Symbol:
Psmg4
Name:
proteasome assembly chaperone 4
RGD ID:
1589955
Description:
Predicted to be involved in proteasome assembly. Predicted to be part of protein-containing complex. Orthologous to human PSMG4 (proteasome assembly chaperone 4); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; bisphenol A; endosulfan.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
hypothetical LOC291080; hypothetical protein LOC689623; LOC291080; LOC689623; MGC189533; proteasome (prosome, macropain) assembly chaperone 4; RGD1305541
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 17 30,916,031 - 30,923,430 (-) NCBI GRCr8 mRatBN7.2 17 30,710,682 - 30,718,035 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 17 30,710,682 - 30,718,082 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 17 30,524,382 - 30,531,720 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 17 32,128,134 - 32,135,472 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 17 30,520,126 - 30,527,464 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 17 31,402,581 - 31,411,924 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 17 31,404,578 - 31,411,957 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 17 33,298,992 - 33,306,344 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 17 37,050,867 - 37,058,209 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 17 30,275,063 - 30,282,405 (-) NCBI Celera Cytogenetic Map 17 p12 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Psmg4 Rat (+)-catechin multiple interactions ISO PSMG4 (Homo sapiens) 6480464 [Catechin co-treated with Grape Seed Proanthocyanidins] results in increased expression of PSMG4 mRNA CTD PMID:24763279 Psmg4 Rat (1->4)-beta-D-glucan multiple interactions ISO Psmg4 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of PSMG4 mRNA CTD PMID:36331819 Psmg4 Rat 1,2-dimethylhydrazine multiple interactions ISO Psmg4 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of PSMG4 mRNA CTD PMID:22206623 Psmg4 Rat 2,3',4,4',5-Pentachlorobiphenyl increases expression ISO Psmg4 (Mus musculus) 6480464 2 more ... CTD PMID:31388691 Psmg4 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Psmg4 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin affects the methylation of PSMG4 intron] which results in decreased expression of PSMG4 mRNA CTD PMID:33017471 Psmg4 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of PSMG4 mRNA CTD PMID:33387578 Psmg4 Rat 4,4'-sulfonyldiphenol increases expression ISO Psmg4 (Mus musculus) 6480464 bisphenol S results in increased expression of PSMG4 mRNA CTD PMID:39298647 Psmg4 Rat aflatoxin B1 decreases methylation ISO PSMG4 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of PSMG4 gene CTD PMID:27153756 Psmg4 Rat all-trans-retinoic acid decreases expression ISO PSMG4 (Homo sapiens) 6480464 Tretinoin results in decreased expression of PSMG4 mRNA CTD PMID:21934132 and PMID:33167477 Psmg4 Rat antirheumatic drug increases expression ISO PSMG4 (Homo sapiens) 6480464 Antirheumatic Agents results in increased expression of PSMG4 mRNA CTD PMID:24449571 Psmg4 Rat aristolochic acid A increases expression ISO PSMG4 (Homo sapiens) 6480464 aristolochic acid I results in increased expression of PSMG4 protein CTD PMID:33212167 Psmg4 Rat bis(2-ethylhexyl) phthalate increases expression ISO Psmg4 (Mus musculus) 6480464 Diethylhexyl Phthalate results in increased expression of PSMG4 mRNA CTD PMID:33754040 Psmg4 Rat bisphenol A decreases expression ISO PSMG4 (Homo sapiens) 6480464 bisphenol A results in decreased expression of PSMG4 mRNA CTD PMID:25047013 Psmg4 Rat bisphenol A increases expression ISO Psmg4 (Mus musculus) 6480464 bisphenol A results in increased expression of PSMG4 mRNA CTD PMID:32156529 and PMID:33221593 Psmg4 Rat bisphenol A multiple interactions ISO PSMG4 (Homo sapiens) 6480464 [[ginger extract results in increased abundance of Oils and Volatile] which co-treated with bisphenol A] affects the expression of PSMG4 protein CTD