Advanced Search (OLGA)

Gene: Eif4a3 (eukaryotic translation initiation factor 4A3) Rattus norvegicus

Analyze

Symbol:

Eif4a3

Name:

eukaryotic translation initiation factor 4A3

RGD ID:

1591139

Description:

Enables RNA stem-loop binding activity; ribonucleoprotein complex binding activity; and selenocysteine insertion sequence binding activity. Involved in several processes, including cellular response to brain-derived neurotrophic factor stimulus; cellular response to selenite ion; and regulation of translation. Located in dendrite and neuronal cell body. Part of ribonucleoprotein complex. Is active in glutamatergic synapse. Human ortholog(s) of this gene implicated in intellectual disability. Orthologous to human EIF4A3 (eukaryotic translation initiation factor 4A3); PARTICIPATES IN spliceosome pathway; mRNA decay pathway; RNA transport pathway; INTERACTS WITH 2,4-dibromophenyl 2,4,5-tribromophenyl ether; 4,4'-sulfonyldiphenol; 6-propyl-2-thiouracil.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

ATP-dependent RNA helicase DDX48; ATP-dependent RNA helicase eIF4A-3; DEAD box protein 48; eIF-4A-III; eIF4A-III; eukaryotic initiation factor 4A-III; eukaryotic translation initiation factor 4A, isoform 3; LOC688288; similar to DEAD (Asp-Glu-Ala-Asp) box polypeptide 48

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	10	105,047,567 - 105,057,561 (-)	NCBI		GRCr8
mRatBN7.2	10	104,549,038 - 104,559,032 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	104,549,038 - 104,559,057 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	10	109,651,698 - 109,661,700 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	10	109,114,724 - 109,124,726 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	10	104,469,667 - 104,479,661 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	10	108,415,201 - 108,425,195 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	108,415,202 - 108,425,206 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	10	108,027,035 - 108,037,029 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
Celera	10	103,096,825 - 103,106,820 (-)	NCBI		Celera
Cytogenetic Map	10	q32.3	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

genetic disease (ISO)

glycogen storage disease II (ISO)

idiopathic generalized epilepsy (ISO)

intellectual disability (ISO)

mucopolysaccharidosis type IIIA (ISO)

pancreatic cancer (ISO)

pityriasis rubra pilaris (ISO)

Richieri Costa Pereira Syndrome (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dimethylhydrazine (ISO)

17alpha-ethynylestradiol (ISO)

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

2,4-dibromophenyl 2,4,5-tribromophenyl ether (EXP)

2-hydroxypropanoic acid (ISO)

4,4'-sulfonyldiphenol (EXP,ISO)

6-propyl-2-thiouracil (EXP)

aflatoxin B1 (ISO)

amitrole (EXP)

arsenite(3-) (ISO)

arsenous acid (ISO)

benzo[a]pyrene diol epoxide I (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

Bisphenol B (ISO)

bisphenol F (EXP,ISO)

caffeine (ISO)

carbon nanotube (ISO)

chloropicrin (ISO)

clobetasol (ISO)

clozapine (ISO)

copper atom (ISO)

copper(0) (ISO)

copper(II) sulfate (ISO)

coumarin (ISO)

Cuprizon (ISO)

diarsenic trioxide (ISO)

Dibutyl phosphate (ISO)

dibutyl phthalate (ISO)

disodium selenite (EXP)

disulfiram (ISO)

ethanol (ISO)

fenvalerate (EXP)

fipronil (EXP)

flutamide (EXP)

folic acid (ISO)

FR900359 (ISO)

gentamycin (EXP)

hydrogen peroxide (ISO)

ivermectin (ISO)

kainic acid (EXP)

lead(0) (ISO)

Licochalcone B (ISO)

Mesaconitine (EXP)

methimazole (EXP)

microcystin-LR (ISO)

