Symbol:
Bckdhb
Name:
branched chain keto acid dehydrogenase E1 subunit beta
RGD ID:
2197
Description:
Predicted to enable metal ion binding activity. Predicted to contribute to 3-methyl-2-oxobutanoate dehydrogenase (2-methylpropanoyl-transferring) activity and branched-chain alpha-keto acid dehydrogenase activity. Involved in response to cAMP; response to glucocorticoid; and response to nutrient. Predicted to be located in mitochondrion; nucleolus; and nucleoplasm. Predicted to be part of branched-chain alpha-ketoacid dehydrogenase complex. Human ortholog(s) of this gene implicated in maple syrup urine disease. Orthologous to human BCKDHB (branched chain keto acid dehydrogenase E1 subunit beta); PARTICIPATES IN 3-hydroxy-3-methylglutaryl-CoA lyase deficiency pathway; 3-hydroxyisobutyric aciduria pathway; 3-methylcrotonyl CoA carboxylase 1 deficiency pathway; INTERACTS WITH (+)-schisandrin B; 2,3,7,8-tetrachlorodibenzodioxine; 2,4-dinitrotoluene.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
2-oxoisovalerate dehydrogenase beta subunit; 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial; BCKDE1B; BCKDH E1-beta; branched chain keto acid dehydrogenase E1 beta; branched chain keto acid dehydrogenase E1, beta polypeptide; branched-chain alpha-keto acid dehydrogenase E1 component beta chain
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
BCKDHB (branched chain keto acid dehydrogenase E1 subunit beta) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):
Bckdhb (branched chain ketoacid dehydrogenase E1, beta polypeptide) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Bckdhb (branched chain keto acid dehydrogenase E1 subunit beta) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
BCKDHB (branched chain keto acid dehydrogenase E1 subunit beta) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
BCKDHB (branched chain keto acid dehydrogenase E1 subunit beta) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Bckdhb (branched chain keto acid dehydrogenase E1 subunit beta) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
BCKDHB (branched chain keto acid dehydrogenase E1 subunit beta) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
BCKDHB (branched chain keto acid dehydrogenase E1 subunit beta) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Bckdhb (branched chain keto acid dehydrogenase E1 subunit beta) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Mus musculus (house mouse):
Bckdhb (branched chain ketoacid dehydrogenase E1, beta polypeptide)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
BCKDHB (branched chain keto acid dehydrogenase E1 subunit beta)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
bckdhb (branched chain keto acid dehydrogenase E1, beta polypeptide)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
CG17691
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
bckd-1B
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
bckdhb
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER|PhylomeDB)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 8 93,725,277 - 93,907,799 (+) NCBI GRCr8 mRatBN7.2 8 84,845,264 - 85,027,812 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 8 84,845,264 - 85,027,812 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 8 90,455,709 - 90,650,254 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 8 88,674,196 - 88,861,198 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 8 86,547,567 - 86,729,703 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 8 91,464,229 - 91,656,134 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 8 91,464,229 - 91,656,134 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 8 90,982,516 - 91,173,706 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 8 88,997,979 - 89,191,017 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 8 89,017,545 - 89,210,461 (+) NCBI Celera 8 84,492,980 - 84,673,845 (+) NCBI Celera RH 3.4 Map 8 981.4 RGD Cytogenetic Map 8 q31 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Bckdhb Rat (+)-schisandrin B multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of BCKDHB mRNA] CTD PMID:31150632 Bckdhb Rat 1,1-dichloroethene decreases expression ISO Bckdhb (Mus musculus) 6480464 vinylidene chloride results in decreased expression of BCKDHB mRNA CTD PMID:26682919 Bckdhb Rat 1,2-dimethylhydrazine multiple interactions ISO Bckdhb (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of BCKDHB mRNA CTD PMID:22206623 Bckdhb Rat 1,2-dimethylhydrazine decreases expression ISO Bckdhb (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of BCKDHB mRNA CTD PMID:22206623 Bckdhb Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Bckdhb (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of BCKDHB mRNA CTD PMID:21570461 Bckdhb Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of