Advanced Search (OLGA)

Gene: Pinlyp (phospholipase A2 inhibitor and Ly6/Plaur domain containing) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Pinlyp

Name:

phospholipase A2 inhibitor and Ly6/Plaur domain containing

RGD ID:

1565787

Description:

Predicted to enable phospholipase inhibitor activity. Predicted to be located in extracellular region. Orthologous to human PINLYP (phospholipase A2 inhibitor and LY6/PLAUR domain containing); INTERACTS WITH 1,2-dimethylhydrazine; 17beta-estradiol; 17beta-estradiol 3-benzoate.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

hypothetical protein LOC308429; LOC308429; phospholipase A2 inhibitor and Ly6/PLAUR domain-containing protein; RGD1565787; similar to RIKEN cDNA 1810065E05; uncharacterized protein LOC308429

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	89,262,559 - 89,268,402 (-)	NCBI		GRCr8
mRatBN7.2	1	80,134,642 - 80,140,488 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	80,134,643 - 80,139,996 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	85,528,340 - 85,533,594 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	94,078,092 - 94,083,445 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	87,284,166 - 87,289,420 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	81,406,632 - 81,412,602 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	81,406,576 - 81,412,251 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	82,666,950 - 82,673,380 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	79,827,538 - 79,832,891 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	1	74,587,684 - 74,593,037 (-)	NCBI		Celera
Cytogenetic Map	1	q21	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Pinlyp	Rat	ethylmalonic encephalopathy		ISO	PINLYP (Homo sapiens)	8554872	ClinVar Annotator: match by term: Ethylmalonic encephalopathy	ClinVar	PMID:28492532
Pinlyp	Rat	schizophrenia		ISO	PINLYP (Homo sapiens)	8554872	ClinVar Annotator: match by term: Schizophrenia	ClinVar	PMID:21681106 and PMID:30208311

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Pinlyp	Rat	1,2-dimethylhydrazine	increases expression	EXP		6480464	1 and 2-Dimethylhydrazine results in increased expression of PINLYP mRNA	CTD	PMID:27840820
Pinlyp	Rat	17beta-estradiol	multiple interactions	EXP		6480464	[estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of PINLYP mRNA	CTD	PMID:32741896
Pinlyp	Rat	17beta-estradiol 3-benzoate	multiple interactions	EXP		6480464	[estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of PINLYP mRNA	CTD	PMID:32741896
Pinlyp	Rat	2,3,7,8-tetrachlorodibenzodioxine	increases expression	EXP		6480464	Tetrachlorodibenzodioxin results in increased expression of PINLYP mRNA	CTD	PMID:33387578
Pinlyp	Rat	2-hydroxypropanoic acid	decreases expression	ISO	PINLYP (Homo sapiens)	6480464	Lactic Acid results in decreased expression of PINLYP mRNA	CTD	PMID:30851411
Pinlyp	Rat	3,3',5,5'-tetrabromobisphenol A	decreases expression	EXP		6480464	tetrabromobisphenol A results in decreased expression of PINLYP mRNA	CTD	PMID:28300664
Pinlyp	Rat	3,7-dihydropurine-6-thione	increases expression	EXP		6480464	Mercaptopurine results in increased expression of PINLYP mRNA	CTD	PMID:23358152
Pinlyp	Rat	aristolochic acid A	increases expression	ISO	PINLYP (Homo sapiens)	6480464	aristolochic acid I results in increased expression of PINLYP mRNA	CTD	PMID:33212167
Pinlyp	Rat	bis(2-ethylhexyl) phthalate	increases expression	ISO	Pinlyp (Mus musculus)	6480464	Diethylhexyl Phthalate results in increased expression of PINLYP mRNA	CTD	PMID:33754040
Pinlyp	Rat	bisphenol A	increases expression	EXP		6480464	bisphenol A results in increased expression of PINLYP mRNA	CTD	PMID:25181051
Pinlyp	Rat	bisphenol A	decreases expression	ISO	PINLYP (Homo sapiens)	6480464	bisphenol A results in decreased expression of PINLYP mRNA	CTD	PMID:27685785
Pinlyp	Rat	copper atom	decreases expression	EXP		6480464	Copper results in decreased expression of PINLYP mRNA	CTD	PMID:30556269
Pinlyp	Rat	copper(0)	decreases expression	EXP		6480464	Copper results in decreased expression of PINLYP mRNA	CTD	PMID:30556269
Pinlyp	Rat	dibenzo[a,l]pyrene	decreases expression	ISO	Pinlyp (Mus musculus)	6480464	dibenzo(a and l)pyrene results in decreased expression of PINLYP mRNA	CTD	PMID:25908611
Pinlyp	Rat	diuron	increases expression	EXP		6480464	Diuron results in increased expression of PINLYP mRNA	CTD	PMID:21551480
Pinlyp	Rat	dorsomorphin	multiple interactions	ISO	PINLYP (Homo sapiens)	6480464	[NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of PINLYP mRNA	CTD	PMID:27188386
Pinlyp	Rat	endosulfan	decreases expression	EXP		6480464	Endosulfan results in decreased expression of PINLYP mRNA	CTD	PMID:29391264
Pinlyp	Rat	fenvalerate	increases expression	EXP		6480464	fenvalerate results in increased expression of PINLYP mRNA	CTD	PMID:30307764
Pinlyp	Rat	genistein	increases expression	ISO	Pinlyp (Mus musculus)	6480464	Genistein results in increased expression of PINLYP mRNA	CTD	PMID:32186404
Pinlyp	Rat	manganese(II) chloride	increases expression	EXP		6480464	manganese chloride results in increased expression of PINLYP mRNA	CTD	PMID:28801915
Pinlyp	Rat	mercaptopurine	increases expression	EXP		6480464	Mercaptopurine results in increased expression of PINLYP mRNA	CTD	PMID:23358152
Pinlyp	Rat	N-methyl-4-phenylpyridinium	increases expression	EXP		6480464	1-Methyl-4-phenylpyridinium results in increased expression of PINLYP mRNA	CTD	PMID:28801915
Pinlyp	Rat	paracetamol	increases expression	EXP		6480464	Acetaminophen results in increased expression of PINLYP mRNA	CTD	PMID:33387578
Pinlyp	Rat	phenylmercury acetate	decreases expression	ISO	PINLYP (Homo sapiens)	6480464	Phenylmercuric Acetate results in decreased expression of PINLYP mRNA	CTD	PMID:26272509
Pinlyp	Rat	phenylmercury acetate	multiple interactions	ISO	PINLYP (Homo sapiens)	6480464	[NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of PINLYP mRNA	CTD	PMID:27188386
Pinlyp	Rat	purine-6-thiol	increases expression	EXP		6480464	Mercaptopurine results in increased expression of PINLYP mRNA	CTD	PMID:23358152
Pinlyp	Rat	rac-lactic acid	decreases expression	ISO	PINLYP (Homo sapiens)	6480464	Lactic Acid results in decreased expression of PINLYP mRNA	CTD	PMID:30851411
Pinlyp	Rat	SB 431542	multiple interactions	ISO	PINLYP (Homo sapiens)	6480464	[NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of PINLYP mRNA	CTD	PMID:27188386
Pinlyp	Rat	sodium arsenite	decreases expression	ISO	PINLYP (Homo sapiens)	6480464	sodium arsenite results in decreased expression of PINLYP mRNA	CTD	PMID:38568856
Pinlyp	Rat	sunitinib	decreases expression	ISO	PINLYP (Homo sapiens)	6480464	Sunitinib results in decreased expression of PINLYP mRNA	CTD	PMID:31533062
Pinlyp	Rat	temozolomide	decreases expression	ISO	PINLYP (Homo sapiens)	6480464	Temozolomide results in decreased expression of PINLYP mRNA	CTD	PMID:31758290
Pinlyp	Rat	testosterone	multiple interactions	EXP		6480464	[estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of PINLYP mRNA	CTD	PMID:32741896
Pinlyp	Rat	trichloroethene	increases expression	EXP		6480464	Trichloroethylene results in increased expression of PINLYP mRNA	CTD	PMID:33387578
Pinlyp	Rat	triptonide	increases expression	ISO	Pinlyp (Mus musculus)	6480464	triptonide results in increased expression of PINLYP mRNA	CTD	PMID:33045310
Pinlyp	Rat	valproic acid	affects expression	ISO	PINLYP (Homo sapiens)	6480464	Valproic Acid affects the expression of PINLYP mRNA	CTD	PMID:25979313
Pinlyp	Rat	valproic acid	decreases expression	ISO	PINLYP (Homo sapiens)	6480464	Valproic Acid results in decreased expression of PINLYP mRNA	CTD	PMID:28001369

