Advanced Search (OLGA)

Gene: Dbr1 (debranching RNA lariats 1) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Dbr1

Name:

debranching RNA lariats 1

RGD ID:

1598038

Description:

Predicted to enable RNA lariat debranching enzyme activity. Predicted to be involved in RNA fragment catabolic process and RNA splicing, via transesterification reactions. Predicted to act upstream of or within mRNA splicing, via spliceosome. Predicted to be located in nucleoplasm. Human ortholog(s) of this gene implicated in brain disease. Orthologous to human DBR1 (debranching RNA lariats 1); INTERACTS WITH bisphenol A; cadmium dichloride; Cuprizon.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

debranching enzyme homolog 1; debranching enzyme homolog 1 (S. cerevisiae); lariat debranching enzyme; LOC315950; LOC681234; similar to debranching enzyme homolog 1

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	DBR1 (debranching RNA lariats 1)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Dbr1 (debranching RNA lariats 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	DBR1 (debranching RNA lariats 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	DBR1 (debranching RNA lariats 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Dbr1 (debranching RNA lariats 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	DBR1 (debranching RNA lariats 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	DBR1 (debranching RNA lariats 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Dbr1 (debranching RNA lariats 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	DBR1 (debranching RNA lariats 1)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Dbr1 (debranching RNA lariats 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	dbr1 (debranching RNA lariats 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	DBR1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	dbr-1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	ldbr	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	dbr1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	8	109,018,364 - 109,030,092 (+)	NCBI		GRCr8
mRatBN7.2	8	100,139,039 - 100,150,768 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	8	100,139,034 - 100,151,030 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	8	105,805,842 - 105,817,525 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	8	104,005,138 - 104,016,821 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	8	101,847,672 - 101,859,355 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	8	107,826,690 - 107,838,186 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	8	107,826,424 - 107,838,339 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	8	107,251,356 - 107,262,732 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	8	104,443,418 - 104,455,249 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	8	99,539,355 - 99,551,081 (+)	NCBI		Celera
Cytogenetic Map	8	q31	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Dbr1	Rat	ENCEPHALITIS, ACUTE, INFECTION (VIRAL)-INDUCED, SUSCEPTIBILITY TO, 11		ISO	RGD:1323625	8554872	ClinVar Annotator: match by term: DBR1-related condition \| ClinVar Annotator: match by term: Encephalitis, acute, more ...	ClinVar	PMID:25741868\|PMID:28492532\|PMID:29474921\|PMID:37656279
Dbr1	Rat	genetic disease		ISO	RGD:1323625	8554872	ClinVar Annotator: match by term: Inborn genetic diseases	ClinVar	PMID:28492532
Dbr1	Rat	XEROSIS AND GROWTH FAILURE WITH IMMUNE AND PULMONARY DYSFUNCTION SYNDROME		ISO	RGD:1323625	8554872	ClinVar Annotator: match by term: Xerosis and growth failure with immune and pulmonary dysfunction syndrome	ClinVar	PMID:25741868\|PMID:37656279

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Dbr1	Rat	amyotrophic lateral sclerosis		ISO	RGD:1323625	11554173	CTD Direct Evidence: therapeutic	CTD	PMID:23104007

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Dbr1	Rat	ENCEPHALITIS, ACUTE, INFECTION (VIRAL)-INDUCED, SUSCEPTIBILITY TO, 11	susceptibility	ISO	RGD:1323625	7240710		OMIM
Dbr1	Rat	XEROSIS AND GROWTH FAILURE WITH IMMUNE AND PULMONARY DYSFUNCTION SYNDROME	susceptibility	ISO	RGD:1323625	7240710		OMIM