N-methyl-4-phenylpyridinium (ISO)

nickel atom (ISO)

paracetamol (EXP,ISO)

phenol red (ISO)

propiconazole (EXP)

rac-lactic acid (ISO)

rotenone (EXP)

sodium arsenite (ISO)

sulfadimethoxine (EXP)

tamoxifen (ISO)

tetrachloromethane (ISO)

thiram (ISO)

titanium dioxide (ISO)

trichostatin A (ISO)

triphenyl phosphate (ISO)

urethane (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

associative learning (IEP)

cellular response to brain-derived neurotrophic factor stimulus (IEP)

cellular response to selenite ion (IEP)

chromatin looping (IEA)

chromatin remodeling (IEA)

embryonic cranial skeleton morphogenesis (ISO,ISS)

exploration behavior (IEP)

mRNA splicing, via spliceosome (IBA,ISO,ISS)

mRNA transport (IEA)

negative regulation of excitatory postsynaptic potential (IMP)

negative regulation of gene expression (IMP)

negative regulation of selenocysteine incorporation (IDA)

negative regulation of selenocysteine insertion sequence binding (IDA)

negative regulation of translation (ISO)

nuclear-transcribed mRNA catabolic process, nonsense-mediated decay (IEA,ISO)

positive regulation of mRNA splicing, via spliceosome (ISO)

positive regulation of transcription by RNA polymerase II (ISO)

positive regulation of translation (ISO)

regulation of alternative mRNA splicing, via spliceosome (ISS)

regulation of mRNA binding (IDA)

regulation of nuclear-transcribed mRNA catabolic process, nonsense-mediated decay (ISO)

regulation of translation at postsynapse, modulating synaptic transmission (IDA,IMP)

RNA splicing (IEA)

rRNA processing (IEA)

Cellular Component

catalytic step 2 spliceosome (IBA,ISO)

cytoplasm (ISO)

dendrite (IDA)

exon-exon junction complex (ISO)

glutamatergic synapse (IDA,IMP)

neuronal cell body (IDA)

nuclear speck (IEA)

nucleolus (IBA)

nucleoplasm (ISO)

nucleus (ISO)

postsynapse (IEA)

ribonucleoprotein complex (IDA)

spliceosomal complex (IEA)

U2-type catalytic step 1 spliceosome (ISO,ISS)

Molecular Function

ATP binding (IEA,ISO)

ATP hydrolysis activity (IEA)

ATP-dependent H2AZ histone chaperone activity (IEA)

ATP-dependent H3-H4 histone complex chaperone activity (IEA)

chromatin extrusion motor activity (IEA)

cohesin loader activity (IEA)

DNA clamp loader activity (IEA)

hydrolase activity (IEA)

mRNA binding (IBA,ISO)

nucleic acid binding (IEA)

poly(A) binding (ISO)

protein binding (ISO)

ribonucleoprotein complex binding (IDA)

RNA helicase activity (IBA,IEA,ISO)

RNA stem-loop binding (IDA)

selenocysteine insertion sequence binding (IDA)

Molecular Pathway Annotations Click to see Annotation Detail View

mRNA decay pathway (IEA)

RNA transport pathway (IEA)

spliceosome pathway (IEA,ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Expression of the core exon-junction complex factor eukaryotic initiation factor 4A3 is increased during spatial exploration and striatally-mediated learning.	Barker-Haliski ML, etal., Neuroscience. 2012 Dec 13;226:51-61. doi: 10.1016/j.neuroscience.2012.09.003. Epub 2012 Sep 12.
2.	Eukaryotic initiation factor 4a3 is a selenium-regulated RNA-binding protein that selectively inhibits selenocysteine incorporation.	Budiman ME, etal., Mol Cell. 2009 Aug 28;35(4):479-89. doi: 10.1016/j.molcel.2009.06.026.
3.	Identification of a signature motif for the eIF4a3-SECIS interaction.	Budiman ME, etal., Nucleic Acids Res. 2011 Sep 1;39(17):7730-9. doi: 10.1093/nar/gkr446. Epub 2011 Jun 17.
4.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
5.	The EJC factor eIF4AIII modulates synaptic strength and neuronal protein expression.	Giorgi C, etal., Cell. 2007 Jul 13;130(1):179-91.
6.	Contribution of copy number variants involving nonsense-mediated mRNA decay pathway genes to neuro-developmental disorders.	Nguyen LS, etal., Hum Mol Genet. 2013 May 1;22(9):1816-25. doi: 10.1093/hmg/ddt035. Epub 2013 Jan 31.
7.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
8.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
9.	GOA pipeline	RGD automated data pipeline
10.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
11.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
12.	The ever-increasing complexities of the exon junction complex.	Tange TO, etal., Curr Opin Cell Biol. 2004 Jun;16(3):279-84.
13.	Proteomics-based identification of DEAD-box protein 48 as a novel autoantigen, a prospective serum marker for pancreatic cancer.	Xia Q, etal., Biochem Biophys Res Commun. 2005 May 6;330(2):526-32.

