Symbol:
S100a7a
Name:
S100 calcium binding protein A7A
RGD ID:
1593779
Description:
Predicted to enable several functions, including calcium-dependent protein binding activity; chemoattractant activity; and identical protein binding activity. Predicted to be involved in endothelial cell migration. Predicted to act upstream of or within inflammatory response. Predicted to be located in cytosol and extracellular space. Predicted to be active in cytoplasm. Orthologous to human S100A7A (S100 calcium binding protein A7A); INTERACTS WITH 2,2',4,4'-Tetrabromodiphenyl ether; 4-aminopyridine; bisphenol A.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
LOC685479; protein S100-A15A; S100 calcium binding protein A15; S100a15; similar to S100 calcium binding protein A15
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 2 178,448,983 - 178,453,424 (+) NCBI GRCr8 mRatBN7.2 2 176,151,405 - 176,155,846 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 2 176,151,288 - 176,156,441 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 2 183,291,695 - 183,296,136 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 2 181,313,951 - 181,318,392 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 2 175,913,781 - 175,918,222 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 2 190,058,093 - 190,063,132 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 2 190,058,093 - 190,062,534 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 2 209,492,452 - 209,496,893 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 2 182,946,273 - 182,950,714 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 2 170,084,151 - 170,088,592 (+) NCBI Celera Cytogenetic Map 2 q34 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
S100a7a Rat 1,2-dichloroethane decreases expression ISO RGD:1321094 6480464 ethylene dichloride results in decreased expression of S100A7A mRNA CTD PMID:28960355 S100a7a Rat 2,2',4,4'-Tetrabromodiphenyl ether decreases expression EXP 6480464 2,2',4,4'-tetrabromodiphenyl ether results in decreased expression of S100A7A mRNA CTD PMID:27291303 S100a7a Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO RGD:1346957 6480464 Tetrachlorodibenzodioxin results in increased expression of S100A7A mRNA CTD PMID:23152189 S100a7a Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO RGD:1321094 6480464 Tetrachlorodibenzodioxin affects the expression of S100A7A mRNA CTD PMID:21570461 S100a7a Rat 4-aminopyridine decreases expression EXP 6480464 4-Aminopyridine results in decreased expression of S100A7A mRNA CTD PMID:24378259 S100a7a Rat aflatoxin B1 decreases methylation ISO RGD:1346957 6480464 Aflatoxin B1 results in decreased methylation of S100A7A gene CTD PMID:27153756 S100a7a Rat arsane affects methylation ISO RGD:1346957 6480464 Arsenic affects the methylation of S100A7A gene CTD PMID:25304211 S100a7a Rat arsenic atom affects methylation ISO RGD:1346957 6480464 Arsenic affects the methylation of S100A7A gene CTD PMID:25304211 S100a7a Rat benzo[a]pyrene increases expression ISO RGD:1321094 6480464 Benzo(a)pyrene results in increased expression of S100A7A mRNA CTD PMID:23735875 S100a7a Rat benzo[a]pyrene increases methylation ISO RGD:1346957 6480464 Benzo(a)pyrene results in increased methylation of S100A7A 5' UTR CTD PMID:27901495 S100a7a Rat benzo[a]pyrene affects methylation ISO RGD:1346957 6480464 Benzo(a)pyrene affects the methylation of S100A7A promoter CTD PMID:27901495 S100a7a Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of S100A7A mRNA CTD PMID:25181051 S100a7a Rat cadmium atom multiple interactions ISO RGD:1346957 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of