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Dbr1	Rat	1,2-dimethylhydrazine	increases expression	ISO	RGD:1619922	6480464	1,2-Dimethylhydrazine results in increased expression of DBR1 mRNA	CTD	PMID:22206623
Dbr1	Rat	2,3,7,8-tetrachlorodibenzodioxine	affects expression	ISO	RGD:1619922	6480464	Tetrachlorodibenzodioxin affects the expression of DBR1 mRNA	CTD	PMID:21570461
Dbr1	Rat	2,3,7,8-tetrachlorodibenzodioxine	decreases expression	ISO	RGD:1323625	6480464	Tetrachlorodibenzodioxin results in decreased expression of DBR1 mRNA	CTD	PMID:29704546
Dbr1	Rat	acrylamide	decreases expression	ISO	RGD:1323625	6480464	Acrylamide results in decreased expression of DBR1 mRNA	CTD	PMID:32763439
Dbr1	Rat	aflatoxin B1	increases expression	ISO	RGD:1619922	6480464	Aflatoxin B1 results in increased expression of DBR1 mRNA	CTD	PMID:19770486
Dbr1	Rat	arsane	multiple interactions	ISO	RGD:1323625	6480464	[sodium arsenite results in increased abundance of Arsenic] which results in increased expression of DBR1 more ...	CTD	PMID:39836092
Dbr1	Rat	arsenic atom	multiple interactions	ISO	RGD:1323625	6480464	[sodium arsenite results in increased abundance of Arsenic] which results in increased expression of DBR1 more ...	CTD	PMID:39836092
Dbr1	Rat	benzo[a]pyrene	multiple interactions	ISO	RGD:1619922	6480464	Benzo(a)pyrene promotes the reaction [AHR protein binds to DBR1 promoter]	CTD	PMID:19654925
Dbr1	Rat	bisphenol A	increases expression	EXP		6480464	bisphenol A results in increased expression of DBR1 mRNA	CTD	PMID:25181051\|PMID:34947998
Dbr1	Rat	bisphenol A	decreases expression	ISO	RGD:1619922	6480464	bisphenol A results in decreased expression of DBR1 mRNA	CTD	PMID:33221593
Dbr1	Rat	cadmium dichloride	increases expression	EXP		6480464	Cadmium Chloride results in increased expression of DBR1 mRNA	CTD	PMID:31077537
Dbr1	Rat	cadmium dichloride	decreases expression	ISO	RGD:1323625	6480464	Cadmium Chloride results in decreased expression of DBR1 mRNA	CTD	PMID:38568856
Dbr1	Rat	cadmium dichloride	multiple interactions	EXP		6480464	[Cadmium Chloride co-treated with diallyl disulfide] results in increased expression of DBR1 mRNA	CTD	PMID:31077537
Dbr1	Rat	chlorpyrifos	decreases expression	ISO	RGD:1619922	6480464	Chlorpyrifos results in decreased expression of DBR1 mRNA	CTD	PMID:37019170
Dbr1	Rat	copper(II) sulfate	decreases expression	ISO	RGD:1323625	6480464	Copper Sulfate results in decreased expression of DBR1 mRNA	CTD	PMID:19549813
Dbr1	Rat	Cuprizon	decreases expression	EXP		6480464	Cuprizone results in decreased expression of DBR1 mRNA	CTD	PMID:26577399
Dbr1	Rat	Cuprizon	increases expression	EXP		6480464	Cuprizone results in increased expression of DBR1 mRNA	CTD	PMID:27523638
Dbr1	Rat	cyclosporin A	decreases expression	ISO	RGD:1323625	6480464	Cyclosporine results in decreased expression of DBR1 mRNA	CTD	PMID:25562108
Dbr1	Rat	diallyl disulfide	multiple interactions	EXP		6480464	[Cadmium Chloride co-treated with diallyl disulfide] results in increased expression of DBR1 mRNA	CTD	PMID:31077537
Dbr1	Rat	Dibutyl phosphate	affects expression	ISO	RGD:1323625	6480464	di-n-butylphosphoric acid affects the expression of DBR1 mRNA	CTD	PMID:37042841
Dbr1	Rat	dibutyl phthalate	decreases expression	ISO	RGD:1619922	6480464	Dibutyl Phthalate results in decreased expression of DBR1 mRNA	CTD	PMID:21266533
Dbr1	Rat	dorsomorphin	multiple interactions	ISO	RGD:1323625	6480464	[NOG protein co-treated with p-Chloromercuribenzoic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased more ...	CTD	PMID:27188386
Dbr1	Rat	enzyme inhibitor	multiple interactions	ISO	RGD:1323625	6480464	[Enzyme Inhibitors results in decreased activity of OGA protein] which results in increased O-linked glycosylation more ...	CTD	PMID:23301498