Additional References at PubMed

PMID:10523622	PMID:11991638	PMID:12477932	PMID:15632090	PMID:16209946	PMID:16601204	PMID:18423201	PMID:18480465	PMID:19946888	PMID:22658674	PMID:22681889	PMID:22961380
PMID:24360810	PMID:24625528	PMID:29301961	PMID:30053369	PMID:37839527

Genomics

Comparative Map Data

Eif4a3
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	10	105,047,567 - 105,057,561 (-)	NCBI		GRCr8
mRatBN7.2	10	104,549,038 - 104,559,032 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	104,549,038 - 104,559,057 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	10	109,651,698 - 109,661,700 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	10	109,114,724 - 109,124,726 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	10	104,469,667 - 104,479,661 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	10	108,415,201 - 108,425,195 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	108,415,202 - 108,425,206 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	10	108,027,035 - 108,037,029 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
Celera	10	103,096,825 - 103,106,820 (-)	NCBI		Celera
Cytogenetic Map	10	q32.3	NCBI

EIF4A3
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	17	80,134,369 - 80,147,128 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	17	80,134,369 - 80,147,151 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	17	78,108,168 - 78,120,927 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	17	75,723,612 - 75,735,533 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	17	75,723,612 - 75,735,533	NCBI
Celera	17	74,737,992 - 74,749,960 (-)	NCBI		Celera
Cytogenetic Map	17	q25.3	NCBI
HuRef	17	73,549,709 - 73,561,680 (-)	NCBI		HuRef
CHM1_1	17	78,195,223 - 78,207,193 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	17	81,034,760 - 81,047,523 (-)	NCBI		T2T-CHM13v2.0

Eif4a3
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	11	119,179,189 - 119,190,869 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	11	119,179,189 - 119,190,915 (-)	Ensembl		GRCm39 Ensembl
GRCm38	11	119,288,363 - 119,300,043 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	11	119,288,363 - 119,300,089 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	11	119,149,677 - 119,161,357 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	11	119,104,453 - 119,116,133 (-)	NCBI		MGSCv36	mm8
Celera	11	131,033,290 - 131,044,990 (-)	NCBI		Celera
Cytogenetic Map	11	E2	NCBI
cM Map	11	83.35	NCBI

Eif4a3
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955506	2,749,534 - 2,760,873 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955506	2,749,534 - 2,760,873 (+)	NCBI	ChiLan1.0	ChiLan1.0

LOC100988043
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	19	96,549,687 - 96,561,728 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	17	101,614,275 - 101,626,237 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	17	74,221,793 - 74,233,738 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3

EIF4A3
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	9	1,582,950 - 1,593,893 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	9	1,582,993 - 1,593,892 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	9	2,222,792 - 2,233,743 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	9	2,215,271 - 2,226,216 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	9	2,215,233 - 2,226,208 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	9	2,238,677 - 2,249,620 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	9	2,364,112 - 2,375,060 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	9	2,445,388 - 2,456,373 (+)	NCBI		UU_Cfam_GSD_1.0

Eif4a3
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405602	2,251,664 - 2,263,559 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936594	4,147,685 - 4,160,293 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936594	4,148,401 - 4,160,290 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

EIF4A3
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	12	2,285,579 - 2,313,874 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	12	2,285,679 - 2,311,750 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	12	2,267,492 - 2,293,229 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