S100A7A more ... CTD PMID:35301059 S100a7a Rat cadmium dichloride increases methylation EXP 6480464 Cadmium Chloride results in increased methylation of S100A7A promoter CTD PMID:22457795 S100a7a Rat cadmium dichloride multiple interactions ISO RGD:1346957 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of S100A7A more ... CTD PMID:35301059 S100a7a Rat CGP 52608 multiple interactions ISO RGD:1346957 6480464 CGP 52608 promotes the reaction [RORA protein binds to S100A7A gene] CTD PMID:28238834 S100a7a Rat chlorpyrifos affects expression ISO RGD:1321094 6480464 Chlorpyrifos affects the expression of S100A7A mRNA CTD PMID:27737797 S100a7a Rat epoxiconazole increases expression ISO RGD:1321094 6480464 epoxiconazole results in increased expression of S100A7A mRNA CTD PMID:35436446 S100a7a Rat glyphosate increases expression ISO RGD:1346957 6480464 Glyphosate results in increased expression of S100A7A mRNA CTD PMID:31874349 S100a7a Rat hydroquinone decreases expression ISO RGD:1346957 6480464 hydroquinone results in decreased expression of S100A7A mRNA CTD PMID:25240866 S100a7a Rat nevirapine increases expression EXP 6480464 Nevirapine metabolite results in increased expression of S100A7A mRNA CTD PMID:23947594 S100a7a Rat nickel atom increases expression ISO RGD:1346957 6480464 Nickel results in increased expression of S100A7A mRNA CTD PMID:24768652|PMID:25583101 S100a7a Rat ozone decreases expression ISO RGD:1321094 6480464 Ozone results in decreased expression of S100A7A mRNA CTD PMID:31626304 S100a7a Rat perfluorobutyric acid increases expression ISO RGD:1321094 6480464 perfluorobutyric acid results in increased expression of S100A7A mRNA CTD PMID:34474067 S100a7a Rat perfluorohexanesulfonic acid increases expression ISO RGD:1321094 6480464 perfluorohexanesulfonic acid results in increased expression of S100A7A mRNA CTD PMID:37995155 S100a7a Rat perfluoropentanoic acid increases expression ISO RGD:1321094 6480464 perfluoropentanoic acid results in increased expression of S100A7A mRNA CTD PMID:36435305 S100a7a Rat sodium arsenite increases expression ISO RGD:1346957 6480464 sodium arsenite results in increased expression of S100A7A mRNA CTD PMID:28595984 S100a7a Rat sodium arsenite affects expression ISO RGD:1346957 6480464 sodium arsenite affects the expression of S100A7A mRNA CTD PMID:34032870 S100a7a Rat sodium dodecyl sulfate increases expression ISO RGD:1346957 6480464 Sodium Dodecyl Sulfate results in increased expression of S100A7A mRNA CTD PMID:25240866 S100a7a Rat sodium dodecyl sulfate decreases expression ISO RGD:1346957 6480464 Sodium Dodecyl Sulfate results in decreased expression of S100A7A mRNA CTD PMID:25240866 S100a7a Rat trichloroethene increases methylation EXP 6480464 Trichloroethylene results in increased methylation of S100A7A gene CTD PMID:27618143 S100a7a Rat trichloroethene decreases expression EXP 6480464 Trichloroethylene results in decreased expression of S100A7A mRNA CTD PMID:33387578 S100a7a Rat triptonide increases expression ISO RGD:1321094 6480464 triptonide results in increased expression of S100A7A mRNA CTD PMID:33045310
S100a7a (Rattus norvegicus - Norway rat)
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 2 178,448,983 - 178,453,424 (+) NCBI GRCr8 mRatBN7.2 2 176,151,405 - 176,155,846 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 2 176,151,288 - 176,156,441 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 2 183,291,695 - 183,296,136 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 2 181,313,951 - 181,318,392 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 2 175,913,781 - 175,918,222 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 2 190,058,093 - 190,063,132 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 2 190,058,093 - 190,062,534 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 2 209,492,452 - 209,496,893 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 2 182,946,273 - 182,950,714 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 2 170,084,151 - 170,088,592 (+) NCBI Celera Cytogenetic Map 2 q34 NCBI