Dbr1	Rat	epoxiconazole	decreases expression	ISO	RGD:1619922	6480464	epoxiconazole results in decreased expression of DBR1 mRNA	CTD	PMID:35436446
Dbr1	Rat	ethanol	increases expression	ISO	RGD:1619922	6480464	Ethanol results in increased expression of DBR1 mRNA	CTD	PMID:30319688
Dbr1	Rat	formaldehyde	increases expression	ISO	RGD:1323625	6480464	Formaldehyde results in increased expression of DBR1 mRNA	CTD	PMID:23649840
Dbr1	Rat	FR900359	decreases phosphorylation	ISO	RGD:1323625	6480464	FR900359 results in decreased phosphorylation of DBR1 protein	CTD	PMID:37730182
Dbr1	Rat	ivermectin	decreases expression	ISO	RGD:1323625	6480464	Ivermectin results in decreased expression of DBR1 protein	CTD	PMID:32959892
Dbr1	Rat	leflunomide	decreases expression	ISO	RGD:1323625	6480464	leflunomide results in decreased expression of DBR1 mRNA	CTD	PMID:28988120
Dbr1	Rat	methyl methanesulfonate	increases expression	ISO	RGD:1323625	6480464	Methyl Methanesulfonate results in increased expression of DBR1 mRNA	CTD	PMID:23649840
Dbr1	Rat	methylisothiazolinone	increases expression	ISO	RGD:1323625	6480464	2-methyl-4-isothiazolin-3-one results in increased expression of DBR1 mRNA	CTD	PMID:31629900
Dbr1	Rat	okadaic acid	increases expression	ISO	RGD:1323625	6480464	Okadaic Acid results in increased expression of DBR1 mRNA	CTD	PMID:38832940
Dbr1	Rat	p-chloromercuribenzoic acid	decreases expression	ISO	RGD:1323625	6480464	p-Chloromercuribenzoic Acid results in decreased expression of DBR1 mRNA	CTD	PMID:26272509
Dbr1	Rat	p-chloromercuribenzoic acid	multiple interactions	ISO	RGD:1323625	6480464	[NOG protein co-treated with p-Chloromercuribenzoic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased more ...	CTD	PMID:27188386
Dbr1	Rat	quercetin	decreases expression	ISO	RGD:1323625	6480464	Quercetin results in decreased expression of DBR1 mRNA	CTD	PMID:21632981
Dbr1	Rat	resveratrol	decreases expression	EXP		6480464	resveratrol results in decreased expression of DBR1 mRNA	CTD	PMID:25905778
Dbr1	Rat	resveratrol	multiple interactions	ISO	RGD:1323625	6480464	[Plant Extracts co-treated with Resveratrol] results in increased expression of DBR1 mRNA	CTD	PMID:23557933
Dbr1	Rat	Salinomycin	decreases expression	ISO	RGD:1323625	6480464	salinomycin results in decreased expression of DBR1 mRNA	CTD	PMID:19682730
Dbr1	Rat	SB 431542	multiple interactions	ISO	RGD:1323625	6480464	[NOG protein co-treated with p-Chloromercuribenzoic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased more ...	CTD	PMID:27188386
Dbr1	Rat	senecionine	increases expression	ISO	RGD:1619922	6480464	senecionine results in increased expression of DBR1 protein	CTD	PMID:35357534
Dbr1	Rat	sodium arsenite	decreases expression	ISO	RGD:1323625	6480464	sodium arsenite results in decreased expression of DBR1 mRNA	CTD	PMID:38568856
Dbr1	Rat	sodium arsenite	multiple interactions	ISO	RGD:1323625	6480464	[sodium arsenite results in increased abundance of Arsenic] which results in increased expression of DBR1 more ...	CTD	PMID:39836092
Dbr1	Rat	thioacetamide	increases expression	EXP		6480464	Thioacetamide results in increased expression of DBR1 mRNA	CTD	PMID:34492290
Dbr1	Rat	thiram	increases expression	ISO	RGD:1323625	6480464	Thiram results in increased expression of DBR1 mRNA	CTD	PMID:38568856
Dbr1	Rat	triptonide	increases expression	ISO	RGD:1619922	6480464	triptonide results in increased expression of DBR1 mRNA	CTD	PMID:33045310
Dbr1	Rat	tungsten	increases expression	ISO	RGD:1619922	6480464	Tungsten results in increased expression of DBR1 mRNA	CTD	PMID:30912803