EIF4A3
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	16	72,097,692 - 72,113,112 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666077	43,403,306 - 43,418,370 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Eif4a3
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624801	9,240,780 - 9,250,863 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624801	9,240,780 - 9,250,864 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Eif4a3
57 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	30
Count of miRNA genes:	29
Interacting mature miRNAs:	30
Transcripts:	ENSRNOT00000073140
Prediction methods:	Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
7387312	Bw125	Body weight QTL 125	3	0.0047	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight (CMO:0000356)	10	64890616	107211142	Rat
12880384	Cm107	Cardiac mass QTL 107		0.001	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)		90404397	107211142	Rat
1354641	Bvd2	Brain ventricular dilatation QTL 2	6.36	0.001	brain ventricle morphology trait (VT:0000822)	hydrocephalus severity score (CMO:0001881)	10	93223816	107057807	Rat
12880385	Cm108	Cardiac mass QTL 108		0.001	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)		90404397	107211142	Rat
2303589	Bw87	Body weight QTL 87	2		body mass (VT:0001259)	body weight (CMO:0000012)	10	81285008	107211142	Rat
2317029	Aia19	Adjuvant induced arthritis QTL 19	2.98		joint integrity trait (VT:0010548)	left rear ankle joint diameter (CMO:0002149)	10	66978955	107211142	Rat
12880396	Am13	Aortic mass QTL 13		0.001	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	10	90404397	107211142	Rat
61449	Ciaa2	CIA Autoantibody QTL 2	7.1		blood autoantibody amount (VT:0003725)	calculated serum anti-type 2 collagen antibody titer (CMO:0001279)	10	63221094	107211142	Rat
12880398	Kidm67	Kidney mass QTL 67		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	10	90404397	107211142	Rat
61387	Bp1	Blood pressure QTL 1	5.1		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	10	51770177	107211142	Rat
2317039	Aia6	Adjuvant induced arthritis QTL 6	4.31		joint integrity trait (VT:0010548)	right rear ankle joint diameter (CMO:0002150)	10	66978955	107211142	Rat
1298078	Stresp5	Stress response QTL 5	2.99	0.00025	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	10	42045676	104670812	Rat
12880395	Cm109	Cardiac mass QTL 109		0.001	heart right ventricle mass (VT:0007033)	heart right ventricle weight to body weight ratio (CMO:0000914)	10	90404397	107211142	Rat
1579915	Bp280	Blood pressure QTL 280		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	90404397	107211142	Rat
61396	Bp9	Blood pressure QTL 9	4.8	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	68420376	107211142	Rat
2298548	Neuinf7	Neuroinflammation QTL 7	3.4		nervous system integrity trait (VT:0010566)	spinal cord RT1-B protein level (CMO:0002132)	10	72224939	107211142	Rat
1302404	Cia27	Collagen induced arthritis QTL 27	2.6	0.0045	joint integrity trait (VT:0010548)	experimental arthritis severity measurement (CMO:0001459)	10	76452683	107211142	Rat
634320	Niddm49	Non-insulin dependent diabetes mellitus QTL 49	4.41		blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	10	88539139	107211142	Rat
2317754	Glom25	Glomerulus QTL 25	3.5		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	10	82685200	107211142	Rat
70171	Cari1	Carrageenan-induced inflammation QTL 1	4.9	0.0005	hypodermis integrity trait (VT:0010550)	inflammatory exudate volume (CMO:0001429)	10	53797385	107211142	Rat
1331791	Cm31	Cardiac mass QTL 31	3.84606		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	10	29299504	107211142	Rat
10450498	Bp384	Blood pressure QTL 384		0.002	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	67750049	107211142	Rat
4889492	Pancm2	Pancreatic morphology QTL 2	3.2		pancreatic beta cell morphology trait (VT:0005217)	ratio of insulin-positive cell area to total area of splenic region of pancreas (CMO:0001814)	10	76748906	107211142	Rat
6893366	Bw106	Body weight QTL 106	0.3	0.47	body mass (VT:0001259)	body weight (CMO:0000012)	10	70199100	107211142	Rat
10450493	Bp382	Blood pressure QTL 382		0.002	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	94759759	107211142	Rat
1578672	Bmd16	Bone mineral density QTL 16	6.2		femur mineral mass (VT:0010011)	compact volumetric bone mineral density (CMO:0001730)	10	96703043	107057807	Rat
2293646	Bss25	Bone structure and strength QTL 25	10.96	0.0001	femur morphology trait (VT:0000559)	femur cross-sectional area (CMO:0001661)	10	69738412	107211142	Rat
2313103	Bss80	Bone structure and strength QTL 80	2	0.0001	tibia strength trait (VT:1000284)	tibia midshaft endosteal cross-sectional area (CMO:0001716)	10	62057807	107057807	Rat
2303118	Mamtr7	Mammary tumor resistance QTL 7		0.003	mammary gland integrity trait (VT:0010552)	mammary tumor growth rate (CMO:0000344)	10	9658275	104670812	Rat
2300172	Bmd57	Bone mineral density QTL 57	9.8	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	10	69738412	107211142	Rat
70193	Mcs7	Mammary carcinoma susceptibility QTL 7	2.38		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	10	72224939	107211142	Rat
2313105	Bss79	Bone structure and strength QTL 79	1.8	0.0001	tibia size trait (VT:0100001)	tibia midshaft cross-sectional area (CMO:0001717)	10	62057807	107057807	Rat
61363	Oia3	Oil induced arthritis QTL 3		0.001	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	87307617	107211142	Rat
2292438	Bp311	Blood pressure QTL 311			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	76246085	107211142	Rat
2316949	Gluco60	Glucose level QTL 60	3.7		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	10	14487011	107057807	Rat
2292436	Bp310	Blood pressure QTL 310			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	94759759	107211142	Rat
724530	Bp149	Blood pressure QTL 149		0.0001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	90627439	107211142	Rat
631539	Oia6	Oil induced arthritis QTL 6			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	97010147	104670812	Rat
1300137	Bp186	Blood pressure QTL 186	3.57		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	10	90627439	107057807	Rat
631538	Oia5	Oil induced arthritis QTL 5			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	87055121	107211142	Rat
1642980	Bp300	Blood pressure QTL 300			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	68383129	107211142	Rat
2293663	Bss33	Bone structure and strength QTL 33	9.34	0.0001	femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	10	69738412	107211142	Rat
1578663	Bss18	Bone structure and strength QTL 18	3.6		femur width (VT:1000666)	femoral neck width (CMO:0001695)	10	96703043	107057807	Rat