S100A7A (Homo sapiens - human)
Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 1 153,416,520 - 153,423,222 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 1 153,416,520 - 153,423,222 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 1 153,388,996 - 153,395,698 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 1 151,655,624 - 151,662,325 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 1 150,202,072 - 150,208,776 NCBI Celera 1 126,460,255 - 126,466,956 (+) NCBI Celera Cytogenetic Map 1 q21.3 NCBI HuRef 1 124,752,411 - 124,759,112 (+) NCBI HuRef CHM1_1 1 154,784,713 - 154,791,415 (+) NCBI CHM1_1 T2T-CHM13v2.0 1 152,553,744 - 152,560,447 (+) NCBI T2T-CHM13v2.0
S100a7a (Mus musculus - house mouse)
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 3 90,561,609 - 90,565,437 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 3 90,561,324 - 90,565,976 (+) Ensembl GRCm39 Ensembl GRCm38 3 90,651,925 - 90,658,130 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 3 90,654,017 - 90,658,669 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 3 90,458,224 - 90,462,052 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 3 90,740,229 - 90,744,057 (+) NCBI MGSCv36 mm8 Celera 3 90,695,739 - 90,699,559 (+) NCBI Celera Cytogenetic Map 3 F1 NCBI cM Map 3 39.82 NCBI
LOC102156046 (Canis lupus familiaris - dog)
Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 7 43,503,226 - 43,537,485 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 7 42,996,095 - 43,030,358 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 7 43,452,867 - 43,487,148 (+) NCBI ROS_Cfam_1.0 UMICH_Zoey_3.1 7 43,155,134 - 43,189,463 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 7 43,208,988 - 43,243,276 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 7 43,492,651 - 43,526,916 (+) NCBI UU_Cfam_GSD_1.0
S100A7 (Sus scrofa - pig)
.
Predicted Target Of
Count of predictions: 86 Count of miRNA genes: 70 Interacting mature miRNAs: 75 Transcripts: ENSRNOT00000051365 Prediction methods: Microtar, Miranda, Rnahybrid Result types: miRGate_prediction
1578648 Bss11 Bone structure and strength QTL 11 4.7 femur morphology trait (VT:0000559) femoral neck cortical cross-sectional area (CMO:0001702) 2 114837527 211674221 Rat 1358356 Srcrt1 Stress Responsive Cort QTL1 3.66 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 2 161699179 222436696 Rat 1331734 Bp204 Blood pressure QTL 204 3.61192 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 168358098 223265385 Rat 1298074 Bp164 Blood pressure QTL 164 0.003 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 42804607 202447032 Rat 1354648 Bp239 Blood pressure QTL 239 0.001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 66118463 226797303 Rat 1354649 Kidm17 Kidney mass QTL 17 2.9 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 2 81754530 227146641 Rat 10755499 Bp389 Blood pressure QTL 389 2.61 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 2 18960362 228801039 Rat 1298076 Bp166 Blood pressure QTL 166 0.0009 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 136445150 202447032 Rat 152025245 Scl81 Serum cholesterol level QTL 81 3.49 blood cholesterol amount (VT:0000180) 2 122609194 206936711 