BCKDHB mRNA CTD PMID:33387578 and PMID:34747641 Bckdhb Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of BCKDHB mRNA CTD PMID:32109520 Bckdhb Rat 2,4-dinitrotoluene affects expression EXP 6480464 2 and 4-dinitrotoluene affects the expression of BCKDHB mRNA CTD PMID:21346803 Bckdhb Rat 4,4'-sulfonyldiphenol increases expression ISO BCKDHB (Homo sapiens) 6480464 bisphenol S results in increased expression of BCKDHB protein CTD PMID:34186270 Bckdhb Rat 4-hydroxyphenyl retinamide decreases expression ISO Bckdhb (Mus musculus) 6480464 Fenretinide results in decreased expression of BCKDHB mRNA CTD PMID:28973697 Bckdhb Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of BCKDHB mRNA CTD PMID:30047161 Bckdhb Rat acrylamide decreases expression ISO BCKDHB (Homo sapiens) 6480464 Acrylamide results in decreased expression of BCKDHB mRNA CTD PMID:32763439 Bckdhb Rat aflatoxin B1 decreases expression ISO Bckdhb (Mus musculus) 6480464 Aflatoxin B1 results in decreased expression of BCKDHB mRNA CTD PMID:19770486 Bckdhb Rat aflatoxin B1 increases methylation ISO BCKDHB (Homo sapiens) 6480464 Aflatoxin B1 results in increased methylation of BCKDHB intron CTD PMID:30157460 Bckdhb Rat aflatoxin B1 decreases methylation ISO BCKDHB (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of BCKDHB gene CTD PMID:27153756 Bckdhb Rat aflatoxin B1 decreases expression ISO BCKDHB (Homo sapiens) 6480464 Aflatoxin B1 results in decreased expression of BCKDHB mRNA CTD PMID:21641981 Bckdhb Rat all-trans-retinoic acid decreases expression ISO BCKDHB (Homo sapiens) 6480464 Tretinoin results in decreased expression of BCKDHB mRNA CTD PMID:33167477 Bckdhb Rat amitrole increases expression EXP 6480464 Amitrole results in increased expression of BCKDHB mRNA CTD PMID:30047161 Bckdhb Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of BCKDHB mRNA CTD PMID:16483693 Bckdhb Rat amphetamine decreases expression EXP 6480464 Amphetamine results in decreased expression of BCKDHB mRNA CTD PMID:30779732 Bckdhb Rat antirheumatic drug increases expression ISO BCKDHB (Homo sapiens) 6480464 Antirheumatic Agents results in increased expression of BCKDHB mRNA CTD PMID:24449571 Bckdhb Rat aristolochic acid A decreases expression ISO BCKDHB (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of BCKDHB mRNA CTD PMID:33212167 Bckdhb Rat benzo[a]pyrene decreases expression ISO Bckdhb (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of BCKDHB mRNA CTD PMID:19770486 and PMID:21715664 Bckdhb Rat benzo[a]pyrene affects methylation ISO BCKDHB (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of BCKDHB intron CTD PMID:30157460 Bckdhb Rat benzo[a]pyrene decreases expression ISO BCKDHB (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of BCKDHB mRNA CTD PMID:22316170 more ... Bckdhb Rat benzo[a]pyrene increases expression ISO Bckdhb (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of BCKDHB mRNA CTD PMID:22228805 Bckdhb Rat benzo[a]pyrene multiple interactions ISO Bckdhb (Mus musculus) 6480464 AHR protein affects the reaction [Benzo(a)pyrene affects the expression of BCKDHB mRNA] CTD PMID:22228805 Bckdhb Rat benzo[e]pyrene increases methylation ISO BCKDHB (Homo sapiens) 6480464 benzo(e)pyrene results in increased methylation of BCKDHB intron CTD PMID:30157460 Bckdhb Rat beta-lapachone decreases expression ISO BCKDHB (Homo sapiens) 6480464 beta-lapachone results in decreased expression of BCKDHB mRNA CTD PMID:38218311 Bckdhb Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of BCKDHB mRNA CTD PMID:30903817 Bckdhb Rat bisphenol A decreases expression ISO BCKDHB (Homo sapiens) 6480464 bisphenol A results in decreased expression of BCKDHB protein CTD PMID:34186270 Bckdhb Rat bisphenol A increases expression ISO BCKDHB (Homo sapiens) 6480464 bisphenol A results in increased expression of BCKDHB protein CTD PMID:33376534 Bckdhb Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of BCKDHB protein CTD PMID:32145629 Bckdhb Rat bisphenol AF increases expression ISO BCKDHB (Homo sapiens) 6480464 bisphenol AF results in increased expression of BCKDHB protein CTD PMID:34186270 Bckdhb Rat Bisphenol B increases expression ISO BCKDHB (Homo sapiens) 6480464 bisphenol B results in increased expression of BCKDHB protein CTD PMID:34186270 Bckdhb Rat butanal decreases expression ISO BCKDHB (Homo sapiens) 6480464 butyraldehyde results in decreased expression of BCKDHB mRNA CTD PMID:26079696 Bckdhb Rat C60 fullerene decreases expression EXP 6480464 fullerene C60 results in decreased expression of BCKDHB mRNA CTD PMID:19167457 Bckdhb Rat chromium trinitrate decreases expression ISO Bckdhb (Mus musculus) 6480464 chromium nitrate results in decreased expression of BCKDHB protein CTD PMID:22144121 Bckdhb Rat chromium(6+) affects expression ISO Bckdhb (Mus