PMID:33376534 Psmg4 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of PSMG4 mRNA CTD PMID:25181051 Psmg4 Rat bisphenol F decreases expression ISO Psmg4 (Mus musculus) 6480464 bisphenol F results in decreased expression of PSMG4 mRNA CTD PMID:38685157 Psmg4 Rat butanal decreases expression ISO PSMG4 (Homo sapiens) 6480464 butyraldehyde results in decreased expression of PSMG4 mRNA CTD PMID:26079696 Psmg4 Rat cadmium atom multiple interactions ISO PSMG4 (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of PSMG4 mRNA CTD PMID:35301059 Psmg4 Rat cadmium dichloride multiple interactions ISO PSMG4 (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of PSMG4 mRNA CTD PMID:35301059 Psmg4 Rat chlorpyrifos increases expression ISO Psmg4 (Mus musculus) 6480464 Chlorpyrifos results in increased expression of PSMG4 mRNA CTD PMID:37019170 Psmg4 Rat clofibrate decreases expression ISO Psmg4 (Mus musculus) 6480464 Clofibrate results in decreased expression of PSMG4 mRNA CTD PMID:17585979 Psmg4 Rat cyclosporin A decreases expression ISO PSMG4 (Homo sapiens) 6480464 Cyclosporine results in decreased expression of PSMG4 mRNA CTD PMID:25562108 Psmg4 Rat dorsomorphin multiple interactions ISO PSMG4 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of PSMG4 mRNA CTD PMID:27188386 Psmg4 Rat endosulfan increases expression EXP 6480464 Endosulfan results in increased expression of PSMG4 mRNA CTD PMID:29391264 Psmg4 Rat epoxiconazole decreases expression ISO Psmg4 (Mus musculus) 6480464 epoxiconazole results in decreased expression of PSMG4 mRNA CTD PMID:35436446 Psmg4 Rat ethyl methanesulfonate decreases expression ISO PSMG4 (Homo sapiens) 6480464 Ethyl Methanesulfonate results in decreased expression of PSMG4 mRNA CTD PMID:23649840 Psmg4 Rat folic acid multiple interactions ISO Psmg4 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of PSMG4 mRNA CTD PMID:22206623 Psmg4 Rat formaldehyde decreases expression ISO PSMG4 (Homo sapiens) 6480464 Formaldehyde results in decreased expression of PSMG4 mRNA CTD PMID:23649840 Psmg4 Rat furan increases expression EXP 6480464 furan results in increased expression of PSMG4 mRNA CTD PMID:26194646 Psmg4 Rat isobutanol multiple interactions ISO PSMG4 (Homo sapiens) 6480464 [[Gasoline co-treated with isobutyl alcohol] results in increased abundance of [Particulate Matter co-treated with Polycyclic Aromatic Hydrocarbons]] which results in decreased expression of PSMG4 mRNA CTD PMID:29432896 Psmg4 Rat ivermectin decreases expression ISO PSMG4 (Homo sapiens) 6480464 Ivermectin results in decreased expression of PSMG4 protein CTD PMID:32959892 Psmg4 Rat ketoconazole increases expression ISO PSMG4 (Homo sapiens) 6480464 Ketoconazole results in increased expression of PSMG4 mRNA CTD PMID:36621641 Psmg4 Rat methyl methanesulfonate decreases expression ISO PSMG4 (Homo sapiens) 6480464 Methyl Methanesulfonate results in decreased expression of PSMG4 mRNA CTD PMID:23649840 Psmg4 Rat nitrates multiple interactions ISO Psmg4 (Mus musculus) 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of PSMG4 mRNA CTD PMID:35964746 Psmg4 Rat ozone multiple interactions ISO PSMG4 (Homo sapiens) 6480464 [Air Pollutants results in increased abundance of Ozone] which affects the expression of PSMG4 mRNA CTD PMID:35430440 Psmg4 Rat paracetamol decreases expression ISO PSMG4 (Homo sapiens) 6480464 Acetaminophen results in decreased expression of PSMG4 mRNA CTD PMID:21420995 Psmg4 Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of PSMG4 mRNA CTD PMID:33387578 Psmg4 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Psmg4 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of PSMG4 mRNA CTD PMID:36331819 Psmg4 Rat phenylmercury acetate increases expression ISO PSMG4 (Homo sapiens) 6480464 Phenylmercuric Acetate results in increased expression of PSMG4 mRNA CTD PMID:26272509 Psmg4 Rat phenylmercury acetate multiple interactions ISO PSMG4 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of