Rat 70162 Bp63 Blood pressure QTL 63 5.64 arterial blood pressure trait (VT:2000000) blood pressure measurement (CMO:0000003) 2 169745596 214745596 Rat 1554319 Bmd2 Bone mineral density QTL 2 13.4 0.0001 lumbar vertebra area (VT:0010570) lumbar vertebra cross-sectional area (CMO:0001689) 2 114837675 212549332 Rat 12879836 Kidm61 Kidney mass QTL 61 0.001 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 2 152413072 185122374 Rat 1581569 Uae32 Urinary albumin excretion QTL 32 0.0001 urine protein amount (VT:0005160) urine albumin excretion rate (CMO:0000757) 2 78665619 219826953 Rat 10043136 Iddm54 Insulin dependent diabetes mellitus QTL 54 3.4 0.0001 blood glucose amount (VT:0000188) age at onset/diagnosis of type 1 diabetes mellitus (CMO:0001140) 2 143657411 190602963 Rat 12879837 Am2 Aortic mass QTL 2 0.001 aorta mass (VT:0002845) aorta weight to aorta length to body weight ratio (CMO:0002722) 2 152413072 185122374 Rat 12879838 Cm86 Cardiac mass QTL 86 0.002 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 2 152413072 185122374 Rat 1302793 Bw16 Body weight QTL 16 5 0.0001 body mass (VT:0001259) body weight (CMO:0000012) 2 157142209 202446871 Rat 61467 Bp14 Blood pressure QTL 14 2.2 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 43154682 202446871 Rat 12879839 Cm85 Cardiac mass QTL 85 0.001 heart mass (VT:0007028) heart wet weight to body weight ratio (CMO:0002408) 2 152413072 185122374 Rat 61469 Bp16 Blood pressure QTL 16 5.64 arterial blood pressure trait (VT:2000000) blood pressure measurement (CMO:0000003) 2 169745596 214745596 Rat 70175 BpQTLCluster3 Blood pressure QTL cluster 3 4.128 arterial blood pressure trait (VT:2000000) absolute change in systolic blood pressure (CMO:0000607) 2 135552573 202446871 Rat 1549833 Bp257 Blood pressure QTL 257 0.003 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 168354880 185122374 Rat 1358900 Bw48 Body weight QTL 48 4.88 body mass (VT:0001259) body weight (CMO:0000012) 2 157142078 211086598 Rat 1359030 Bp277 Blood pressure QTL 277 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 2 114837527 185876470 Rat 1331760 Bp206 Blood pressure QTL 206 3.62454 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 56043031 202447032 Rat 12879840 Bw179 Body weight QTL 179 0.005 body mass (VT:0001259) body weight (CMO:0000012) 2 152413072 185122374 Rat 1581502 Esta3 Estrogen-induced thymic atrophy QTL 3 thymus mass (VT:0004954) thymus wet weight (CMO:0000855) 2 136916935 189599348 Rat 1359032 Hrtrt18 Heart rate QTL 18 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 2 157142078 192625452 Rat 2301966 Bp322 Blood pressure QTL 322 3.58 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 150540301 202447032 Rat 1298080 Bp163 Blood pressure QTL 163 0.02 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 66118275 202447032 Rat 8662832 Vetf7 Vascular elastic tissue fragility QTL 7 3.5 aorta elastin amount (VT:0003905) aorta wall extracellular elastin dry weight to aorta wall dry weight ratio (CMO:0002002) 2 81689826 221035911 Rat 1298085 Bp165 Blood pressure QTL 165 0.0006 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 42804607 202447032 Rat 1359022 Ppulsi1 Prepulse inhibition QTL 1 3.63 prepulse inhibition trait (VT:0003088) acoustic startle response measurement (CMO:0001519) 2 136916935 213594495 Rat 1641891 Alcrsp17 Alcohol response QTL 17 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 2 149559561 249053267 Rat 724534 Uae6 Urinary albumin excretion QTL 6 10 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 2 78665619 249053267 Rat 61374 Edpm2 Estrogen-dependent pituitary mass QTL 2 4.42 0.86 