Markers in Region

D10Got223

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	10	104,552,104 - 104,552,234 (+)	MAPPER	mRatBN7.2
Rnor_6.0	10	108,418,268 - 108,418,397	NCBI	Rnor6.0
Rnor_5.0	10	108,030,102 - 108,030,231	UniSTS	Rnor5.0
Celera	10	103,099,893 - 103,100,022	UniSTS

RH137027

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	10	104,549,126 - 104,549,399 (+)	MAPPER	mRatBN7.2
Rnor_6.0	10	108,415,290 - 108,415,562	NCBI	Rnor6.0
Rnor_5.0	10	108,027,124 - 108,027,396	UniSTS	Rnor5.0
Celera	10	103,096,914 - 103,097,186	UniSTS

RH129599

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	10	104,549,065 - 104,549,373 (+)	MAPPER	mRatBN7.2
Rnor_6.0	10	108,415,229 - 108,415,536	NCBI	Rnor6.0
Rnor_5.0	10	108,027,063 - 108,027,370	UniSTS	Rnor5.0
Celera	10	103,096,853 - 103,097,160	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001100158	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC105875	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473948	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CO559861	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ234161	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000010	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000073140 ⟹ ENSRNOP00000066302

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	10	104,549,038 - 104,559,057 (-)	Ensembl
Rnor_6.0 Ensembl	10	108,415,202 - 108,425,206 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000095583 ⟹ ENSRNOP00000080401

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	10	104,549,038 - 104,559,057 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000114380 ⟹ ENSRNOP00000081737

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	10	104,549,045 - 104,559,019 (-)	Ensembl

RefSeq Acc Id:

NM_001100158 ⟹ NP_001093628

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	105,047,567 - 105,057,561 (-)	NCBI
mRatBN7.2	10	104,549,038 - 104,559,032 (-)	NCBI
Rnor_6.0	10	108,415,201 - 108,425,195 (-)	NCBI
Rnor_5.0	10	108,027,035 - 108,037,029 (-)	NCBI
Celera	10	103,096,825 - 103,106,820 (-)	NCBI