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Dbr1	Rat	mRNA processing	involved_in	IEA	UniProtKB-KW:KW-0507	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Dbr1	Rat	mRNA processing	involved_in	IEA	InterPro:IPR007708	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Dbr1	Rat	mRNA splicing, via spliceosome	acts_upstream_of_or_within	ISO	RGD:1619922	1624291	PMID:10982890	RGD	PMID:10982890
Dbr1	Rat	RNA fragment catabolic process	involved_in	ISO	RGD:1323625	1624291	PMID:37656279	RGD	PMID:37656279
Dbr1	Rat	RNA splicing, via transesterification reactions	involved_in	ISO	RGD:1323625	1624291	PMID:10982890	RGD	PMID:10982890

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Dbr1	Rat	nucleoplasm	located_in	ISO	RGD:1323625\|UniProtKB:Q9UK59-1	1624291		RGD	GO_REF:0000052
Dbr1	Rat	nucleus	located_in	ISO	RGD:1323625	1624291	PMID:10982890	RGD	PMID:10982890
Dbr1	Rat	nucleus	located_in	IEA	UniProtKB-SubCell:SL-0191	1600115	GO_REF:0000044	UniProt	GO_REF:0000044

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Dbr1	Rat	hydrolase activity	enables	IEA	UniProtKB-KW:KW-0378	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Dbr1	Rat	hydrolase activity	enables	IEA	InterPro:IPR004843	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Dbr1	Rat	hydrolase activity, acting on ester bonds	enables	IEA	InterPro:IPR007708	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Dbr1	Rat	metal ion binding	enables	IEA	UniProtKB-KW:KW-0479	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Dbr1	Rat	RNA lariat debranching enzyme activity	enables	ISO	RGD:1323625	1624291	PMID:10982890, PMID:29474921	RGD	PMID:10982890\|PMID:29474921
Dbr1	Rat	RNA lariat debranching enzyme activity	enables	ISO	RGD:1619922	1624291	PMID:10982890	RGD	PMID:10982890
Dbr1	Rat	RNA lariat debranching enzyme activity	enables	IEA	ARBA:ARBA00028886	1600115	GO_REF:0000117	UniProt	GO_REF:0000117

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	GOA pipeline	RGD automated data pipeline
3.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

PMID:10982890	PMID:12477932	PMID:22658674	PMID:30361391

Dbr1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	8	109,018,364 - 109,030,092 (+)	NCBI		GRCr8
mRatBN7.2	8	100,139,039 - 100,150,768 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	8	100,139,034 - 100,151,030 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	8	105,805,842 - 105,817,525 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	8	104,005,138 - 104,016,821 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	8	101,847,672 - 101,859,355 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	8	107,826,690 - 107,838,186 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	8	107,826,424 - 107,838,339 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	8	107,251,356 - 107,262,732 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	8	104,443,418 - 104,455,249 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	8	99,539,355 - 99,551,081 (+)	NCBI		Celera
Cytogenetic Map	8	q31	NCBI

DBR1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	3	138,160,988 - 138,174,921 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	3	138,160,988 - 138,174,949 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	3	137,879,830 - 137,893,763 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	3	139,362,542 - 139,376,463 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	3	139,362,550 - 139,376,471	NCBI
Celera	3	136,304,598 - 136,318,559 (-)	NCBI		Celera
Cytogenetic Map	3	q22.3	NCBI
HuRef	3	135,254,888 - 135,268,849 (-)	NCBI		HuRef
CHM1_1	3	137,843,634 - 137,857,589 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	3	140,901,580 - 140,915,511 (-)	NCBI		T2T-CHM13v2.0