musculus) 6480464 chromium hexavalent ion affects the expression of BCKDHB mRNA CTD PMID:28472532 Bckdhb Rat chrysene decreases expression ISO Bckdhb (Mus musculus) 6480464 chrysene results in decreased expression of BCKDHB mRNA CTD PMID:26377693 Bckdhb Rat cisplatin decreases expression ISO Bckdhb (Mus musculus) 6480464 Cisplatin results in decreased expression of BCKDHB mRNA CTD PMID:24280081 Bckdhb Rat cisplatin multiple interactions ISO BCKDHB (Homo sapiens) 6480464 [Cisplatin co-treated with jinfukang] results in increased expression of BCKDHB mRNA CTD PMID:27392435 Bckdhb Rat cisplatin decreases expression ISO BCKDHB (Homo sapiens) 6480464 Cisplatin results in decreased expression of BCKDHB mRNA CTD PMID:24280081 Bckdhb Rat cobalt dichloride decreases expression ISO BCKDHB (Homo sapiens) 6480464 cobaltous chloride results in decreased expression of BCKDHB mRNA CTD PMID:19376846 Bckdhb Rat copper atom decreases expression EXP 6480464 Copper results in decreased expression of BCKDHB mRNA CTD PMID:22465980 Bckdhb Rat copper atom increases expression EXP 6480464 Copper results in increased expression of BCKDHB mRNA CTD PMID:30556269 Bckdhb Rat copper(0) decreases expression EXP 6480464 Copper results in decreased expression of BCKDHB mRNA CTD PMID:22465980 Bckdhb Rat copper(0) increases expression EXP 6480464 Copper results in increased expression of BCKDHB mRNA CTD PMID:30556269 Bckdhb Rat copper(II) sulfate decreases expression ISO BCKDHB (Homo sapiens) 6480464 Copper Sulfate results in decreased expression of BCKDHB mRNA CTD PMID:19549813 Bckdhb Rat corosolic acid decreases expression ISO BCKDHB (Homo sapiens) 6480464 corosolic acid results in decreased expression of BCKDHB mRNA CTD PMID:37939859 Bckdhb Rat coumestrol decreases expression ISO BCKDHB (Homo sapiens) 6480464 Coumestrol results in decreased expression of BCKDHB mRNA CTD PMID:19167446 Bckdhb Rat Cuprizon increases expression EXP 6480464 Cuprizone results in increased expression of BCKDHB mRNA CTD PMID:26577399 Bckdhb Rat cyclosporin A decreases expression ISO BCKDHB (Homo sapiens) 6480464 Cyclosporine results in decreased expression of BCKDHB mRNA CTD PMID:20106945 and PMID:25562108 Bckdhb Rat dibutyl phthalate decreases expression EXP 6480464 Dibutyl Phthalate results in decreased expression of BCKDHB mRNA CTD PMID:21266533 Bckdhb Rat dibutyl phthalate decreases expression ISO Bckdhb (Mus musculus) 6480464 Dibutyl Phthalate results in decreased expression of BCKDHB mRNA CTD PMID:17361019 and PMID:21266533 Bckdhb Rat doxorubicin decreases expression ISO Bckdhb (Mus musculus) 6480464 Doxorubicin results in decreased expression of BCKDHB mRNA CTD PMID:26873546 Bckdhb Rat doxorubicin decreases expression ISO BCKDHB (Homo sapiens) 6480464 Doxorubicin results in decreased expression of BCKDHB mRNA CTD PMID:29803840 Bckdhb Rat ethyl methanesulfonate decreases expression ISO BCKDHB (Homo sapiens) 6480464 Ethyl Methanesulfonate results in decreased expression of BCKDHB mRNA CTD PMID:23649840 Bckdhb Rat folic acid multiple interactions ISO Bckdhb (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of BCKDHB mRNA CTD PMID:22206623 Bckdhb Rat formaldehyde decreases expression ISO BCKDHB (Homo sapiens) 6480464 Formaldehyde results in decreased expression of BCKDHB mRNA CTD PMID:23649840 Bckdhb Rat glyphosate affects methylation EXP 6480464 Glyphosate affects the methylation of BCKDHB gene CTD PMID:35440735 Bckdhb Rat indometacin decreases expression EXP 6480464 Indomethacin results in decreased expression of BCKDHB mRNA CTD PMID:36868495 Bckdhb Rat isotretinoin decreases expression ISO BCKDHB (Homo sapiens) 6480464 Isotretinoin results in decreased expression of BCKDHB mRNA CTD PMID:20436886 Bckdhb Rat ivermectin decreases expression ISO BCKDHB (Homo sapiens) 6480464 Ivermectin results in decreased expression of BCKDHB protein CTD PMID:32959892 Bckdhb Rat maneb multiple interactions ISO Bckdhb (Mus musculus) 6480464 [Maneb co-treated with Paraquat] results in decreased expression of BCKDHB mRNA CTD PMID:36117858 Bckdhb Rat methapyrilene increases methylation ISO BCKDHB (Homo sapiens) 6480464 Methapyrilene results in increased methylation of BCKDHB intron CTD PMID:30157460 Bckdhb Rat methimazole increases expression EXP 6480464 Methimazole results in increased expression of BCKDHB mRNA CTD PMID:30047161 Bckdhb Rat methyl methanesulfonate decreases expression ISO BCKDHB (Homo sapiens) 6480464 Methyl Methanesulfonate results in decreased expression of BCKDHB mRNA CTD PMID:23649840 Bckdhb Rat methylmercury chloride decreases expression ISO BCKDHB (Homo sapiens) 6480464 methylmercuric chloride results in decreased expression of BCKDHB mRNA CTD PMID:28001369 Bckdhb Rat N-nitrosodiethylamine increases expression ISO Bckdhb (Mus musculus) 6480464 Diethylnitrosamine results in increased expression of BCKDHB mRNA CTD PMID:17942915 Bckdhb Rat N-nitrosodiethylamine multiple interactions ISO Bckdhb (Mus musculus) 6480464 MET protein inhibits the reaction [Diethylnitrosamine results in increased expression of BCKDHB mRNA] CTD PMID:17942915 Bckdhb Rat N-Nitrosopyrrolidine decreases expression ISO BCKDHB (Homo sapiens) 6480464 N-Nitrosopyrrolidine results in decreased expression of BCKDHB mRNA CTD PMID:32234424 Bckdhb Rat nickel atom decreases expression ISO BCKDHB (Homo sapiens) 6480464 Nickel results in decreased expression of BCKDHB mRNA CTD PMID:24768652 and PMID:25583101 Bckdhb Rat nitroglycerin decreases expression EXP 6480464 Nitroglycerin results in decreased expression of BCKDHB mRNA CTD PMID:12102619 Bckdhb Rat O-methyleugenol decreases expression ISO BCKDHB (Homo sapiens) 6480464 methyleugenol results in decreased expression of BCKDHB mRNA CTD PMID:32234424 Bckdhb Rat oxaliplatin multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of BCKDHB mRNA CTD PMID:25729387 Bckdhb Rat ozone multiple interactions ISO Bckdhb (Mus musculus) 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in decreased expression of BCKDHB mRNA CTD PMID:34911549 Bckdhb Rat ozone multiple interactions ISO BCKDHB (Homo sapiens) 6480464 [Air Pollutants results in increased abundance of Ozone] which affects the expression of BCKDHB mRNA CTD PMID:35430440 Bckdhb Rat paracetamol decreases expression ISO BCKDHB (Homo sapiens) 6480464 Acetaminophen results in decreased expression of BCKDHB mRNA CTD PMID:29067470 Bckdhb Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of BCKDHB mRNA CTD PMID:33387578 Bckdhb Rat paraquat increases expression ISO Bckdhb (Mus musculus) 6480464 Paraquat results in increased expression of BCKDHB mRNA CTD PMID:21371552 Bckdhb Rat paraquat multiple interactions ISO Bckdhb (Mus musculus) 6480464 [Maneb co-treated with Paraquat] results in decreased expression of BCKDHB mRNA CTD PMID:36117858 Bckdhb Rat phlorizin decreases expression ISO Bckdhb (Mus musculus) 6480464 Phlorhizin results in decreased expression of BCKDHB mRNA CTD PMID:22538082 Bckdhb Rat pirinixic acid decreases expression ISO Bckdhb (Mus musculus) 6480464 pirinixic acid results in decreased expression of BCKDHB mRNA CTD PMID:17426115 Bckdhb Rat pirinixic acid increases expression ISO Bckdhb (Mus musculus) 6480464 pirinixic acid results in increased expression of BCKDHB mRNA CTD PMID:23811191 Bckdhb Rat potassium chromate increases expression ISO Bckdhb (Mus musculus) 6480464 potassium chromate(VI) results in increased expression of BCKDHB protein CTD PMID:22144121 Bckdhb Rat resveratrol multiple interactions ISO BCKDHB (Homo sapiens) 6480464 [Plant Extracts co-treated with Resveratrol] results in increased expression of BCKDHB mRNA CTD PMID:23557933 Bckdhb Rat silicon dioxide decreases expression ISO BCKDHB (Homo sapiens) 6480464 Silicon Dioxide analog results in decreased expression of BCKDHB mRNA and Silicon Dioxide results in decreased expression of BCKDHB mRNA CTD PMID:25351596 and PMID:25895662 Bckdhb Rat sodium arsenite increases expression EXP 6480464 sodium arsenite results in increased expression of BCKDHB protein CTD PMID:29459688 Bckdhb Rat sodium arsenite decreases expression ISO BCKDHB (Homo sapiens) 6480464 sodium arsenite results in decreased expression of BCKDHB mRNA CTD PMID:38568856 Bckdhb Rat sulfadimethoxine increases expression EXP 6480464 Sulfadimethoxine results in increased expression of BCKDHB mRNA CTD PMID:30047161 Bckdhb Rat Tanshinone I decreases expression ISO BCKDHB (Homo sapiens) 6480464 tanshinone results in decreased expression of BCKDHB mRNA CTD PMID:15849732 Bckdhb Rat tetrachloromethane multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of BCKDHB mRNA] CTD PMID:31150632 Bckdhb Rat tetrachloromethane decreases expression ISO Bckdhb (Mus musculus) 6480464 Carbon Tetrachloride results in decreased expression of BCKDHB mRNA CTD PMID:31919559 Bckdhb Rat tetrachloromethane decreases expression EXP 6480464 Carbon Tetrachloride results in decreased expression of BCKDHB mRNA CTD PMID:31150632 Bckdhb Rat thioacetamide decreases expression EXP 6480464 Thioacetamide results in decreased expression of BCKDHB mRNA CTD PMID:34492290 Bckdhb Rat thiram decreases expression ISO BCKDHB (Homo sapiens) 6480464 Thiram results in decreased expression of BCKDHB mRNA CTD PMID:38568856 Bckdhb Rat titanium dioxide decreases expression ISO Bckdhb (Mus musculus) 6480464 titanium dioxide results in decreased expression of BCKDHB mRNA CTD PMID:23557971 Bckdhb Rat topotecan multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of BCKDHB mRNA CTD PMID:25729387 Bckdhb Rat triphenyl phosphate affects expression ISO BCKDHB (Homo sapiens) 6480464 triphenyl phosphate affects the expression of BCKDHB mRNA CTD PMID:37042841 Bckdhb Rat tunicamycin decreases expression ISO BCKDHB (Homo sapiens) 6480464 Tunicamycin results in decreased expression of BCKDHB mRNA CTD PMID:22378314 Bckdhb Rat urethane decreases expression ISO BCKDHB (Homo sapiens) 6480464 Urethane results in decreased expression of BCKDHB mRNA CTD PMID:28818685 Bckdhb Rat valproic acid decreases methylation ISO BCKDHB (Homo sapiens) 6480464 Valproic Acid results in decreased methylation of BCKDHB gene CTD PMID:29154799 Bckdhb Rat valproic acid increases expression ISO BCKDHB (Homo sapiens) 6480464 Valproic Acid results in increased expression of BCKDHB mRNA CTD PMID:23179753 and PMID:27188386 Bckdhb Rat valproic acid affects expression ISO BCKDHB (Homo sapiens) 6480464 Valproic Acid affects the expression of BCKDHB mRNA CTD PMID:25979313 Bckdhb Rat vancomycin increases expression ISO Bckdhb (Mus musculus) 6480464 Vancomycin results in increased expression of BCKDHB mRNA CTD PMID:18930951
Imported Annotations - SMPDB
Imported Annotations - KEGG (archival)
(+)-schisandrin B (EXP) 1,1-dichloroethene (ISO) 1,2-dimethylhydrazine (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-dinitrotoluene (EXP) 4,4'-sulfonyldiphenol (ISO) 4-hydroxyphenyl retinamide (ISO) 6-propyl-2-thiouracil (EXP) acrylamide (ISO) aflatoxin B1 (ISO) all-trans-retinoic acid (ISO) amitrole (EXP) ammonium chloride (EXP) amphetamine (EXP) antirheumatic drug (ISO) aristolochic acid A (ISO) benzo[a]pyrene (ISO) benzo[e]pyrene (ISO) beta-lapachone (ISO) bisphenol A (EXP,ISO) bisphenol AF (ISO) Bisphenol B (ISO) butanal (ISO) C60 fullerene (EXP) chromium trinitrate (ISO) chromium(6+) (ISO) chrysene (ISO) cisplatin (ISO) cobalt dichloride (ISO) copper atom (EXP) copper(0) (EXP) copper(II) sulfate (ISO) corosolic acid (ISO) coumestrol (ISO) Cuprizon (EXP) cyclosporin A (ISO) dibutyl phthalate (EXP,ISO) doxorubicin (ISO) ethyl methanesulfonate (ISO) folic acid (ISO) formaldehyde (ISO) glyphosate (EXP) indometacin (EXP) isotretinoin (ISO) ivermectin (ISO) maneb (ISO) methapyrilene (ISO) methimazole (EXP) methyl methanesulfonate (ISO) methylmercury chloride (ISO) N-nitrosodiethylamine (ISO) N-Nitrosopyrrolidine (ISO) nickel atom (ISO) nitroglycerin (EXP) O-methyleugenol (ISO) oxaliplatin (EXP) ozone (ISO) paracetamol (EXP,ISO) paraquat (ISO) phlorizin (ISO) pirinixic acid (ISO) potassium chromate (ISO) resveratrol (ISO) silicon dioxide (ISO) sodium arsenite (EXP,ISO) sulfadimethoxine (EXP) Tanshinone I (ISO) tetrachloromethane (EXP,ISO) thioacetamide (EXP) thiram (ISO) titanium dioxide (ISO) topotecan (EXP) triphenyl phosphate (ISO) tunicamycin (ISO) urethane (ISO) valproic acid (ISO) vancomycin (ISO)
1.
Regulation of gene expression of branched-chain keto acid dehydrogenase complex in primary cultured hepatocytes by dexamethasone and a cAMP analog.
Chicco AG, etal., J Biol Chem. 1994 Jul 29;269(30):19427-34.
2.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.
High-density rat radiation hybrid maps containing over 24,000 SSLPs, genes, and ESTs provide a direct link to the rat genome sequence.
Kwitek AE, etal., Genome Res. 2004 Apr;14(4):750-7
4.
Posttranscriptional alterations in protein masses of hepatic branched-chain keto acid dehydrogenase and its associated kinase in diabetes.
Lombardo YB, etal., Proc Assoc Am Physicians. 1998 Jan-Feb;110(1):40-9.
5.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
6.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
7.
Maple syrup urine disease. Complete defect of the E1 beta subunit of the branched chain alpha-ketoacid dehydrogenase complex due to a deletion of an 11-bp repeat sequence which encodes a mitochondrial targeting leader peptide in a family with the disease.
Nobukuni Y, etal., J Clin Invest. 1991 May;87(5):1862-6.
8.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
9.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
10.
SMPDB Annotation Import Pipeline
Pipeline to import SMPDB annotations from SMPDB into RGD
11.
GOA pipeline
RGD automated data pipeline
12.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
13.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
14.
Comprehensive gene review and curation
RGD comprehensive gene curation
15.
Purification of branched chain alpha-ketoacid dehydrogenase complex from rat liver.
Shimomura Y, etal., Anal Biochem. 1987 May 15;163(1):74-8.
16.
Tentative Sequence Identification Numbers
Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
17.
Effect of dietary protein on the liver content and subunit composition of the branched-chain alpha-ketoacid dehydrogenase complex.
Zhao Y, etal., Arch Biochem Biophys. 1994 Feb 1;308(2):446-53.
18.
Molecular cloning of the E1 beta subunit of the rat branched chain alpha-ketoacid dehydrogenase.
Zhao Y, etal., Biochim Biophys Acta 1992 Sep 24;1132(2):207-10.
Bckdhb Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 8 93,725,277 - 93,907,799 (+) NCBI GRCr8 mRatBN7.2 8 84,845,264 - 85,027,812 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 8 84,845,264 - 85,027,812 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 8 90,455,709 - 90,650,254 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 8 88,674,196 - 88,861,198 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 8 86,547,567 - 86,729,703 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 8 91,464,229 - 91,656,134 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 8 91,464,229 - 91,656,134 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 8 90,982,516 - 91,173,706 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 8 88,997,979 - 89,191,017 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 8 89,017,545 - 89,210,461 (+) NCBI Celera 8 84,492,980 - 84,673,845 (+) NCBI Celera RH 3.4 Map 8 981.4 RGD Cytogenetic Map 8 q31 NCBI
BCKDHB Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 6 80,106,610 - 80,466,676 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 6 80,106,647 - 80,346,270 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 6 80,816,327 - 81,172,940 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 6 80,873,083 - 81,112,706 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 6 80,873,082 - 81,112,706 NCBI Celera 6 81,237,906 - 81,477,561 (+) NCBI Celera Cytogenetic Map 6 q14.1 NCBI HuRef 6 78,039,157 - 78,278,814 (+) NCBI HuRef CHM1_1 6 80,913,790 - 81,153,760 (+) NCBI CHM1_1 T2T-CHM13v2.0 6 81,315,017 - 81,677,450 (+) NCBI T2T-CHM13v2.0
Bckdhb Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 9 83,807,190 - 84,006,293 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 9 83,807,198 - 84,006,293 (+) Ensembl GRCm39 Ensembl GRCm38 9 83,925,111 - 84,124,240 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 9 83,925,145 - 84,124,240 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 9 83,842,388 - 84,017,847 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 9 83,745,499 - 83,920,958 (+) NCBI MGSCv36 mm8 Celera 9 81,044,884 - 81,213,851 (+) NCBI Celera Cytogenetic Map 9 E2 NCBI cM Map 9 45.67 NCBI
Bckdhb Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955411 8,437,548 - 8,628,363 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955411 8,427,875 - 8,626,564 (+) NCBI ChiLan1.0 ChiLan1.0
BCKDHB Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 5 100,209,447 - 100,462,843 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 6 98,088,586 - 98,340,102 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 6 78,005,287 - 78,246,287 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 6 81,277,085 - 81,516,787 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 6 81,276,836 - 81,516,787 (+) Ensembl panpan1.1 panPan2
BCKDHB Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 12 41,009,798 - 41,224,802 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 12 41,009,730 - 41,224,802 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 12 40,881,519 - 41,096,408 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 12 41,775,384 - 41,991,512 (+) NCBI ROS_Cfam_1.0 UMICH_Zoey_3.1 12 41,088,764 - 41,303,619 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 12 41,063,571 - 41,271,816 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 12 41,216,793 - 41,431,727 (+) NCBI UU_Cfam_GSD_1.0
Bckdhb Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404946 76,389,357 - 76,568,118 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936510 9,902,670 - 10,081,587 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936510 9,904,703 - 10,081,532 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
BCKDHB Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 1 85,755,743 - 86,017,650 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 1 85,755,819 - 86,017,661 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 1 96,353,433 - 96,716,539 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
BCKDHB Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 13 4,845,481 - 5,087,558 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 13 4,845,457 - 5,087,745 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666040 181,063,803 - 181,307,482 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Bckdhb
.
Predicted Target Of
Count of predictions: 28 Count of miRNA genes: 26 Interacting mature miRNAs: 28 Transcripts: ENSRNOT00000013249 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1300177 Cm2 Cardiac mass QTL 2 3.65 heart mass (VT:0007028) heart weight (CMO:0000017) 8 54259986 100382532 Rat 1549909 Stresp11 Stress response QTL 11 6.83 0.0019 stress-related behavior trait (VT:0010451) number of approaches toward negative stimulus before onset of defensive burying response (CMO:0001960) 8 73473045 118473045 Rat 12879878 Bw183 Body weight QTL 183 0.001 body mass (VT:0001259) body weight (CMO:0000012) 8 43296169 98968765 Rat 1549908 Neudeg1 Neurodegradation QTL 1 5.5 0 nervous system integrity trait (VT:0010566) logarithm of the ratio of the lesioned side motor neuron count to contralateral side motor neuron count (CMO:0001986) 8 30188867 94457446 Rat 12879879 Cm99 Cardiac mass QTL 99 0.001 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 8 43296169 98968765 Rat 1554321 Bmd3 Bone mineral density QTL 3 7.9 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 8 40952565 123900184 Rat 9590292 Uminl3 Urine mineral level QTL 3 3.62 0.001 urine mineral amount (VT:0015086) urine electrolyte level (CMO:0000593) 8 71888757 116888757 Rat 1578769 Uae31 Urinary albumin excretion QTL 31 3.3 0.001 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 8 30848154 101699754 Rat 1298079 Activ2 Activity QTL 2 9.5 0.000001 voluntary movement trait (VT:0003491) rearing measurement (CMO:0001515) 8 41866876 86866876 Rat 12879880 Cm100 Cardiac mass QTL 100 0.001 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 8 43296169 98968765 Rat 12879881 Cm101 Cardiac mass QTL 101 0.001 heart right ventricle mass (VT:0007033) heart right ventricle weight to body weight ratio (CMO:0000914) 8 43296169 98968765 Rat 12879882 Am8 Aortic mass QTL 8 0.001 aorta mass (VT:0002845) aorta weight to aorta length to body weight ratio (CMO:0002722) 8 43296169 98968765 Rat 12879883 Kidm65 Kidney mass QTL 65 0.001 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 8 43296169 98968765 Rat 70161 Bp62 Blood pressure QTL 62 2.9 0.001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 8 42692684 90165460 Rat 1358912 Bw51 Body weight QTL 51 2.95 body mass (VT:0001259) body weight (CMO:0000012) 8 51351728 107062046 Rat 1578765 Klgr1 Kidney lesion grade QTL 1 3.3 0.0001 kidney morphology trait (VT:0002135) organ lesion measurement (CMO:0000677) 8 30848154 101699754 Rat 1300171 Bp184 Blood pressure QTL 184 3.66 arterial blood pressure trait (VT:2000000) blood pressure time series experimental set point of the baroreceptor response (CMO:0002593) 8 70513503 118219066 Rat 1578755 Pur5 Proteinuria QTL 5 3.3 0.0001 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 8 30848154 101699754 Rat 2303171 Bp331 Blood pressure QTL 331 5.57 0.005 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 8 61290298 119084929 Rat 631210 Bw3 Body weight QTL3 5.9 mesenteric fat pad mass (VT:0010427) mesenteric fat pad weight to body weight ratio (CMO:0000654) 8 69349194 112783834 Rat 2293697 Bmd39 Bone mineral density QTL 39 femur strength trait (VT:0010010) femur total energy absorbed before break (CMO:0001677) 8 54043744 98968765 Rat 8662823 Vetf5 Vascular elastic tissue fragility QTL 5 1.9 artery integrity trait (VT:0010639) patent ductus arteriosus score (CMO:0002566) 8 28242912 99525068 Rat 1358896 Bp262 Blood pressure QTL 262 2.89 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 8 27205715 99103503 Rat 731182 Uae24 Urinary albumin excretion QTL 24 6.4 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 8 19331152 93965294 Rat 1331837 Bw23 Body weight QTL 23 4.19 0.00007 body mass (VT:0001259) body weight (CMO:0000012) 8 46531722 99083736 Rat 1331838 Niddm61 Non-insulin dependent diabetes mellitus QTL 61 3.53 0.0004 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 8 36469535 99083736 Rat 8694446 Bw170 Body weight QTL 170 12.07 0.001 retroperitoneal fat pad mass (VT:0010430) retroperitoneal fat pad weight to body weight ratio (CMO:0000635) 8 71888757 116888757 Rat 631650 Stl6 Serum triglyceride level QTL 6 4 0.0019 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 8 10378157 112202585 Rat 631653 Bp125 Blood pressure QTL 125 3.3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 8 66142385 111142385 Rat 1581557 Eae16 Experimental allergic encephalomyelitis QTL 16 3.8 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046) 8 8462195 110921472 Rat 1358906 Bp253 Blood pressure QTL 253 4 0.0004 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 8 40713066 93965294 Rat 1358907 Cm40 Cardiac mass QTL 40 1.89 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 8 27205715 99103503 Rat 2303570 Gluco48 Glucose level QTL 48 2 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 8 49805831 94805831 Rat 70197 BpQTLcluster8 Blood pressure QTL cluster 8 3.482 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 8 46531639 119088626 Rat 2316950 Scl66 Serum cholesterol level QTL 66 4.1 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 8 30848259 105647037 Rat 1582254 Kidm31 Kidney mass QTL 31 3 kidney mass (VT:0002707) both kidneys wet weight (CMO:0000085) 8 54237644 85365202 Rat 2300181 Bmd55 Bone mineral density QTL 55 5.7 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 8 76468691 121468691 Rat 10402857 Bp380 Blood pressure QTL 380 0.95 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 8 53968765 98968765 Rat 1358892 Kidm26 Kidney mass QTL 26 3.69 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 8 27205715 99103503 Rat 631664 Hcar3 Hepatocarcinoma resistance QTL 3 2.9 0.0005 liver integrity trait (VT:0010547) volume of individual liver tumorous lesion (CMO:0001078) 8 54237644 99103503 Rat 2301402 Bp316 Blood pressure QTL 316 0.005 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 8 53968765 98968765 Rat 1582243 Bw66 Body weight QTL 66 3.4 0.0048 body mass (VT:0001259) body weight (CMO:0000012) 8 54237644 85365202 Rat 8694200 Abfw4 Abdominal fat weight QTL 4 9.07 0.001 visceral adipose mass (VT:0010063) abdominal fat pad weight to body weight ratio (CMO:0000095) 8 71888757 116888757 Rat 8694392 Bw161 Body weight QTL 161 8.06 0.001 body lean mass (VT:0010483) lean tissue morphological measurement (CMO:0002184) 8 71888757 116888757 Rat 61437 Cia6 Collagen induced arthritis QTL 6 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 8 82460758 122812818 Rat
D8Rat138
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 8 93,791,942 - 93,792,239 (+) Marker Load Pipeline mRatBN7.2 8 84,911,931 - 84,912,228 (+) MAPPER mRatBN7.2 Rnor_6.0 8 91,530,881 - 91,531,177 NCBI Rnor6.0 Rnor_5.0 8 91,049,017 - 91,049,313 UniSTS Rnor5.0 RGSC_v3.4 8 89,064,468 - 89,064,925 RGD RGSC3.4 RGSC_v3.4 8 89,064,544 - 89,064,840 UniSTS RGSC3.4 RGSC_v3.1 8 89,083,999 - 89,084,295 RGD Celera 8 84,559,684 - 84,559,980 UniSTS RH 3.4 Map 8 980.5 UniSTS RH 3.4 Map 8 980.5 RGD RH 2.0 Map 8 772.9 RGD SHRSP x BN Map 8 48.21 RGD Cytogenetic Map 8 q31 UniSTS
BE104808
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 8 85,010,652 - 85,010,823 (+) MAPPER mRatBN7.2 Rnor_6.0 8 91,639,015 - 91,639,185 NCBI Rnor6.0 Rnor_5.0 8 91,156,322 - 91,156,492 UniSTS Rnor5.0 RGSC_v3.4 8 89,173,539 - 89,173,709 UniSTS RGSC3.4 Celera 8 84,656,087 - 84,656,257 UniSTS RH 3.4 Map 8 980.5 UniSTS Cytogenetic Map 8 q31 UniSTS
RH142183
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 8 93,907,606 - 93,907,773 (+) Marker Load Pipeline mRatBN7.2 8 85,027,619 - 85,027,786 (+) MAPPER mRatBN7.2 Rnor_6.0 8 91,655,942 - 91,656,108 NCBI Rnor6.0 Rnor_5.0 8 91,173,512 - 91,173,678 UniSTS Rnor5.0 RGSC_v3.4 8 89,190,825 - 89,190,991 UniSTS RGSC3.4 Celera 8 84,673,653 - 84,673,819 UniSTS RH 3.4 Map 8 981.4 UniSTS Cytogenetic Map 8 q31 UniSTS
BE114464
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 8 84,843,984 - 84,844,169 (+) MAPPER mRatBN7.2 Rnor_6.0 8 91,462,950 - 91,463,134 NCBI Rnor6.0 Rnor_5.0 8 90,981,240 - 90,981,424 UniSTS Rnor5.0 RGSC_v3.4 8 88,996,700 - 88,996,884 UniSTS RGSC3.4 Celera 8 84,491,701 - 84,491,885 UniSTS RH 3.4 Map 8 980.5 UniSTS Cytogenetic Map 8 q31 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000013249 ⟹ ENSRNOP00000013249
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 8 84,845,264 - 85,027,812 (+) Ensembl Rnor_6.0 Ensembl 8 91,464,229 - 91,656,134 (+) Ensembl
RefSeq Acc Id:
NM_019267 ⟹ NP_062140
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 93,725,277 - 93,907,799 (+) NCBI mRatBN7.2 8 84,845,264 - 85,027,812 (+) NCBI Rnor_6.0 8 91,464,229 - 91,656,134 (+) NCBI Rnor_5.0 8 90,982,516 - 91,173,706 (+) NCBI RGSC_v3.4 8 88,997,979 - 89,191,017 (+) RGD Celera 8 84,492,980 - 84,673,845 (+) RGD
Sequence:
CGTGGGCTGCGGTGCCTGAGAACCCGGGATGGCGGCGGTGGCTGCGCGCGCCGGTGGGCTGCTGCGGCTCGGGGCTGCAGGAGCGGAGCGGCGGCGGCGCGGATTGCGCTGCGCTGCGCTGGTGCAAG
hide sequence
RefSeq Acc Id:
NP_062140 ⟸ NM_019267
- Peptide Label:
precursor
- UniProtKB:
P35738 (UniProtKB/Swiss-Prot), A6I1S6 (UniProtKB/TrEMBL), A0A0A0MXW1 (UniProtKB/TrEMBL)
- Sequence:
MAAVAARAGGLLRLGAAGAERRRRGLRCAALVQGFLQPAVDDASQKRRVAHFTFQPDPESLQYGQTQKMNLFQSITSALDNSLAKDPTAVIFGEDVAFGGVFRCTVGLRDKYGKDRVFNTPLCEQGIV
hide sequence
Ensembl Acc Id:
ENSRNOP00000013249 ⟸ ENSRNOT00000013249
RGD ID: 13696155 Promoter ID: EPDNEW_R6680 Type: multiple initiation site Name: Bckdhb_1 Description: branched chain keto acid dehydrogenase E1 subunit beta SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 8 91,464,246 - 91,464,306 EPDNEW
BioCyc Gene G2FUF-29671 BioCyc
BioCyc Pathway ILEUDEG-PWY [L-isoleucine degradation I] BioCyc
LEU-DEG2-PWY [L-leucine degradation I] BioCyc
PWY-5046 [2-oxoisovalerate decarboxylation to isobutanoyl-CoA] BioCyc
PWY-5130 [2-oxobutanoate degradation I] BioCyc
PWY66-428 [L-threonine degradation V] BioCyc
VALDEG-PWY [L-valine degradation I] BioCyc
BioCyc Pathway Image ILEUDEG-PWY BioCyc
LEU-DEG2-PWY BioCyc
PWY-5046 BioCyc
PWY-5130 BioCyc
PWY66-428 BioCyc
VALDEG-PWY BioCyc
Ensembl Genes ENSRNOG00000009928 Ensembl, UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Ensembl Transcript ENSRNOT00000013249 UniProtKB/TrEMBL
ENSRNOT00000013249.7 UniProtKB/Swiss-Prot
Gene3D-CATH 3.40.50.920 UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
3.40.50.970 UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
IMAGE_CLONE IMAGE:7932093 IMAGE-MGC_LOAD
InterPro THDP-binding UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Transketo_C/PFOR_II UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Transketolase-like_Pyr-bd UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Transketolase_C UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report rno:29711 UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
MGC_CLONE MGC:188428 IMAGE-MGC_LOAD
NCBI Gene 29711 ENTREZGENE
PANTHER 2-OXOISOVALERATE DEHYDROGENASE SUBUNIT BETA, MITOCHONDRIAL UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
2-OXOISOVALERATE DEHYDROGENASE SUBUNIT BETA-RELATED UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam Transket_pyr UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Transketolase_C UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen Bckdhb PhenoGen
RatGTEx ENSRNOG00000009928 RatGTEx
SMART Transket_pyr UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP SSF52518 UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
SSF52922 UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
TIGR TC206577
UniProt A0A0A0MXW1 ENTREZGENE, UniProtKB/TrEMBL
A6I1S6 ENTREZGENE, UniProtKB/TrEMBL
B0BNK6_RAT UniProtKB/TrEMBL
ODBB_RAT UniProtKB/Swiss-Prot, ENTREZGENE
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-07-13
Bckdhb
branched chain keto acid dehydrogenase E1 subunit beta
Bckdhb
branched chain keto acid dehydrogenase E1, beta polypeptide
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2002-06-10
Bckdhb
branched chain keto acid dehydrogenase E1, beta polypeptide
Symbol and Name status set to approved
70586 APPROVED