Sequence:

show sequence

GCGAGCCTTGTTTCCGGTTCCCGCCGCAGCTCGCAGTTGTCTATTAGTGGGGTCGGGATCATGG
CGGCCACGGCCACGATGGCGACGTCGGGCTCCGCGCGGAAGCGGCTGCTCAAAGAGGAGGACAT
GACCAAAGTGGAGTTCGAGACCAGCGAGGAGGTGGACGTGACCCCCACGTTCGACACCATGGGC
CTTCGGGAGGACCTGCTGCGCGGCATCTACGCCTACGGTTTTGAAAAACCTTCTGCGATCCAAC
AGCGTGCTATCAAGCAGATAATTAAAGGGAGAGATGTCATTGCACAGTCTCAGTCTGGCACAGG
CAAGACGGCCACCTTCAGTATTTCAGTCCTTCAGTGCTTGGATATCCAGGTTCGAGAAACCCAA
GCTTTGATATTGGCTCCAACAAGAGAGTTAGCAGTGCAGATTCAGAAGGGTCTGCTTGCTTTGG
GGGATTACATGAACGTGCAGTGCCATGCCTGCATTGGTGGCACCAATGTCGGGGAGGACATCCG
GAAGCTGGACTATGGGCAGCATGTTGTGGCGGGCACACCAGGACGAGTCTTTGATATGATCCGC
CGTAGAAGTTTAAGGACACGGGCAATCAAGATGTTGGTTTTGGATGAAGCTGATGAAATGTTGA
ACAAAGGTTTCAAGGAGCAGATCTATGACGTGTACAGGTACTTGCCACCAGCCACTCAGGTTGT
TCTCATCAGCGCCACGCTGCCCCATGAGATCCTGGAGATGACCAACAAGTTCATGACCGACCCC
ATCCGCATCTTGGTGAAGCGTGATGAGTTGACTCTGGAAGGCATCAAACAGTTCTTCGTGGCCG
TGGAAAGAGAGGAATGGAAGTTCGACACTCTCTGTGATCTCTACGACACGCTGACCATCACCCA
GGCTGTCATCTTCTGCAACACCAAGAGGAAGGTTGACTGGCTGACAGAGAAAATGAGAGAAGCC
AATTTCACAGTGTCGTCCATGCACGGAGACATGCCCCAGAAAGAGCGTGAGTCCATCATGAAGG
AGTTCCGGTCAGGTGCCAGCCGAGTGCTCATCTCCACAGATGTCTGGGCGCGGGGCCTCGATGT
CCCTCAGGTGTCCCTCATCATTAACTATGACCTGCCCAACAACAGAGAACTGTACATTCACAGA
ATCGGGAGATCAGGTCGATATGGACGCAAAGGTGTGGCCATCAATTTTGTGAAGAATGATGACA
TCCGCATCCTCAGGGACATTGAGCAGTACTACTCCACCCAGATAGATGAGATGCCTATGAATGT
GGCTGACCTCATCTGAAGCTGGTGCTGGTACACCAAGGGCCTGTTTGGAGCTCCTCTTTGGACA
TGGAAGCTTCTATTTAATGGGGTTTATATGAACTGTCTTCTCATAGCCCTCAGGAGGACCCTCG
GCCTCTGCCATCTTTTCTAATGCACGTGTAAATAATCCAATGCGCTAAATCTTTTACATTAAAC
ATGGAAATTTTCCCACGAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001093628	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAI05876	(Get FASTA)	NCBI Sequence Viewer
	EDM06783	(Get FASTA)	NCBI Sequence Viewer
	EDM06784	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000066302.1
	ENSRNOP00000080401.1
	ENSRNOP00000081737.1
	ENSRNOP00055046755
	ENSRNOP00060038779
	ENSRNOP00065004611
GenBank Protein	Q3B8Q2	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_001093628 ⟸ NM_001100158

- UniProtKB:

Q3B8Q2 (UniProtKB/Swiss-Prot), A0A8I5ZT01 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MAATATMATSGSARKRLLKEEDMTKVEFETSEEVDVTPTFDTMGLREDLLRGIYAYGFEKPSAI
QQRAIKQIIKGRDVIAQSQSGTGKTATFSISVLQCLDIQVRETQALILAPTRELAVQIQKGLLA
LGDYMNVQCHACIGGTNVGEDIRKLDYGQHVVAGTPGRVFDMIRRRSLRTRAIKMLVLDEADEM
LNKGFKEQIYDVYRYLPPATQVVLISATLPHEILEMTNKFMTDPIRILVKRDELTLEGIKQFFV
AVEREEWKFDTLCDLYDTLTITQAVIFCNTKRKVDWLTEKMREANFTVSSMHGDMPQKERESIM
KEFRSGASRVLISTDVWARGLDVPQVSLIINYDLPNNRELYIHRIGRSGRYGRKGVAINFVKND
DIRILRDIEQYYSTQIDEMPMNVADLI

hide sequence

Ensembl Acc Id:

ENSRNOP00000066302 ⟸ ENSRNOT00000073140

Ensembl Acc Id:

ENSRNOP00000080401 ⟸ ENSRNOT00000095583

Ensembl Acc Id:

ENSRNOP00000081737 ⟸ ENSRNOT00000114380

Protein Domains

DEAD-box RNA helicase Q Helicase ATP-binding Helicase C-terminal

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q3B8Q2-F1-model_v2	AlphaFold	Q3B8Q2	1-411	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13697944

Promoter ID:

EPDNEW_R8468

Type:

initiation region

Name:

Eif4a3_1

Description:

eukaryotic translation initiation factor 4A3

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	10	108,425,157 - 108,425,217	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1591139	AgrOrtholog
BioCyc Gene	G2FUF-22495	BioCyc
Ensembl Genes	ENSRNOG00000045791	Ensembl, UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	ENSRNOG00055032767	UniProtKB/Swiss-Prot
	ENSRNOG00060026889	UniProtKB/Swiss-Prot
	ENSRNOG00065004580	UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000073140.3	UniProtKB/Swiss-Prot
	ENSRNOT00000095583.1	UniProtKB/TrEMBL
	ENSRNOT00000114380.1	UniProtKB/TrEMBL
	ENSRNOT00055056649	UniProtKB/Swiss-Prot
	ENSRNOT00060046639	UniProtKB/Swiss-Prot
	ENSRNOT00065006668	UniProtKB/Swiss-Prot
Gene3D-CATH	3.40.50.300	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7130292	IMAGE-MGC_LOAD
InterPro	DEAD/DEAH_box_helicase_dom	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Helicase_ATP-bd	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Helicase_C	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	P-loop_NTPase	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	RNA-helicase_DEAD-box_CS	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	RNA_helicase_DEAD_Q_motif	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:688288	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:125040	IMAGE-MGC_LOAD
NCBI Gene	688288	ENTREZGENE
PANTHER	ATP-DEPENDENT RNA HELICASE DBP3	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	EUKARYOTIC INITIATION FACTOR 4A-III	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	DEAD	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Helicase_C	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Eif4a3	PhenoGen
PROSITE	DEAD_ATP_HELICASE	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	HELICASE_ATP_BIND_1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	HELICASE_CTER	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Q_MOTIF	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000045791	RatGTEx
	ENSRNOG00055032767	RatGTEx
	ENSRNOG00060026889	RatGTEx
	ENSRNOG00065004580	RatGTEx
SMART	DEXDc	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	HELICc	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	SSF52540	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A0A8I5ZSA0_RAT	UniProtKB/TrEMBL
	A0A8I5ZT01	ENTREZGENE, UniProtKB/TrEMBL
	IF4A3_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2013-08-01	Eif4a3	eukaryotic translation initiation factor 4A3	Eif4a3	eukaryotic translation initiation factor 4A, isoform 3	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-09-23	Eif4a3	eukaryotic translation initiation factor 4A, isoform 3	LOC688288	similar to DEAD (Asp-Glu-Ala-Asp) box polypeptide 48	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-11-20	LOC688288	similar to DEAD (Asp-Glu-Ala-Asp) box polypeptide 48			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

RGD Manual Annotations

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

RGD Manual Annotations

Imported Annotations - KEGG (archival)