Dbr1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	9	99,457,839 - 99,467,060 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	9	99,457,852 - 99,466,554 (+)	Ensembl		GRCm39 Ensembl
GRCm38	9	99,575,786 - 99,585,007 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	9	99,575,799 - 99,584,501 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	9	99,476,218 - 99,484,762 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	9	99,385,151 - 99,393,695 (+)	NCBI		MGSCv36	mm8
Celera	9	99,110,559 - 99,119,100 (+)	NCBI		Celera
Cytogenetic Map	9	E3.3	NCBI
cM Map	9	51.86	NCBI

DBR1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	2	136,065,814 - 136,082,053 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	3	136,068,127 - 136,086,788 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	3	135,188,636 - 135,202,934 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	3	142,639,712 - 142,653,016 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	3	142,639,712 - 142,653,016 (-)	Ensembl	panpan1.1		panPan2

DBR1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	23	34,375,691 - 34,388,317 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	23	34,376,228 - 34,388,263 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	23	34,368,284 - 34,380,893 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	23	34,915,650 - 34,928,302 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	23	34,915,650 - 34,928,278 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	23	34,597,534 - 34,610,147 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	23	34,662,956 - 34,675,492 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	23	34,913,997 - 34,926,603 (-)	NCBI		UU_Cfam_GSD_1.0

Dbr1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405602	73,766,245 - 73,776,137 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936540	505,619 - 515,964 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936540	504,638 - 515,913 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

DBR1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	13	78,958,218 - 78,970,137 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	13	78,958,301 - 78,970,250 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	13	86,477,860 - 86,480,220 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

DBR1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	15	52,367,197 - 52,381,076 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	15	52,367,357 - 52,380,227 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666041	25,381,120 - 25,394,996 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Dbr1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624730	14,681,730 - 14,711,368 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624730	14,682,951 - 14,693,450 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Dbr1
52 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	127
Count of miRNA genes:	100
Interacting mature miRNAs:	106
Transcripts:	ENSRNOT00000019769
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1300177	Cm2	Cardiac mass QTL 2	3.65		heart mass (VT:0007028)	heart weight (CMO:0000017)	8	54259986	100382532	Rat
1549909	Stresp11	Stress response QTL 11	6.83	0.0019	stress-related behavior trait (VT:0010451)	number of approaches toward negative stimulus before onset of defensive burying response (CMO:0001960)	8	73473045	118473045	Rat
1554321	Bmd3	Bone mineral density QTL 3	7.9	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	8	40952565	123900184	Rat
9590292	Uminl3	Urine mineral level QTL 3	3.62	0.001	urine mineral amount (VT:0015086)	urine electrolyte level (CMO:0000593)	8	71888757	116888757	Rat
1578769	Uae31	Urinary albumin excretion QTL 31	3.3	0.001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	8	30848154	101699754	Rat
738011	Anxrr9	Anxiety related response QTL 9	6.1		exploratory behavior trait (VT:0010471)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	8	93535351	123900184	Rat
8693654	Alc32	Alcohol consumption QTL 32	2	0.755	drinking behavior trait (VT:0001422)	calculated ethanol drink intake rate (CMO:0001615)	8	88612425	107550209	Rat
1358912	Bw51	Body weight QTL 51	2.95		body mass (VT:0001259)	body weight (CMO:0000012)	8	51351728	107062046	Rat
1578765	Klgr1	Kidney lesion grade QTL 1	3.3	0.0001	kidney morphology trait (VT:0002135)	organ lesion measurement (CMO:0000677)	8	30848154	101699754	Rat
738014	Anxrr15	Anxiety related response QTL 15	3.6	0.005	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	8	95718998	123900184	Rat
1300171	Bp184	Blood pressure QTL 184	3.66		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	8	70513503	118219066	Rat
1578755	Pur5	Proteinuria QTL 5	3.3	0.0001	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	8	30848154	101699754	Rat
2313400	Anxrr25	Anxiety related response QTL 25			aggression-related behavior trait (VT:0015014)	tameness/aggressiveness composite score (CMO:0002136)	8	89265192	114019816	Rat
2303171	Bp331	Blood pressure QTL 331	5.57	0.005	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	61290298	119084929	Rat
631210	Bw3	Body weight QTL3	5.9		mesenteric fat pad mass (VT:0010427)	mesenteric fat pad weight to body weight ratio (CMO:0000654)	8	69349194	112783834	Rat
1358903	Bp252	Blood pressure QTL 252	7	0.0001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	93965141	123900184	Rat
8694446	Bw170	Body weight QTL 170	12.07	0.001	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	8	71888757	116888757	Rat
631650	Stl6	Serum triglyceride level QTL 6	4	0.0019	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	8	10378157	112202585	Rat
631653	Bp125	Blood pressure QTL 125	3.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	66142385	111142385	Rat
1581557	Eae16	Experimental allergic encephalomyelitis QTL 16	3.8		nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046)	8	8462195	110921472	Rat
724539	Cm19	Cardiac mass QTL 19	2.6		heart mass (VT:0007028)	calculated heart weight (CMO:0000073)	8	100149864	120994388	Rat
70197	BpQTLcluster8	Blood pressure QTL cluster 8	3.482		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	46531639	119088626	Rat
2316950	Scl66	Serum cholesterol level QTL 66	4.1		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	8	30848259	105647037	Rat
2300182	Bmd56	Bone mineral density QTL 56	5.4		femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	8	95718998	123900184	Rat
2300181	Bmd55	Bone mineral density QTL 55	5.7	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	8	76468691	121468691	Rat
1358893	Bp263	Blood pressure QTL 263	5.01		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	93965141	123900184	Rat
8694200	Abfw4	Abdominal fat weight QTL 4	9.07	0.001	visceral adipose mass (VT:0010063)	abdominal fat pad weight to body weight ratio (CMO:0000095)	8	71888757	116888757	Rat
8694392	Bw161	Body weight QTL 161	8.06	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	8	71888757	116888757	Rat
61437	Cia6	Collagen induced arthritis QTL 6			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	8	82460758	122812818	Rat

