Symbol:
Gcc1
Name:
GRIP and coiled-coil domain containing 1
RGD ID:
2319954
Description:
Predicted to be located in Golgi membrane. Predicted to be active in Golgi apparatus. Orthologous to human GCC1 (GRIP and coiled-coil domain containing 1); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; vinclozolin; (-)-epigallocatechin 3-gallate (ortholog).
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
GRIP and coiled-coil domain-containing protein 1; LOC100361513; rCG28300-like
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 4 57,996,261 - 58,008,126 (-) NCBI GRCr8 mRatBN7.2 4 57,030,817 - 57,042,682 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 4 57,032,314 - 57,042,663 (-) Ensembl mRatBN7.2 Ensembl Rnor_6.0 4 55,708,040 - 55,719,884 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 4 55,709,096 - 55,713,620 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 4 55,455,487 - 55,467,326 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 4 55,287,931 - 55,291,642 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 4 52,142,399 - 52,154,245 (-) NCBI Celera Cytogenetic Map 4 q22 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Gcc1 Rat (-)-epigallocatechin 3-gallate multiple interactions ISO GCC1 (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in increased expression of GCC1 mRNA CTD PMID:22079256 Gcc1 Rat 1,2-dimethylhydrazine affects expression ISO Gcc1 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine affects the expression of GCC1 mRNA CTD PMID:22206623 Gcc1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Gcc1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of GCC1 mRNA CTD PMID:19770486 and PMID:31961203 Gcc1 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of GCC1 mRNA CTD PMID:33387578 Gcc1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Gcc1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of GCC1 mRNA CTD PMID:26377647 Gcc1 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Gcc1 (Mus musculus) 6480464 [TIPARP gene mutant form results in increased susceptibility to Tetrachlorodibenzodioxin] which results in increased expression of GCC1 mRNA CTD PMID:25975270 Gcc1 Rat 4,4'-diaminodiphenylmethane increases expression ISO Gcc1 (Mus musculus) 6480464 4 and 4'-diaminodiphenylmethane results in increased expression of GCC1 mRNA CTD PMID:18648102 Gcc1 Rat aflatoxin B1 decreases methylation ISO GCC1 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of GCC1 gene CTD PMID:27153756 Gcc1 Rat atrazine decreases expression ISO GCC1 (Homo sapiens) 6480464 Atrazine results in decreased expression of GCC1 mRNA CTD PMID:22378314 Gcc1 Rat benzo[a]pyrene multiple interactions ISO Gcc1 (Mus musculus) 6480464 Benzo(a)pyrene promotes the reaction [AHR protein binds to GCC1 promoter] CTD PMID:19654925 Gcc1 Rat benzo[a]pyrene affects methylation ISO GCC1 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of GCC1 promoter CTD PMID:27901495 Gcc1 Rat benzo[a]pyrene increases expression ISO Gcc1 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of GCC1 mRNA CTD PMID:19770486 Gcc1 Rat bis(2-ethylhexyl) phthalate decreases expression ISO Gcc1 (Mus musculus) 6480464 Diethylhexyl Phthalate results in decreased expression of GCC1 mRNA CTD PMID:34319233 Gcc1 Rat bisphenol A decreases expression ISO Gcc1 (Mus musculus) 6480464 bisphenol A results in decreased expression of GCC1 mRNA CTD PMID:26063408 Gcc1 Rat CGP 52608 multiple interactions ISO GCC1 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to GCC1 gene] CTD PMID:28238834 Gcc1 Rat ciguatoxin CTX1B affects expression ISO Gcc1 (Mus musculus) 6480464 Ciguatoxins affects the expression of GCC1 mRNA CTD PMID:18353800 Gcc1 Rat cisplatin increases expression ISO GCC1 (Homo sapiens) 6480464 Cisplatin results in increased expression of GCC1 mRNA CTD PMID:19561079 and PMID:27594783 Gcc1 Rat cocaine increases expression ISO GCC1 (Homo sapiens) 6480464 Cocaine results in increased expression of GCC1 mRNA CTD PMID:17205118 Gcc1 Rat copper atom multiple interactions ISO GCC1 (Homo sapiens) 6480464 [Disulfiram binds to Copper] which results in decreased expression of GCC1 mRNA CTD PMID:24690739 Gcc1 Rat copper(0) multiple interactions ISO GCC1 (Homo sapiens) 6480464 [Disulfiram binds to Copper] which results in decreased expression of GCC1 mRNA CTD PMID:24690739 Gcc1 Rat crocidolite asbestos decreases expression ISO Gcc1 (Mus musculus) 6480464 Asbestos and Crocidolite results in decreased expression of GCC1 mRNA CTD PMID:29279043 Gcc1 Rat cyclosporin A increases expression ISO GCC1 (Homo sapiens) 6480464 Cyclosporine results in increased expression of GCC1 mRNA CTD PMID:20106945 Gcc1 Rat cylindrospermopsin increases expression ISO GCC1 (Homo sapiens) 6480464 cylindrospermopsin results in increased expression of GCC1 mRNA CTD PMID:24921660 Gcc1 Rat DDE decreases expression ISO GCC1 (Homo sapiens) 6480464 Dichlorodiphenyl Dichloroethylene results in decreased expression of GCC1 mRNA CTD PMID:38568856 Gcc1 Rat Dibutyl phosphate affects expression ISO GCC1 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of GCC1 mRNA CTD PMID:37042841 Gcc1 Rat disodium selenite increases expression ISO GCC1 (Homo sapiens) 6480464 Sodium Selenite results in increased expression of GCC1 mRNA CTD PMID:24383545 Gcc1 Rat disulfiram multiple interactions ISO GCC1 (Homo sapiens) 6480464 [Disulfiram binds to Copper] which results in decreased expression of GCC1 mRNA CTD PMID:24690739 Gcc1 Rat doxorubicin affects expression ISO GCC1 (Homo sapiens) 6480464 Doxorubicin affects the expression of GCC1 mRNA CTD PMID:29803840 Gcc1 Rat entinostat decreases expression ISO GCC1 (Homo sapiens) 6480464 entinostat results in decreased expression of GCC1 mRNA CTD PMID:27188386 Gcc1 Rat folic acid decreases expression ISO Gcc1 (Mus musculus) 6480464 Folic Acid results in decreased expression of GCC1 mRNA CTD PMID:25629700 Gcc1 Rat iron dichloride decreases expression ISO GCC1 (Homo sapiens) 6480464 ferrous chloride results in decreased expression of GCC1 mRNA CTD PMID:35984750 Gcc1 Rat ozone multiple interactions ISO GCC1 (Homo sapiens) 6480464 [Air Pollutants results in increased abundance of Ozone] which affects the expression of GCC1 mRNA CTD PMID:35430440 Gcc1 Rat paracetamol increases expression ISO GCC1 (Homo sapiens) 6480464 Acetaminophen results in increased expression of GCC1 mRNA CTD PMID:29067470 Gcc1 Rat perfluorononanoic acid increases expression ISO GCC1 (Homo sapiens) 6480464 perfluoro-n-nonanoic acid results in increased expression of GCC1 mRNA CTD PMID:32588087 Gcc1 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Gcc1 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Pectins] results in decreased expression of GCC1 mRNA CTD PMID:36331819 Gcc1 Rat phencyclidine increases expression ISO GCC1 (Homo sapiens) 6480464 Phencyclidine results in increased expression of GCC1 mRNA CTD PMID:17205118 Gcc1 Rat pirinixic acid decreases expression ISO Gcc1 (Mus musculus) 6480464 pirinixic acid results in decreased expression of GCC1 mRNA CTD PMID:23811191 Gcc1 Rat potassium chromate increases expression ISO GCC1 (Homo sapiens) 6480464 potassium chromate(VI) results in increased expression of GCC1 mRNA CTD PMID:22079256 Gcc1 Rat potassium chromate multiple interactions ISO GCC1 (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in increased expression of GCC1 mRNA CTD PMID:22079256 Gcc1 Rat resveratrol multiple interactions ISO GCC1 (Homo sapiens) 6480464 [Plant Extracts co-treated with Resveratrol] results in increased expression of GCC1 mRNA CTD PMID:23557933 Gcc1 Rat sodium arsenite increases expression ISO GCC1 (Homo sapiens) 6480464 sodium arsenite results in increased expression of GCC1 mRNA CTD PMID:38568856 Gcc1 Rat sunitinib increases expression ISO GCC1 (Homo sapiens) 6480464 Sunitinib results in increased expression of GCC1 mRNA CTD PMID:31533062 Gcc1 Rat thiram increases expression ISO GCC1 (Homo sapiens) 6480464 Thiram results in increased expression of GCC1 mRNA CTD PMID:38568856 Gcc1 Rat tungsten decreases expression ISO Gcc1 (Mus musculus) 6480464 Tungsten results in decreased expression of GCC1 mRNA CTD PMID:30912803 Gcc1 Rat tunicamycin increases expression ISO GCC1 (Homo sapiens) 6480464 Tunicamycin results in increased expression of GCC1 mRNA CTD PMID:22378314 and PMID:29453283 Gcc1 Rat urethane increases expression ISO GCC1 (Homo sapiens) 6480464 Urethane results in increased expression of GCC1 mRNA CTD PMID:28818685 Gcc1 Rat valproic acid affects expression ISO GCC1 (Homo sapiens) 6480464 Valproic Acid affects the expression of GCC1 mRNA CTD PMID:25979313 Gcc1 Rat vinclozolin increases expression EXP 6480464 vinclozolin results in increased expression of GCC1 mRNA CTD PMID:23034163 Gcc1 Rat zinc atom multiple interactions ISO GCC1 (Homo sapiens) 6480464 [PCI 5002 co-treated with Zinc] results in increased expression of GCC1 mRNA CTD PMID:18593933 Gcc1 Rat zinc(0) multiple interactions ISO GCC1 (Homo sapiens) 6480464 [PCI 5002 co-treated with Zinc] results in increased expression of GCC1 mRNA CTD PMID:18593933
Gcc1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 4 57,996,261 - 58,008,126 (-) NCBI GRCr8 mRatBN7.2 4 57,030,817 - 57,042,682 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 4 57,032,314 - 57,042,663 (-) Ensembl mRatBN7.2 Ensembl Rnor_6.0 4 55,708,040 - 55,719,884 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 4 55,709,096 - 55,713,620 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 4 55,455,487 - 55,467,326 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 4 55,287,931 - 55,291,642 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 4 52,142,399 - 52,154,245 (-) NCBI Celera Cytogenetic Map 4 q22 NCBI
GCC1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 7 127,580,628 - 127,585,596 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 7 127,580,628 - 127,593,611 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 7 127,220,682 - 127,225,650 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 7 127,007,918 - 127,012,890 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 7 126,814,633 - 126,819,605 NCBI Celera 7 122,024,410 - 122,029,382 (-) NCBI Celera Cytogenetic Map 7 q32.1 NCBI HuRef 7 121,581,752 - 121,586,724 (-) NCBI HuRef CHM1_1 7 127,153,979 - 127,158,951 (-) NCBI CHM1_1 T2T-CHM13v2.0 7 128,892,307 - 128,897,275 (-) NCBI T2T-CHM13v2.0 CRA_TCAGchr7v2 7 126,604,127 - 126,609,099 (-) NCBI
Gcc1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 6 28,413,784 - 28,424,152 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 6 28,416,090 - 28,428,389 (-) Ensembl GRCm39 Ensembl GRCm38 6 28,416,603 - 28,421,724 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 6 28,416,091 - 28,428,390 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 6 28,366,603 - 28,371,724 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 6 28,366,701 - 28,371,734 (-) NCBI MGSCv36 mm8 Celera 6 28,423,663 - 28,428,784 (-) NCBI Celera Cytogenetic Map 6 A3.3 NCBI cM Map 6 11.99 NCBI
Gcc1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955479 8,635,114 - 8,642,027 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955479 8,636,274 - 8,642,027 (-) NCBI ChiLan1.0 ChiLan1.0
GCC1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 6 164,439,787 - 164,446,266 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 7 16,450,038 - 16,457,742 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 7 119,575,802 - 119,581,401 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 7 132,231,077 - 132,236,053 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 7 132,231,077 - 132,236,053 (-) Ensembl panpan1.1 panPan2
GCC1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 14 8,738,379 - 8,743,623 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 14 8,737,838 - 8,742,022 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 14 8,431,191 - 8,436,440 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 14 8,511,898 - 8,517,147 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 14 8,511,912 - 8,517,145 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 14 8,716,131 - 8,721,380 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 14 8,450,601 - 8,455,850 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 14 8,604,366 - 8,609,615 (+) NCBI UU_Cfam_GSD_1.0
Gcc1 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405118 53,659,457 - 53,664,293 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936479 14,782,455 - 14,788,230 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936479 14,782,595 - 14,788,089 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
GCC1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 18 20,701,737 - 20,707,138 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 18 20,701,685 - 20,708,053 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 18 21,705,363 - 21,711,721 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
GCC1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 21 96,395,819 - 96,400,817 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 21 96,397,199 - 96,400,682 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666042 7,003,507 - 7,011,565 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Gcc1
.
Predicted Target Of
Count of predictions: 163 Count of miRNA genes: 119 Interacting mature miRNAs: 132 Transcripts: ENSRNOT00000010246 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
2302371 Stl22 Serum triglyceride level QTL 22 5.15 blood triglyceride amount (VT:0002644) serum triglyceride level (CMO:0000360) 4 5218294 57114705 Rat 2303585 Bw86 Body weight QTL 86 4 body mass (VT:0001259) body weight (CMO:0000012) 4 14678065 59678065 Rat 5685012 Bmd87 Bone mineral density QTL 87 5.1 tibia mineral mass (VT:1000283) bone mineral content (CMO:0001554) 4 56647776 78882945 Rat 1358352 Srcrt3 Stress Responsive Cort QTL 3 2.29 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 4 38465774 146803430 Rat 61445 Strs3 Sensitivity to stroke QTL 3 3 cerebrum integrity trait (VT:0010549) post-insult time to onset of cerebrovascular lesion (CMO:0002343) 4 40433388 85433388 Rat 6893678 Bw108 Body weight QTL 108 2.6 0.006 body mass (VT:0001259) body weight (CMO:0000012) 4 43457976 88457976 Rat 5685009 Bmd86 Bone mineral density QTL 86 3.7 tibia mineral mass (VT:1000283) bone mineral density (CMO:0001226) 4 56647776 78882945 Rat 10755501 Bp390 Blood pressure QTL 390 2.5 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 4 26775591 168368347 Rat 1331807 Rf31 Renal function QTL 31 2.988 urine potassium amount (VT:0010539) urine potassium level (CMO:0000128) 4 39524264 74726312 Rat 8552782 Vie1 Viral induced encephalitis QTL 1 26.4 brain integrity trait (VT:0010579) encephalitis incidence/prevalence measurement (CMO:0002361) 4 34430484 82490359 Rat 631261 Tcas3 Tongue tumor susceptibility QTL 3 6.88 tongue integrity trait (VT:0010553) number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950) 4 10814170 91360527 Rat 2312567 Glom19 Glomerulus QTL 19 1.9 0.006 kidney glomerulus morphology trait (VT:0005325) index of glomerular damage (CMO:0001135) 4 45456990 146803430 Rat 10450825 Scl78 Serum cholesterol level QTL 78 3.7 0.01 blood VLDL cholesterol amount (VT:0005144) blood low density lipoprotein cholesterol level (CMO:0000053) 4 49178116 57114705 Rat 2313401 Anxrr27 Anxiety related response QTL 27 aggression-related behavior trait (VT:0015014) tameness/aggressiveness composite score (CMO:0002136) 4 17933508 62933508 Rat 10450821 Scl77 Serum cholesterol level QTL 77 4.1 0.01 blood VLDL cholesterol amount (VT:0005144) blood high density lipoprotein cholesterol level (CMO:0000052) 4 49178116 57114705 Rat 8655961 Kidm43 Kidney mass QTL 43 18 kidney mass (VT:0002707) both kidneys wet weight (CMO:0000085) 4 36303261 103194984 Rat 10450818 Scl76 Serum cholesterol level QTL 76 3.6 0.01 blood VLDL cholesterol amount (VT:0005144) blood high density lipoprotein cholesterol level (CMO:0000052) 4 49178116 57114705 Rat 1354612 Foco1 Food consumption QTL 1 8.87 eating behavior trait (VT:0001431) food intake rate (CMO:0000427) 4 44463908 148090542 Rat 6909128 Pancm4 Pancreatic morphology QTL 4 11.35 pancreas mass (VT:0010144) pancreas wet weight (CMO:0000626) 4 26907285 75585128 Rat 2303168 Bp330 Blood pressure QTL 330 4.25 0.017 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 4 5214602 146446691 Rat 8552801 Bw143 Body weight QTL 143 7.3 body mass (VT:0001259) change in body weight to body weight ratio (CMO:0002216) 4 34430484 82490359 Rat 61475 Aia2 Adjuvant induced arthritis QTL 2 5.8 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 4 39505275 73892441 Rat 8694439 Bw168 Body weight QTL 168 9.57 0.001 retroperitoneal fat pad mass (VT:0010430) retroperitoneal fat pad weight to body weight ratio (CMO:0000635) 4 40433414 85433414 Rat 61412 Pia2 Pristane induced arthritis QTL 2 3.9 joint integrity trait (VT:0010548) post-insult time to onset of experimental arthritis (CMO:0001450) 4 21333343 62278020 Rat 8655906 Rf60 Renal function QTL 60 3.8 blood creatinine amount (VT:0005328) creatinine clearance (CMO:0000765) 4 29494195 81006281 Rat 619616 Bp79 Blood pressure QTL 79 0.0292 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 4 5214602 78882945 Rat 1576305 Emca6 Estrogen-induced mammary cancer QTL 6 5.8 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 4 44463720 155883716 Rat 7387227 Uae40 Urinary albumin excretion QTL 40 2.9 0.0052 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 4 17946999 62946999 Rat 6909122 Insul22 Insulin level QTL 22 4.63 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 4 26907285 75585128 Rat 8552809 Vie5 Viral induced encephalitis QTL 5 25.3 brain integrity trait (VT:0010579) encephalitis incidence/prevalence measurement (CMO:0002361) 4 34430484 82490359 Rat 1358203 Stl19 Serum triglyceride level QTL 19 2.8 0.002 blood triglyceride amount (VT:0002644) serum triglyceride level (CMO:0000360) 4 5218294 65958103 Rat 1354660 Salc1 Saline consumption QTL 1 11.26 drinking behavior trait (VT:0001422) saline drink intake rate (CMO:0001627) 4 44463908 148090542 Rat 1641833 Alc21 Alcohol consumption QTL 21 8.6 0.0001 drinking behavior trait (VT:0001422) ethanol drink intake rate (CMO:0001407) 4 56698790 126192555 Rat 1298082 Stresp4 Stress response QTL 4 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 4 50119848 146803430 Rat 1300139 Hrtrt6 Heart rate QTL 6 2.85 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 4 39524264 116179656 Rat 70200 Alc18 Alcohol consumption QTL 18 9.2 drinking behavior trait (VT:0001422) ethanol intake volume to total fluid intake volume ratio (CMO:0001591) 4 56647873 149491524 Rat 12798520 Anxrr55 Anxiety related response QTL 55 4.45 0.01 locomotor behavior trait (VT:0001392) number of rearing movements with lid-pushing in an experimental apparatus (CMO:0002715) 4 32583980 114627242 Rat 4889969 Bss96 Bone structure and strength QTL 96 4.9 tibia size trait (VT:0100001) tibia cortical bone volume (CMO:0001725) 4 56647776 78882945 Rat 2316958 Gluco58 Glucose level QTL 58 10 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 4 11320076 180699135 Rat 4889972 Bss97 Bone structure and strength QTL 97 5.6 tibia size trait (VT:0100001) tibia total bone volume (CMO:0001724) 4 56647776 78882945 Rat
RH129669
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 4 57,041,289 - 57,041,446 (+) MAPPER mRatBN7.2 Rnor_6.0 4 55,718,513 - 55,718,669 NCBI Rnor6.0 Rnor_5.0 4 55,465,960 - 55,466,116 UniSTS Rnor5.0 RGSC_v3.4 4 55,296,594 - 55,296,750 UniSTS RGSC3.4 Celera 4 52,152,874 - 52,153,030 UniSTS RH 3.4 Map 4 304.72 UniSTS Cytogenetic Map 4 q22 UniSTS
AA964078
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 4 57,041,210 - 57,041,421 (+) MAPPER mRatBN7.2 Rnor_6.0 4 55,718,434 - 55,718,644 NCBI Rnor6.0 Rnor_5.0 4 55,465,881 - 55,466,091 UniSTS Rnor5.0 RGSC_v3.4 4 55,296,515 - 55,296,725 UniSTS RGSC3.4 Celera 4 52,152,795 - 52,153,005 UniSTS RH 3.4 Map 4 306.3 UniSTS Cytogenetic Map 4 q22 UniSTS
stSG613726
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 4 57,041,434 - 57,042,151 (+) MAPPER mRatBN7.2 Rnor_6.0 4 55,718,658 - 55,719,374 NCBI Rnor6.0 Rnor_5.0 4 55,466,105 - 55,466,821 UniSTS Rnor5.0 RGSC_v3.4 4 55,296,739 - 55,297,455 UniSTS RGSC3.4 Celera 4 52,153,019 - 52,153,735 UniSTS Cytogenetic Map 4 q22 UniSTS
ARF5
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 4 58,004,096 - 58,004,713 (+) Marker Load Pipeline mRatBN7.2 4 57,038,646 - 57,039,263 (+) MAPPER mRatBN7.2 Rnor_6.0 4 55,715,870 - 55,716,486 NCBI Rnor6.0 Rnor_5.0 4 55,463,317 - 55,463,933 UniSTS Rnor5.0 RGSC_v3.4 4 55,293,951 - 55,294,567 UniSTS RGSC3.4 Celera 4 52,150,231 - 52,150,847 UniSTS Cytogenetic Map 4 q22 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000010246 ⟹ ENSRNOP00000010246
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 4 57,032,314 - 57,042,663 (-) Ensembl Rnor_6.0 Ensembl 4 55,709,096 - 55,713,620 (-) Ensembl
RefSeq Acc Id:
NM_001427123 ⟹ NP_001414052
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 4 57,996,267 - 58,002,185 (-) NCBI
RefSeq Acc Id:
XM_006236234 ⟹ XP_006236296
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 4 57,996,261 - 58,003,909 (-) NCBI mRatBN7.2 4 57,030,817 - 57,038,449 (-) NCBI Rnor_6.0 4 55,708,040 - 55,715,654 (-) NCBI Rnor_5.0 4 55,455,487 - 55,467,326 (-) NCBI
Sequence:
TAGGCGCGTTTGCGGAAGAACTGAAGTCGAGCGAGGCCTGGCAGCCTGCCTGGGGCGGAGGGCTTGTTCGGGGTCGCTAGTCTCCGCATGACTTTGCTTTACTCTTAAGTCATAGACTTGCACTCGTA
hide sequence
RefSeq Acc Id:
XM_006236235 ⟹ XP_006236297
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 4 57,996,261 - 58,008,126 (-) NCBI mRatBN7.2 4 57,030,817 - 57,042,682 (-) NCBI Rnor_6.0 4 55,708,040 - 55,719,884 (-) NCBI Rnor_5.0 4 55,455,487 - 55,467,326 (-) NCBI
Sequence:
CAATCATGAGCCAAAGGAAGTGGGGTCCTGTGCTTTGGGCGTTTGTCTTTGTAACCCCAAGCAATGAGCTGTTGTGGCTCTGTCCAGGGCTGCAAGAACGCTGACGTGGAGCATCCCACTCCGGAACC
hide sequence
RefSeq Acc Id:
XM_039108620 ⟹ XP_038964548
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 4 57,996,261 - 58,008,121 (-) NCBI mRatBN7.2 4 57,030,817 - 57,042,144 (-) NCBI
RefSeq Acc Id:
XP_006236297 ⟸ XM_006236235
- Peptide Label:
isoform X1
- UniProtKB:
D3ZPA1 (UniProtKB/TrEMBL), A6IEA5 (UniProtKB/TrEMBL)
- Sequence:
MEKFGMNFGGGPSKKDLLETIETQKKQLLQYQARLKDVVRAYKSLLKEKEALEASIKVLSVSHEADAGLSGVQPPGLTFPDSVDDRCSTHSEDSTGTATSLDTAASLTSVKGEFGVEDDRVARGPLPP
hide sequence
RefSeq Acc Id:
XP_006236296 ⟸ XM_006236234
- Peptide Label:
isoform X1
- UniProtKB:
D3ZPA1 (UniProtKB/TrEMBL), A6IEA5 (UniProtKB/TrEMBL)
- Sequence:
MEKFGMNFGGGPSKKDLLETIETQKKQLLQYQARLKDVVRAYKSLLKEKEALEASIKVLSVSHE
hide sequence
Ensembl Acc Id:
ENSRNOP00000010246 ⟸ ENSRNOT00000010246
RefSeq Acc Id:
XP_038964548 ⟸ XM_039108620
- Peptide Label:
isoform X1
- UniProtKB:
D3ZPA1 (UniProtKB/TrEMBL), A6IEA5 (UniProtKB/TrEMBL)
RefSeq Acc Id:
NP_001414052 ⟸ NM_001427123
- UniProtKB:
A6IEA5 (UniProtKB/TrEMBL), D3ZPA1 (UniProtKB/TrEMBL)
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2012-08-13
Gcc1
GRIP and coiled-coil domain containing 1
LOC100361513
rCG28300-like
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2010-05-05
LOC100361513
rCG28300-like
Symbol and Name status set to provisional
70820 PROVISIONAL