PSMG4 mRNA CTD PMID:27188386 Psmg4 Rat quercetin decreases expression ISO PSMG4 (Homo sapiens) 6480464 Quercetin results in decreased expression of PSMG4 mRNA CTD PMID:21632981 Psmg4 Rat SB 431542 multiple interactions ISO PSMG4 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of PSMG4 mRNA CTD PMID:27188386 Psmg4 Rat sodium arsenite decreases expression ISO PSMG4 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of PSMG4 mRNA CTD PMID:38568856 Psmg4 Rat temozolomide increases expression ISO PSMG4 (Homo sapiens) 6480464 Temozolomide results in increased expression of PSMG4 mRNA CTD PMID:31758290 Psmg4 Rat tetrachloromethane affects expression ISO Psmg4 (Mus musculus) 6480464 Carbon Tetrachloride affects the expression of PSMG4 mRNA CTD PMID:17484886 Psmg4 Rat titanium dioxide decreases methylation ISO Psmg4 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of PSMG4 gene CTD PMID:35295148 Psmg4 Rat toluene decreases expression EXP 6480464 Toluene results in decreased expression of PSMG4 mRNA CTD PMID:22967744 Psmg4 Rat triptonide decreases expression ISO Psmg4 (Mus musculus) 6480464 triptonide results in decreased expression of PSMG4 mRNA CTD PMID:33045310 Psmg4 Rat tungsten increases expression ISO Psmg4 (Mus musculus) 6480464 Tungsten results in increased expression of PSMG4 mRNA CTD PMID:30912803 Psmg4 Rat urethane decreases expression ISO PSMG4 (Homo sapiens) 6480464 Urethane results in decreased expression of PSMG4 mRNA CTD PMID:28818685 Psmg4 Rat valproic acid increases expression ISO PSMG4 (Homo sapiens) 6480464 Valproic Acid results in increased expression of PSMG4 mRNA CTD PMID:23179753 Psmg4 Rat vincristine increases expression ISO PSMG4 (Homo sapiens) 6480464 Vincristine results in increased expression of PSMG4 mRNA CTD PMID:23649840
(+)-catechin (ISO) (1->4)-beta-D-glucan (ISO) 1,2-dimethylhydrazine (ISO) 2,3',4,4',5-Pentachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 4,4'-sulfonyldiphenol (ISO) aflatoxin B1 (ISO) all-trans-retinoic acid (ISO) antirheumatic drug (ISO) aristolochic acid A (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol F (ISO) butanal (ISO) cadmium atom (ISO) cadmium dichloride (ISO) chlorpyrifos (ISO) clofibrate (ISO) cyclosporin A (ISO) dorsomorphin (ISO) endosulfan (EXP) epoxiconazole (ISO) ethyl methanesulfonate (ISO) folic acid (ISO) formaldehyde (ISO) furan (EXP) isobutanol (ISO) ivermectin (ISO) ketoconazole (ISO) methyl methanesulfonate (ISO) nitrates (ISO) ozone (ISO) paracetamol (EXP,ISO) perfluorooctane-1-sulfonic acid (ISO) phenylmercury acetate (ISO) quercetin (ISO) SB 431542 (ISO) sodium arsenite (ISO) temozolomide (ISO) tetrachloromethane (ISO) titanium dioxide (ISO) toluene (EXP) triptonide (ISO) tungsten (ISO) urethane (ISO) valproic acid (ISO) vincristine (ISO)
Psmg4 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 17 30,916,031 - 30,923,430 (-) NCBI GRCr8 mRatBN7.2 17 30,710,682 - 30,718,035 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 17 30,710,682 - 30,718,082 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 17 30,524,382 - 30,531,720 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 17 32,128,134 - 32,135,472 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 17 30,520,126 - 30,527,464 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 17 31,402,581 - 31,411,924 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 17 31,404,578 - 31,411,957 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 17 33,298,992 - 33,306,344 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 17 37,050,867 - 37,058,209 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 17 30,275,063 - 30,282,405 (-) NCBI Celera Cytogenetic Map 17 p12 NCBI
PSMG4 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 6 3,254,404 - 3,268,049 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 6 3,231,403 - 3,303,373 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 6 3,259,181 - 3,268,283 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 6 3,203,548 - 3,213,298 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 6 4,488,059 - 4,497,215 (+) NCBI Celera Cytogenetic Map 6 p25.2 NCBI HuRef 6 3,137,004 - 3,146,143 (+) NCBI HuRef CHM1_1 6 3,261,618 - 3,270,777 (+) NCBI CHM1_1 T2T-CHM13v2.0 6 3,123,453 - 3,136,452 (+) NCBI T2T-CHM13v2.0
Psmg4 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 13 34,346,947 - 34,362,155 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 13 34,346,947 - 34,362,156 (+) Ensembl GRCm39 Ensembl GRCm38 13 34,162,964 - 34,178,172 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 13 34,162,964 - 34,178,173 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 13 34,254,846 - 34,270,041 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 13 34,170,429 - 34,185,638 (+) NCBI MGSCv36 mm8 Celera 13 35,297,101 - 35,305,067 (+) NCBI Celera Cytogenetic Map 13 A3.3 NCBI cM Map 13 14.05 NCBI
Psmg4 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955465 10,007,023 - 10,014,921 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955465 10,007,136 - 10,014,921 (-) NCBI ChiLan1.0 ChiLan1.0
PSMG4 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 5 17,890,875 - 17,900,007 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 6 13,894,419 - 13,903,563 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 6 3,097,462 - 3,106,866 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 6 3,286,677 - 3,295,747 (+) NCBI panpan1.1 PanPan1.1 panPan2
PSMG4 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 35 3,523,541 - 3,540,300 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 35 3,525,780 - 3,540,295 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 35 3,537,156 - 3,550,867 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 35 3,586,270 - 3,599,990 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 35 3,586,284 - 3,599,984 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 35 3,462,481 - 3,475,940 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 35 3,484,866 - 3,498,381 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 35 4,817,425 - 4,831,140 (+) NCBI UU_Cfam_GSD_1.0
Psmg4 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404946 20,915,762 - 20,924,428 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936534 9,184,492 - 9,193,420 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936534 9,184,748 - 9,193,414 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
PSMG4 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 7 1,980,292 - 1,988,729 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 7 1,980,295 - 1,987,946 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 7 2,041,124 - 2,048,776 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
PSMG4 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 17 68,917,108 - 68,926,020 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 17 68,917,180 - 68,925,912 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666044 3,195,721 - 3,204,631 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Psmg4
.
Predicted Target Of
Count of predictions: 21 Count of miRNA genes: 21 Interacting mature miRNAs: 21 Transcripts: ENSRNOT00000060132 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1354581 Bp247 Blood pressure QTL 247 4.5 arterial blood pressure trait (VT:2000000) pulse pressure (CMO:0000292) 17 1 69599340 Rat 2300002 Iddm36 Insulin dependent diabetes mellitus QTL 36 1.98 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 17 9991286 40540197 Rat 1354640 Scl32 Serum cholesterol level QTL 32 5.4 blood HDL cholesterol amount (VT:0000184) blood high density lipoprotein cholesterol level (CMO:0000052) 17 15781592 60781592 Rat 152023626 Bp403 Blood pressure QTL 403 3.86 arterial blood pressure trait (VT:2000000) 17 23930421 79524188 Rat 1300123 Bp194 Blood pressure QTL 194 2.82 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 17 2115149 34551001 Rat 9590107 Sffal7 Serum free fatty acids level QTL 7 4.81 0.001 blood free fatty acid amount (VT:0001553) plasma free fatty acids level (CMO:0000546) 17 28409147 73409147 Rat 2302377 Scl61 Serum cholesterol level QTL 61 4.36 blood HDL cholesterol amount (VT:0000184) serum high density lipoprotein cholesterol level (CMO:0000361) 17 27389946 53481766 Rat 70157 Niddm32 Non-insulin dependent diabetes mellitus QTL 32 4.34 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 17 22454924 50909196 Rat 1354651 Lmblg2 Limb length QTL 2 6 tibia length (VT:0004357) tibia length (CMO:0000450) 17 4299130 69599340 Rat 1354628 Stl13 Serum triglyceride level QTL 13 3.8 blood triglyceride amount (VT:0002644) blood triglyceride level (CMO:0000118) 17 21293039 60781592 Rat 1581512 Cm55 Cardiac mass QTL 55 2.8 0.05 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 17 27027949 56836890 Rat 10401807 Kidm52 Kidney mass QTL 52 kidney mass (VT:0002707) both kidneys wet weight (CMO:0000085) 17 1 31701463 Rat 10054088 Scort28 Serum corticosterone level QTL 28 2.04 0.0102 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 17 4528038 49528038 Rat 1354630 Cm34 Cardiac mass QTL 34 8.7 heart left ventricle mass (VT:0007031) heart left ventricle wet weight (CMO:0000071) 17 4299130 69599340 Rat 61394 Bp8 Blood pressure QTL 8 2.2 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 17 23080567 59555013 Rat 1559055 Bp278 Blood pressure QTL 278 0.04 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 17 23653184 68653184 Rat 152025238 Slep14 Serum leptin concentration QTL 14 4.62 blood leptin amount (VT:0005667) 17 24184890 79524188 Rat 1354638 Insul1 Insulin level QTL 1 4.8 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 17 4299130 69599340 Rat 1354613 Kidm14 Kidney mass QTL 14 6.2 kidney mass (VT:0002707) left kidney wet weight (CMO:0000083) 17 4299130 35837242 Rat 1331765 Hrtrt15 Heart rate QTL 15 4.094 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 17 15330613 55836425 Rat 8552928 Pigfal9 Plasma insulin-like growth factor 1 level QTL 9 9 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 17 28409147 73409147 Rat 2303627 Vencon8 Ventilatory control QTL 8 0.001 respiration trait (VT:0001943) tidal volume (CMO:0000222) 17 4528038 49528038 Rat 12903980 Cm120 Cardiac mass QTL 120 0.002 heart right ventricle mass (VT:0007033) heart right ventricle weight to body weight ratio (CMO:0000914) 17 23653184 68653184 Rat 70184 BpQTLcluster14 Blood pressure QTL cluster 14 3.38 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 17 1 31990913 Rat 12903981 Am17 Aortic mass QTL 17 0.001 aorta mass (VT:0002845) aorta weight to aorta length to body weight ratio (CMO:0002722) 17 23653184 68653184 Rat 4889891 Eae32 Experimental allergic encephalomyelitis QTL 32 4.8 0.0002 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis severity score (CMO:0001419) 17 27027949 36146731 Rat 4889955 Bss93 Bone structure and strength QTL 93 4.4 tibia size trait (VT:0100001) tibia cortical bone volume to tibia total bone volume ratio (CMO:0001727) 17 27027949 60463643 Rat 2303561 Bw91 Body weight QTL 91 2 body mass (VT:0001259) body weight (CMO:0000012) 17 8868462 53868462 Rat 12903982 Kidm70 Kidney mass QTL 70 0.001 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 17 23653184 70974005 Rat 631207 Niddm41 Non-insulin dependent diabetes mellitus QTL 41 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 17 1 37830672 Rat 12903978 Cm118 Cardiac mass QTL 118 0.001 heart mass (VT:0007028) heart wet weight to body weight ratio (CMO:0002408) 17 23653184 68653184 Rat 12903979 Cm119 Cardiac mass QTL 119 0.001 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 17 23653184 68653184 Rat 1354619 Bp242 Blood pressure QTL 242 6.3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 17 24599340 69599340 Rat 1354596 Bw32 Body weight QTL 32 4.5 body mass (VT:0001259) body weight (CMO:0000012) 17 4299130 60781592 Rat 1354662 Rf49 Renal function QTL 49 2.9 blood creatinine amount (VT:0005328) plasma creatinine level (CMO:0000537) 17 1 69599340 Rat 152023740 Bp406 Blood pressure QTL 406 6.06 arterial blood pressure trait (VT:2000000) 17 23930421 79524188 Rat 7488966 Bp370 Blood pressure QTL 370 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 17 23653184 57246843 Rat 1354658 Spl8 Serum phospholipid level QTL 8 3.8 blood VLDL phospholipid amount (VT:0010507) blood very low density lipoprotein phospholipid level (CMO:0001571) 17 1 60781592 Rat 152023737 Bp405 Blood pressure QTL 405 5.06 arterial blood pressure trait (VT:2000000) 23930421 79524188 Rat 1354659 Scl68 Serum cholesterol level QTL 68 3.9 blood VLDL cholesterol amount (VT:0005144) blood very low density lipoprotein cholesterol level (CMO:0000648) 17 15781592 60781592 Rat 152023736 Bp404 Blood pressure QTL 404 3.78 arterial blood pressure trait (VT:2000000) 17 23930421 79524188 Rat
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000060132 ⟹ ENSRNOP00000056879
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 17 30,710,682 - 30,718,082 (-) Ensembl Rnor_6.0 Ensembl 17 31,404,578 - 31,411,957 (-) Ensembl
RefSeq Acc Id:
NM_001129879 ⟹ NP_001123351
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 17 30,916,031 - 30,923,373 (-) NCBI mRatBN7.2 17 30,710,682 - 30,718,024 (-) NCBI Rnor_6.0 17 31,404,577 - 31,411,919 (-) NCBI Rnor_5.0 17 33,298,992 - 33,306,344 (-) NCBI RGSC_v3.4 17 37,050,867 - 37,058,209 (-) RGD Celera 17 30,275,063 - 30,282,405 (-) RGD
Sequence:
CGCAGCTGAAAGTGAAAGAGCGCTCAGCTTTTCGGCGCTCGCTCTTTCTGGTCTGGTCTCCCGCGCTTGCCTGGTCTAGGCTGTGGCCCGGTGGCTGGCGGGATGGAGGAGCCGCAAGCCGCCGCGGA
hide sequence
RefSeq Acc Id:
XM_006253847 ⟹ XP_006253909
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 17 30,916,033 - 30,923,430 (-) NCBI mRatBN7.2 17 30,710,683 - 30,718,029 (-) NCBI Rnor_6.0 17 31,402,581 - 31,411,924 (-) NCBI Rnor_5.0 17 33,298,992 - 33,306,344 (-) NCBI
Sequence:
GCGCGCGCAGCTGAAAGTGAAAGAGCGCTCAGCTTTTCGGCGCTCGCTCTTTCTGGTCTGGTCT
hide sequence
RefSeq Acc Id:
XM_039096086 ⟹ XP_038952014
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 17 30,916,033 - 30,923,430 (-) NCBI mRatBN7.2 17 30,710,683 - 30,718,035 (-) NCBI
RefSeq Acc Id:
NP_001123351 ⟸ NM_001129879
- UniProtKB:
B2RZB8 (UniProtKB/TrEMBL)
- Sequence:
MEEPQAAADVSLHNFSARLWEQLVHFHVMRLTDSLFLWVGATPHLRNLAVAMCSRFDSIPVCTSLFGDTSDTTSTGLAQRLARKTSKQVFVSYNLSNTDSNFTLLVENRIKEEMETFPEKF
hide sequence
RefSeq Acc Id:
XP_006253909 ⟸ XM_006253847
- Peptide Label:
isoform X1
- Sequence:
MEEPQAAADVSLHNFSARLWEQLVHFHVMRLTDSLFLWVGATPHLRNLAVAMCSRFDSIPVCTSLFGDTSDTTSTGLAQRLGRPANRCLSATTSPIQTVTSRYS
hide sequence
Ensembl Acc Id:
ENSRNOP00000056879 ⟸ ENSRNOT00000060132
RefSeq Acc Id:
XP_038952014 ⟸ XM_039096086
- Peptide Label:
isoform X2
- UniProtKB:
A6J7G2 (UniProtKB/TrEMBL)
RGD ID: 13700411 Promoter ID: EPDNEW_R10934 Type: initiation region Name: Psmg4_1 Description: proteasome assembly chaperone 4 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 17 31,411,876 - 31,411,936 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-04-14
Psmg4
proteasome assembly chaperone 4
Psmg4
proteasome (prosome, macropain) assembly chaperone 4
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2009-06-15
Psmg4
proteasome (prosome, macropain) assembly chaperone 4
RGD1305541
hypothetical LOC291080
Data merged from RGD:1305541
1643240 APPROVED
2008-04-30
RGD1305541
hypothetical LOC291080
RGD1305541_predicted
hypothetical LOC291080 (predicted)
'predicted' is removed
2292626 APPROVED
2008-03-17
Psmg4
proteasome (prosome, macropain) assembly chaperone 4
LOC689623
hypothetical protein LOC689623
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2006-11-20
LOC689623
hypothetical protein LOC689623
Symbol and Name status set to provisional
70820 PROVISIONAL
2005-01-20
RGD1305541_predicted
hypothetical LOC291080 (predicted)
LOC291080_predicted
Symbol and Name status set to approved
1331353 APPROVED
2005-01-12
LOC291080_predicted
hypothetical LOC291080 (predicted)
Symbol and Name status set to provisional
70820 PROVISIONAL