BF397095

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	8	100,150,660 - 100,150,856 (+)	MAPPER	mRatBN7.2
Rnor_6.0	8	107,838,079 - 107,838,274	NCBI	Rnor6.0
Rnor_5.0	8	107,262,625 - 107,262,820	UniSTS	Rnor5.0
RGSC_v3.4	8	104,455,142 - 104,455,337	UniSTS	RGSC3.4
Celera	8	99,550,974 - 99,551,169	UniSTS
RH 3.4 Map	8	1040.59	UniSTS
Cytogenetic Map	8	q31	UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31


RefSeq Transcripts	NM_001109437	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC166797	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473954	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000008	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000019769 ⟹ ENSRNOP00000019769

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	8	100,139,034 - 100,151,030 (+)	Ensembl
Rnor_6.0 Ensembl	8	107,826,424 - 107,838,339 (+)	Ensembl

RefSeq Acc Id:

NM_001109437 ⟹ NP_001102907

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	8	109,018,364 - 109,030,092 (+)	NCBI
mRatBN7.2	8	100,139,039 - 100,150,768 (+)	NCBI
Rnor_6.0	8	107,826,690 - 107,838,186 (+)	NCBI
Rnor_5.0	8	107,251,356 - 107,262,732 (+)	NCBI
RGSC_v3.4	8	104,443,418 - 104,455,249 (+)	RGD
Celera	8	99,539,355 - 99,551,081 (+)	RGD

Sequence:

show sequence

TGGCGGGATACGGGCGGGCGGCTTGTCCGCTCTTCTCTGCTGTTCTGCCCGGGCTGCAGGTGCTCGAGGGCGTTGCGTTGGAGTTCCGTGGCCCAACGTCACGATGCGGGTGGCTGTGGCCGGCTGCT
GCCACGGCGAGCTGGACAAGATCTACGAGACTCTGGCGCTAGCGGAGCGGCGCGGCCCGGGACCGGTGGATCTCCTTCTGTGCTGTGGCGACTTCCAGGCGGTGCGCAATGAGGCCGACCTGCGCTGC
ATGGCCGTGCCGCCCAAATACCGCCACATGCAGACCTTCTACCGATACTACTCTGGAGAGAAAAAGGCCCCGGTTCTCACCATCTTCATTGGAGGAAACCATGAAGCTTCAAACCATTTGCAAGAGTT
ACCCTATGGTGGCTGGGTGGCGCCAAATATTTACTATTTAGGTTTGGCTGGTGTTGTCAAATACCGAGGAGTAAGGATTGGTGGCATCTCTGGCATATTTAAATCTCATGACTATCGAAAAGGTCATT
TTGAGTGTCCCCCTTATAATTCGTCTACCATAAGGAGTATATATCATGTGAGAAATATAGAGGTCTACAAATTAAAACAGTTAAAGCAGCCTGTACATATATTCTTATCTCATGATTGGCCAAGAAAT
ATATATCATTATGGAAATAAGAAGCAACTTCTTAAGACCAAATCTTTTTTCCGCCAAGAGGTGGAAAATAGCACACTAGGAAGTCCCGCTGCCTCGGAGCTGCTAGAGCACCTAAAGCCCGCATACTG
GTTCTCGGCACACCTACACGTGAAGTTTGCGGCCTTGATGCAGCATCAGGCCACAGATAAAGAACAAGCAGGCAAGGAAACCAAGTTTTTAGCCTTGGACAAGTGCTTGCCACACAGAGACTTTCTTC
AGGTGTTAGAGATAGAACATGACCCCAGTGCTCCTGAGTACTTAGAGTACGACGTTGAATGGCTTGCTGTCCTCAGGGCCACTGATGACCTGATGAATGTGACTGGGGGCCTATGGAATATGCCTGAA
AACAATGGTCTGCATACAAGGTGGGATTATAGTGCAACCGAAGAAGCCATGAAAGACGTAATGGAGAAATTGAACCATGACCCCAGAATCCCCTGTAACTTCAGCATGACAGCTGCTTGTTATGATCC
TAGTAAGCCACAGACACAAGTGCAGCTGGTGCACAGGATCAGTCCGCAGACTACTAAATTCTGTGCCCAGCTTGGCATCACAGACATTAACGTCATGATTCAGAAGGCCAAGGAAGAGCATCATCTGT
GTGGTGAATATGTACAGCAGGGTGATCTGGGGACTGATGACTCTGAGGAGGACCGGAGTGAATACAACACAGACACGTCTGCCCTGTCCTCCATTAATCCAGATGAAATAATGTTGGATGAGGAAGAG
GAAGAGGAGGAAGCTGTAAGTACCCATAGTGACATGAACACGCCTTCTGTGGAACCTTCTTCTGATCAAGCTTCTGACCTCTCCACAAGCTTTTCTGACATCAGGAACTTACCAAGTTCCATGTTTGT
GTCTTCTGATGATGCCTCCCGTTCTCCAGCTAGTGAGGAGGGGAAATCTGGTGAAACTGTAGAGTGTGGGGATGAAAAAGACTTGGTTGAGTTTTCAGTGAAGAGGCTTAGTAATGAACACGAACCTG
AACAAAGGAAGAGGATAAAGAGGAGGAACCAGGCCATCTACGCTGCAGTGGATGACGAGGATGCCAACGATGAGTAGGACAGAGGACTTGATGTGGTAAATACAGATGTATGATTTCAAGACCCGATT
TTTAGCACAGAATTTCTGATTTAATGACTGGACTTTGTAATAATGAAATGATGGAATTTTGGTTATATGTTCTGTATTTAGGTGTATGTTTATATGATTCAGATATATACTTATTAAAATTTCATATG
AAATTTGAAAAAAAAAAAAAAA

hide sequence


Protein RefSeqs	NP_001102907	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAI66797	(Get FASTA)	NCBI Sequence Viewer
	EDL77437	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000019769.2
	ENSRNOP00000109481

RefSeq Acc Id:

NP_001102907 ⟸ NM_001109437

- UniProtKB:

B2RYJ2 (UniProtKB/TrEMBL), A6I2E0 (UniProtKB/TrEMBL), F7FLJ5 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MRVAVAGCCHGELDKIYETLALAERRGPGPVDLLLCCGDFQAVRNEADLRCMAVPPKYRHMQTFYRYYSGEKKAPVLTIFIGGNHEASNHLQELPYGGWVAPNIYYLGLAGVVKYRGVRIGGISGIFK
SHDYRKGHFECPPYNSSTIRSIYHVRNIEVYKLKQLKQPVHIFLSHDWPRNIYHYGNKKQLLKTKSFFRQEVENSTLGSPAASELLEHLKPAYWFSAHLHVKFAALMQHQATDKEQAGKETKFLALDK
CLPHRDFLQVLEIEHDPSAPEYLEYDVEWLAVLRATDDLMNVTGGLWNMPENNGLHTRWDYSATEEAMKDVMEKLNHDPRIPCNFSMTAACYDPSKPQTQVQLVHRISPQTTKFCAQLGITDINVMIQ
KAKEEHHLCGEYVQQGDLGTDDSEEDRSEYNTDTSALSSINPDEIMLDEEEEEEEAVSTHSDMNTPSVEPSSDQASDLSTSFSDIRNLPSSMFVSSDDASRSPASEEGKSGETVECGDEKDLVEFSVK
RLSNEHEPEQRKRIKRRNQAIYAAVDDEDANDE

hide sequence

Ensembl Acc Id:

ENSRNOP00000019769 ⟸ ENSRNOT00000019769

Protein Domains

Lariat debranching enzyme C-terminal

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-B2RYJ2-F1-model_v2	AlphaFold	B2RYJ2	1-545	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

RGD ID:

13696212

Promoter ID:

EPDNEW_R6737

Type:

multiple initiation site

Name:

Dbr1_1

Description:

debranching RNA lariats 1

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	8	107,826,682 - 107,826,742	EPDNEW

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-29391	BioCyc
Ensembl Genes	ENSRNOG00000014588	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000019769.5	UniProtKB/TrEMBL
	ENSRNOT00000127819	ENTREZGENE
Gene3D-CATH	3.60.21.10	UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7938214	IMAGE-MGC_LOAD
InterPro	DBR1_C	UniProtKB/TrEMBL
	Dbr1_N	UniProtKB/TrEMBL
	M-pesterase	UniProtKB/TrEMBL
	Metallo-depent_PP-like	UniProtKB/TrEMBL
KEGG Report	rno:681234	UniProtKB/TrEMBL
MGC_CLONE	MGC:188596	IMAGE-MGC_LOAD
NCBI Gene	681234	ENTREZGENE
PANTHER	LARIAT DEBRANCHING ENZYME	UniProtKB/TrEMBL
	RNA LARIAT DEBRANCHING ENZYME	UniProtKB/TrEMBL
Pfam	DBR1	UniProtKB/TrEMBL
	Metallophos	UniProtKB/TrEMBL
PhenoGen	Dbr1	PhenoGen
RatGTEx	ENSRNOG00000014588	RatGTEx
SMART	DBR1	UniProtKB/TrEMBL
Superfamily-SCOP	SSF56300	UniProtKB/TrEMBL
UniProt	A6I2E0	ENTREZGENE, UniProtKB/TrEMBL
	B2RYJ2	ENTREZGENE
	F7FLJ5	ENTREZGENE, UniProtKB/TrEMBL
UniProt Secondary	B2RYJ2	UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2013-09-16	Dbr1	debranching RNA lariats 1	Dbr1	debranching enzyme homolog 1 (S. cerevisiae)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2009-06-15	Dbr1	debranching enzyme homolog 1 (S. cerevisiae)	Dbr1_predicted	debranching enzyme homolog 1 (S. cerevisiae) (predicted)	Data merged from RGD:1311917	1643240	APPROVED
2008-03-05	Dbr1	debranching enzyme homolog 1 (S. cerevisiae)	LOC681234	similar to debranching enzyme homolog 1	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-01-09	LOC681234	similar to debranching enzyme homolog 1	LOC683696	similar to debranching enzyme homolog 1	Data merged from RGD:1584458	1643240	APPROVED
2006-11-20	LOC681234	similar to debranching enzyme homolog 1			Symbol and Name status set to provisional	70820	PROVISIONAL
2006-11-19	LOC683696	similar to debranching enzyme homolog 1			Symbol and Name status set to provisional	70820	PROVISIONAL
2005-01-12	Dbr1_predicted	debranching enzyme homolog 1 (S. cerevisiae) (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM