases expression EXP 6480464 Melatonin results in increased expression of MTNR1A protein CTD PMID:23591044 and PMID:28238930 Mtnr1a Rat methoxychlor affects methylation EXP 6480464 Methoxychlor affects the methylation of MTNR1A gene CTD PMID:35440735 Mtnr1a Rat ozone multiple interactions EXP 6480464 [Ozone co-treated with Chlorine] results in increased expression of MTNR1A mRNA CTD PMID:18636392 Mtnr1a Rat paracetamol affects expression ISO Mtnr1a (Mus musculus) 6480464 Acetaminophen affects the expression of MTNR1A mRNA CTD PMID:17562736 Mtnr1a Rat paracetamol multiple interactions EXP 6480464 Acetaminophen inhibits the reaction [Alcohols results in decreased expression of MTNR1A mRNA] CTD PMID:36572547 Mtnr1a Rat parathion increases methylation ISO MTNR1A (Homo sapiens) 6480464 Parathion results in increased methylation of MTNR1A promoter CTD PMID:22847954 Mtnr1a Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Mtnr1a (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of MTNR1A mRNA CTD PMID:36331819 Mtnr1a Rat phenobarbital decreases expression ISO Mtnr1a (Mus musculus) 6480464 Phenobarbital results in decreased expression of MTNR1A mRNA CTD PMID:19270015 Mtnr1a Rat phenobarbital affects expression ISO Mtnr1a (Mus musculus) 6480464 Phenobarbital affects the expression of MTNR1A mRNA CTD PMID:23091169 Mtnr1a Rat pirinixic acid multiple interactions ISO Mtnr1a (Mus musculus) 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in decreased expression of MTNR1A mRNA CTD PMID:19710929 Mtnr1a Rat pirinixic acid increases expression ISO Mtnr1a (Mus musculus) 6480464 pirinixic acid results in increased expression of MTNR1A mRNA CTD PMID:18301758 Mtnr1a Rat resveratrol affects binding ISO MTNR1A (Homo sapiens) 6480464 resveratrol binds to MTNR1A protein CTD PMID:20399199 Mtnr1a Rat terbufos increases methylation ISO MTNR1A (Homo sapiens) 6480464 terbufos results in increased methylation of MTNR1A promoter CTD PMID:22847954 Mtnr1a Rat titanium dioxide multiple interactions ISO Mtnr1a (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of MTNR1A mRNA CTD PMID:29950665 Mtnr1a Rat titanium dioxide decreases expression ISO Mtnr1a (Mus musculus) 6480464 titanium dioxide results in decreased expression of MTNR1A mRNA CTD PMID:35295148 Mtnr1a Rat tributylstannane decreases expression ISO Mtnr1a (Mus musculus) 6480464 tributyltin results in decreased expression of MTNR1A mRNA CTD PMID:31939706 Mtnr1a Rat trichloroethene increases expression ISO Mtnr1a (Mus musculus) 6480464 Trichloroethylene results in increased expression of MTNR1A mRNA CTD PMID:25549359 Mtnr1a Rat trichloroethene increases expression EXP 6480464 Trichloroethylene results in increased expression of MTNR1A mRNA CTD PMID:33387578 Mtnr1a Rat vinclozolin increases methylation EXP 6480464 vinclozolin results in increased methylation of MTNR1A gene CTD PMID:31079544
1,2-dichloroethane (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,3,7,8-Tetrachlorodibenzofuran (EXP) 4',5,7-trihydroxy-3'-methoxyflavone (ISO) 4,4'-sulfonyldiphenol (ISO) 6-propyl-2-thiouracil (EXP) acenaphthenes (ISO) acrylamide (ISO) agomelatine (ISO) alcohol (EXP) ammonium chloride (EXP) Azoxymethane (ISO) benzo[a]pyrene (EXP,ISO) benzo[a]pyrene diol epoxide I (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) cadmium dichloride (ISO) carbaryl (ISO) carbofuran (ISO) chlorpyrifos (ISO) dextran sulfate (ISO) dibenz[a,h]anthracene (ISO) dichlorine (EXP) dichloroacetic acid (ISO) disodium selenite (ISO) epoxiconazole (ISO) ethanol (EXP) fonofos (ISO) fulvestrant (ISO) furan (ISO) inulin (ISO) ketorolac tromethamine (EXP) luzindole (EXP) melatonin (EXP,ISO) methoxychlor (EXP) ozone (EXP) paracetamol (EXP,ISO) parathion (ISO) perfluorooctane-1-sulfonic acid (ISO) phenobarbital (ISO) pirinixic acid (ISO) resveratrol (ISO) terbufos (ISO) titanium dioxide (ISO) tributylstannane (ISO) trichloroethene (EXP,ISO) vinclozolin (EXP)
1.
Induction of GDNF mRNA expression by melatonin in rat C6 glioma cells.
Armstrong KJ and Niles LP, Neuroreport 2002 Mar 25;13(4):473-5.
2.
Expression of mt1 melatonin receptor in rat retina: evidence for multiple cell targets for melatonin.
Fujieda H, etal., Neuroscience. 1999;93(2):793-9.
3.
Gene regulation of melatonin and dopamine receptors during eye development.
Fujieda H, etal., Neuroscience. 2003;120(2):301-7.
4.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
5.
Age-related decline in melatonin and its MT1 receptor are associated with decreased sensitivity to melatonin and enhanced mammary tumor growth.
Hill SM, etal., Curr Aging Sci. 2013 Feb;6(1):125-33.
6.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
7.
Melatonin influences insulin secretion primarily via MT(1) receptors in rat insulinoma cells (INS-1) and mouse pancreatic islets.
Muhlbauer E, etal., J Pineal Res. 2012 May;52(4):446-59. doi: 10.1111/j.1600-079X.2012.00959.x. Epub 2012 Jan 30.
8.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
9.
Diabetic Goto Kakizaki rats as well as type 2 diabetic patients show a decreased diurnal serum melatonin level and an increased pancreatic melatonin-receptor status.
Peschke E, etal., J Pineal Res. 2006 Mar;40(2):135-43.
10.
MT1 melatonin receptor mRNA expression exhibits a circadian variation in the rat suprachiasmatic nuclei.
Poirel VJ, etal., Brain Res 2002 Aug 9;946(1):64-71.
11.
Cloning and characterization of a mammalian melatonin receptor that mediates reproductive and circadian responses.
Reppert SM, etal., Neuron 1994 Nov;13(5):1177-85.
12.
GOA pipeline
RGD automated data pipeline
13.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
14.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
15.
Comprehensive gene review and curation
RGD comprehensive gene curation
16.
The melatonin MT1 receptor axis modulates mutant Huntingtin-mediated toxicity.
Wang X, etal., J Neurosci. 2011 Oct 12;31(41):14496-507. doi: 10.1523/JNEUROSCI.3059-11.2011.
17.
Melatonin inhibits the caspase-1/cytochrome c/caspase-3 cell death pathway, inhibits MT1 receptor loss and delays disease progression in a mouse model of amyotrophic lateral sclerosis.
Zhang Y, etal., Neurobiol Dis. 2013 Jul;55:26-35. doi: 10.1016/j.nbd.2013.03.008. Epub 2013 Mar 26.
Mtnr1a Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 16 53,876,964 - 53,896,421 (-) NCBI GRCr8 mRatBN7.2 16 47,144,461 - 47,163,919 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 16 47,144,461 - 47,163,919 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 16 52,537,231 - 52,556,697 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 16 55,914,702 - 55,934,153 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 16 51,176,623 - 51,196,091 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 16 50,339,358 - 50,358,809 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 16 50,339,358 - 50,358,809 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 16 50,060,173 - 50,079,905 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 16 50,439,407 - 50,458,585 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 16 50,440,049 - 50,458,436 (-) NCBI Celera 16 45,133,125 - 45,152,577 (-) NCBI Celera Cytogenetic Map 16 q11 NCBI
MTNR1A Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 4 186,533,655 - 186,555,567 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 4 186,526,792 - 186,555,567 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 4 187,454,809 - 187,476,721 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 4 187,691,803 - 187,713,531 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 4 187,829,957 - 187,851,686 NCBI Celera 4 184,775,494 - 184,797,420 (-) NCBI Celera Cytogenetic Map 4 q35.2 NCBI HuRef 4 183,202,086 - 183,223,734 (-) NCBI HuRef CHM1_1 4 187,431,225 - 187,452,953 (-) NCBI CHM1_1 T2T-CHM13v2.0 4 189,880,029 - 189,902,297 (-) NCBI T2T-CHM13v2.0
Mtnr1a Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 8 45,522,144 - 45,542,270 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 8 45,522,174 - 45,541,543 (+) Ensembl GRCm39 Ensembl GRCm38 8 45,069,107 - 45,089,233 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 8 45,069,137 - 45,088,506 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 8 46,154,564 - 46,173,860 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 8 46,568,027 - 46,587,323 (+) NCBI MGSCv36 mm8 Celera 8 47,756,698 - 47,775,989 (+) NCBI Celera Cytogenetic Map 8 B1.1 NCBI cM Map 8 24.95 NCBI
Mtnr1a Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955403 22,636,212 - 22,658,566 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955403 22,636,212 - 22,658,566 (+) NCBI ChiLan1.0 ChiLan1.0
MTNR1A Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 3 184,264,624 - 184,293,011 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 4 184,611,403 - 184,641,772 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 4 178,693,869 - 178,720,351 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 4 190,897,192 - 190,921,677 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 4 190,897,192 - 190,921,677 (-) Ensembl panpan1.1 panPan2
MTNR1A Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 16 44,258,239 - 44,286,761 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 16 44,744,863 - 44,773,476 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 16 46,475,550 - 46,506,291 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 16 46,477,377 - 46,504,258 (+) Ensembl ROS_Cfam_1.0 Ensembl UU_Cfam_GSD_1.0 16 45,187,864 - 45,219,170 (+) NCBI UU_Cfam_GSD_1.0
Mtnr1a Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404943 35,063,053 - 35,096,930 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936554 3,013,050 - 3,047,179 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936554 3,013,106 - 3,047,171 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
MTNR1A Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 17 8,596,911 - 8,617,657 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 17 8,597,047 - 8,618,746 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 17 9,510,039 - 9,522,414 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
MTNR1A Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 7 132,423,619 - 132,445,881 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 7 132,424,052 - 132,444,860 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666037 112,752,358 - 112,774,119 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Mtnr1a
.
Predicted Target Of
Count of predictions: 90 Count of miRNA genes: 65 Interacting mature miRNAs: 84 Transcripts: ENSRNOT00000039331 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
2300163 Bmd64 Bone mineral density QTL 64 5.3 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 16 37752156 82752156 Rat 1600378 Arunc4 Aerobic running capacity QTL 4 0.03 exercise endurance trait (VT:0002332) maximum distance run on treadmill (CMO:0001406) 16 380245 80345693 Rat 70215 Niddm29 Non-insulin dependent diabetes mellitus QTL 29 3.54 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 16 19004435 75226532 Rat 1578768 Stresp22 Stress response QTL 22 2.8 thymus mass (VT:0004954) thymus wet weight (CMO:0000855) 16 35288870 80288870 Rat 737826 Alc11 Alcohol consumption QTL 11 3.2 consumption behavior trait (VT:0002069) ethanol drink intake rate (CMO:0001407) 16 4227609 60252231 Rat 2302057 Pia29 Pristane induced arthritis QTL 29 3.6 0.001 blood autoantibody amount (VT:0003725) serum immunoglobulin M-type rheumatoid factor level relative to an arbitrary reference serum (CMO:0002111) 16 21735975 66735975 Rat 7205510 Activ5 Activity QTL 5 3.78 0.00028 locomotor behavior trait (VT:0001392) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 16 42396345 84729064 Rat 631833 Sach2 Saccharin preference QTL 2 4 0.01 consumption behavior trait (VT:0002069) calculated saccharin drink intake rate (CMO:0001613) 16 43024842 50166018 Rat 8694453 Bw172 Body weight QTL 172 8.33 0.001 retroperitoneal fat pad mass (VT:0010430) retroperitoneal fat pad weight to body weight ratio (CMO:0000635) 16 24325513 69325513 Rat 1298529 Arunc1 Aerobic running capacity QTL 1 4 exercise endurance trait (VT:0002332) maximum distance run on treadmill (CMO:0001406) 16 31951520 60148445 Rat 2312663 Slep9 Serum leptin concentration QTL 9 0.001 blood leptin amount (VT:0005667) serum leptin level (CMO:0000780) 16 832236 59492508 Rat 2312660 Bw95 Body weight QTL 95 0.05 inguinal fat pad mass (VT:0010424) inguinal fat pad weight to body weight ratio (CMO:0001253) 16 832236 59492508 Rat 6903294 Stl30 Serum triglyceride level QTL 30 2.6 0.0013 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 16 25152793 70152793 Rat 2293690 Bss45 Bone structure and strength QTL 45 5.13 0.0001 lumbar vertebra morphology trait (VT:0010494) lumbar vertebra cortical cross-sectional area (CMO:0001690) 16 37752156 82752156 Rat 2312666 Insul16 Insulin level QTL 16 0.01 blood insulin amount (VT:0001560) serum insulin level (CMO:0000358) 16 832236 59492508 Rat 61338 Bp23 Blood pressure QTL 23 4.3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 16 4227609 49227609 Rat 70205 Gcr3 Gastric cancer resistance QTL 3 2.3 stomach morphology trait (VT:0000470) stomach tumor diameter (CMO:0001889) 16 17696791 82635055 Rat 61405 Niddm6 Non-insulin dependent diabetes mellitus QTL 6 3.66 0.001 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 16 4227609 48972724 Rat 2312669 Stl23 Serum triglyceride level QTL 23 0.01 blood triglyceride amount (VT:0002644) serum triglyceride level (CMO:0000360) 16 832236 59492508 Rat
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
1
3
50
21
8
3
17
3
2
50
31
37
6
30
5
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000039331 ⟹ ENSRNOP00000034328
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 16 47,144,461 - 47,163,919 (-) Ensembl Rnor_6.0 Ensembl 16 50,339,358 - 50,358,809 (-) Ensembl
RefSeq Acc Id:
NM_053676 ⟹ NP_446128
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 16 53,876,964 - 53,896,421 (-) NCBI mRatBN7.2 16 47,144,461 - 47,163,919 (-) NCBI Rnor_6.0 16 50,339,358 - 50,358,809 (-) NCBI Rnor_5.0 16 50,060,173 - 50,079,905 (-) NCBI RGSC_v3.4 16 50,439,407 - 50,458,585 (-) RGD Celera 16 45,133,125 - 45,152,577 (-) RGD
Sequence:
GAAAGGGTGTCCTGCCACCGGGAGGGGCTGGAGCGGGGTAAGGGGCAGGACCGCGAAGCAGCCATAAGGATGCAAAGTAGGCGCGGGAGGGCTCTCCCCAGCCATAAAAAGTGGCGGAGAGGGCGCAA
hide sequence
RefSeq Acc Id:
NP_446128 ⟸ NM_053676
- UniProtKB:
B7X945 (UniProtKB/TrEMBL), A6JPS4 (UniProtKB/TrEMBL), Q9ESJ3 (UniProtKB/TrEMBL), F7F7U1 (UniProtKB/TrEMBL)
- Sequence:
MKGNVSELLNASQQAPGGGEEIRSRPSWLASTLAFILIFTIVVDILGNLLVILSVYRNKKLRNAGNIFVVSLAVADLVVAIYPFPLALTSILNNGWNLGYLHCQVSAFLMGLSVIGSVFNITGIAMNR
hide sequence
Ensembl Acc Id:
ENSRNOP00000034328 ⟸ ENSRNOT00000039331
BioCyc Gene G2FUF-11309 BioCyc
Ensembl Genes ENSRNOG00000028744 Ensembl, UniProtKB/TrEMBL
Ensembl Transcript ENSRNOT00000039331.4 UniProtKB/TrEMBL
Gene3D-CATH Rhodopsin 7-helix transmembrane proteins UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
InterPro GPCR_Rhodpsn UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
GPCR_Rhodpsn_7TM UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Mel_1A/1B_rcpt UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Melatonin_rcpt UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report rno:114211 UniProtKB/TrEMBL
NCBI Gene 114211 ENTREZGENE
PANTHER B2 BRADYKININ RECEPTOR/ANGIOTENSIN II RECEPTOR UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
MELATONIN RECEPTOR TYPE 1A UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam 7tm_1 UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen Mtnr1a PhenoGen
PRINTS GPCRRHODOPSN UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
MELATONIN1AR UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
MELATONINR UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PROSITE G_PROTEIN_RECEP_F1_1 UniProtKB/TrEMBL
G_PROTEIN_RECEP_F1_2 UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
RatGTEx ENSRNOG00000028744 RatGTEx
SMART 7TM_GPCR_Srsx UniProtKB/TrEMBL
Superfamily-SCOP Family A G protein-coupled receptor-like UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt A6JPS4 ENTREZGENE, UniProtKB/TrEMBL
B7X945 ENTREZGENE
F7F7U1 ENTREZGENE, UniProtKB/TrEMBL
MTR1A_RAT UniProtKB/Swiss-Prot, ENTREZGENE
Q9ESJ3 ENTREZGENE, UniProtKB/TrEMBL
UniProt Secondary B7X945 UniProtKB/TrEMBL
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2004-09-10
Mtnr1a
melatonin receptor 1A
Symbol and Name status set to approved
1299863 APPROVED
2002-08-07
Mtnr1a
melatonin receptor 1A
Symbol and Name status set to provisional
70820 PROVISIONAL
Note Type
Note
Reference
gene_expression
expression demonstrates a circadian variation in the rat suprachiasmatic nuclei
729107
gene_process
upregulates expression of glial cell line-derived neurotrophic factor (GDNF) in C6 glioma cells
727356