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 2 76539322 202447032 Rat 8662843 Vetf9 Vascular elastic tissue fragility QTL 9 2.05 thoracic aorta molecular composition trait (VT:0010568) aorta wall extracellular elastin dry weight to aorta wall extracellular collagen weight ratio (CMO:0002003) 2 157142078 226277316 Rat 631501 Bp101 Blood pressure QTL 101 2.4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 150341684 202446871 Rat 2307174 Activ3 Activity QTL 3 4.83 0.000058 locomotor behavior trait (VT:0001392) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 2 168594495 213594495 Rat 1331794 Bp202 Blood pressure QTL 202 3.66819 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 141194931 223265385 Rat 71113 Cari2 Carrageenan-induced inflammation QTL 2 2.7 0.009 hypodermis integrity trait (VT:0010550) inflammatory exudate volume (CMO:0001429) 2 141596551 202447032 Rat 1331805 Cm29 Cardiac mass QTL 29 3.50746 heart mass (VT:0007028) heart wet weight (CMO:0000069) 2 141194931 223265385 Rat 634308 Sach6 Saccharin preference QTL 6 4.9 taste sensitivity trait (VT:0001986) saccharin intake volume to total fluid intake volume ratio (CMO:0001601) 2 112456140 212696837 Rat 1598805 Memor8 Memory QTL 8 3 exploratory behavior trait (VT:0010471) average horizontal distance between subject and target during voluntary locomotion in an experimental apparatus (CMO:0002674) 2 150341585 189039377 Rat 1358917 Cm42 Cardiac mass QTL 42 2.82 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 2 25413423 203928301 Rat 724568 Uae13 Urinary albumin excretion QTL 13 4.4 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 2 143157029 210020885 Rat 1358913 Cm41 Cardiac mass QTL 41 2.73 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 2 25413423 203928301 Rat 1300165 Rf9 Renal function QTL 9 3.28 kidney glomerulus integrity trait (VT:0010546) index of glomerular damage (CMO:0001135) 2 133914684 202447032 Rat 61401 Niddm2 Non-insulin dependent diabetes mellitus QTL 2 4.54 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 2 144599348 189599348 Rat 631507 Bp105 Blood pressure QTL 105 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 112456140 212696837 Rat 1641925 Alcrsp2 Alcohol response QTL 2 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 2 149559561 221167075 Rat 1354609 Niddm62 Non-insulin dependent diabetes mellitus QTL 62 4.72 0.000006 insulin secretion trait (VT:0003564) plasma insulin level (CMO:0000342) 2 150540301 202447032 Rat 1598833 Bp295 Blood pressure QTL 295 3.5 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 147798556 192798556 Rat 1354622 Kidm16 Kidney mass QTL 16 3 kidney mass (VT:0002707) left kidney wet weight (CMO:0000083) 2 81754530 222436696 Rat 631266 Bp132 Blood pressure QTL 132 0.0005 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 46123260 202447032 Rat 631522 Bp74 Blood pressure QTL 74 0.05 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 172710921 184114403 Rat 7488927 Bp365 Blood pressure QTL 365 0.008 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 162765032 207765032 Rat 1598838 Bp290 Blood pressure QTL 290 1.9 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 166539266 211539266 Rat 7488925 Bp364 Blood pressure QTL 364 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 160564068 205564068 Rat 2293843 Kiddil6 Kidney dilation QTL 6 3.1 kidney pelvis morphology trait (VT:0004194) hydronephrosis severity score (CMO:0001208) 2 42804607 182042367 Rat 2306901 Bp337 Blood pressure QTL 337 0.01 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 164073756 227146641 Rat 1354605 Rf48 Renal function QTL 48 2.9 blood creatinine amount (VT:0005328) plasma creatinine level (CMO:0000537) 2 74786664 206665859 Rat 6903312 Bw112 Body weight QTL 112 3.2 0.0013 body mass (VT:0001259) body weight (CMO:0000012) 2 143657569 184114274 Rat 1354601 Slep1 Serum leptin concentration QTL 1 5.39 blood leptin amount (VT:0005667) serum leptin level (CMO:0000780) 2 43171017 184114403 Rat 2293084 Iddm26 Insulin dependent diabetes mellitus QTL 26 2.9 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 2 174930955 213594495 Rat
D2Rat110
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 2 178,447,938 - 178,448,166 (+) Marker Load Pipeline mRatBN7.2 2 176,150,360 - 176,150,588 (+) MAPPER mRatBN7.2 Rnor_6.0 2 190,057,049 - 190,057,276 NCBI Rnor6.0 Rnor_5.0 2 209,491,408 - 209,491,635 UniSTS Rnor5.0 RGSC_v3.4 2 182,945,228 - 182,945,456 RGD RGSC3.4 RGSC_v3.4 2 182,945,229 - 182,945,456 UniSTS RGSC3.4 RGSC_v3.1 2 182,895,334 - 182,895,562 RGD Celera 2 170,083,109 - 170,083,334 UniSTS SHRSP x BN Map 2 70.0898 UniSTS SHRSP x BN Map 2 70.0898 RGD Cytogenetic Map 2 q34 UniSTS
RH128552
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 2 176,156,127 - 176,156,308 (+) MAPPER mRatBN7.2 Rnor_6.0 2 190,062,816 - 190,062,996 NCBI Rnor6.0 Rnor_5.0 2 209,497,175 - 209,497,355 UniSTS Rnor5.0 RGSC_v3.4 2 182,950,996 - 182,951,176 UniSTS RGSC3.4 Celera 2 170,088,874 - 170,089,054 UniSTS RH 3.4 Map 2 1166.7 UniSTS Cytogenetic Map 2 q34 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
4
2
6
9
6
16
4
6
20
13
2
1
20
16
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000051365 ⟹ ENSRNOP00000043898
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 2 176,151,288 - 176,156,441 (+) Ensembl Rnor_6.0 Ensembl 2 190,058,093 - 190,062,534 (+) Ensembl
RefSeq Acc Id:
NM_001109471 ⟹ NP_001102941
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 178,448,983 - 178,453,424 (+) NCBI mRatBN7.2 2 176,151,405 - 176,155,846 (+) NCBI Rnor_6.0 2 190,058,093 - 190,062,534 (+) NCBI Rnor_5.0 2 209,492,452 - 209,496,893 (+) NCBI RGSC_v3.4 2 182,946,273 - 182,950,714 (+) RGD Celera 2 170,084,151 - 170,088,592 (+) RGD
Sequence:
CCTGGTGGAAGTTCCCCTGTTCAGAAGTCTGCCTTTTATCTGATTTCCAGGATCATATAGAGGCTGGGCTGTGGATGAAGAGCAGCCCTGCATTGAGAGCAACAGACTCTCCACTGTCCCAGAGCCTC CTCATCTACTCTGCAGATTTGCCTGTACCCTGAAGGGTCCATCGGTCATGCCAGACACACCAGTAGAGGACTCCCTTTTCCAAATCATACACTGCTTTCATCACTATGCTGCCCGGGAAGGGGACAAG GAGACCTTGTCCCTGGAGGAGCTGAAAGCCCTGCTCTTGGATAGTGTGCCTCGCTTCATGGACACCCTGGGCCGCAGGCAGCCATACTACATCACAGAGCTCTTCCGGGCGGCTGACAAAAACAAGGA CAACCAGATCTGCTTCGATGAGTTCCTGTACATCTTGGGCAAACTGGTGAAGGACTATCATCTTCAGTTTCACCGGCAGTTGTGCACACACTACTGCACCCAGCACAACCTCTACTAAAGGGGGACAG GCAGTCTCTCATCACCAGAACTTGTTCCTGGAGACATGGCCTGACTAAGAACAGCTTACAGAACTTAGC
hide sequence
RefSeq Acc Id:
NP_001102941 ⟸ NM_001109471
- UniProtKB:
D3ZDM0 (UniProtKB/TrEMBL), A6J6Q2 (UniProtKB/TrEMBL)
- Sequence:
MPDTPVEDSLFQIIHCFHHYAAREGDKETLSLEELKALLLDSVPRFMDTLGRRQPYYITELFRAADKNKDNQICFDEFLYILGKLVKDYHLQFHRQLCTHYCTQHNLY
hide sequence
Ensembl Acc Id:
ENSRNOP00000043898 ⟸ ENSRNOT00000051365
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2008-03-05
S100a7a
S100 calcium binding protein A7A
LOC685479
similar to S100 calcium binding protein A15
Nomenclature updated to reflect human and mouse nomenclature
1299863
APPROVED
2008-01-09
LOC685479
similar to S100 calcium binding protein A15
LOC686730
similar to S100 calcium binding protein A15
Data merged from RGD:1593731
1643240
APPROVED
2006-11-20
LOC685479
similar to S100 calcium binding protein A15
Symbol and Name status set to provisional
70820
PROVISIONAL
2006-11-20
LOC686730
similar to S100 calcium binding protein A15
Symbol and Name status set to provisional
70820
PROVISIONAL