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Pinlyp	Rat	extracellular region	located_in	IEA	UniProtKB-SubCell:SL-0243	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Pinlyp	Rat	extracellular region	located_in	IEA	InterPro:IPR004126	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Pinlyp	Rat	extracellular region	located_in	IEA	UniProtKB-KW:KW-0964	1600115	GO_REF:0000043	UniProt	GO_REF:0000043

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Pinlyp	Rat	phospholipase inhibitor activity	enables	IEA	InterPro:IPR004126	1600115	GO_REF:0000002	InterPro	GO_REF:0000002

#	Reference Title	Reference Citation
1.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Pinlyp
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	89,262,559 - 89,268,402 (-)	NCBI		GRCr8
mRatBN7.2	1	80,134,642 - 80,140,488 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	80,134,643 - 80,139,996 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	85,528,340 - 85,533,594 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	94,078,092 - 94,083,445 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	87,284,166 - 87,289,420 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	81,406,632 - 81,412,602 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	81,406,576 - 81,412,251 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	82,666,950 - 82,673,380 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	79,827,538 - 79,832,891 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	1	74,587,684 - 74,593,037 (-)	NCBI		Celera
Cytogenetic Map	1	q21	NCBI

PINLYP
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	19	43,575,509 - 43,582,098 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	19	43,575,801 - 43,583,964 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	19	44,079,953 - 44,086,250 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	19	48,773,233 - 48,778,111 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	19	40,883,431 - 40,888,735 (+)	NCBI		Celera
Cytogenetic Map	19	q13.31	NCBI
HuRef	19	40,511,711 - 40,517,015 (+)	NCBI		HuRef
CHM1_1	19	44,082,674 - 44,087,982 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	19	46,397,139 - 46,403,730 (+)	NCBI		T2T-CHM13v2.0

Pinlyp
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	7	24,241,079 - 24,246,045 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	7	24,241,083 - 24,245,543 (-)	Ensembl		GRCm39 Ensembl
GRCm38	7	24,541,654 - 24,546,668 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	7	24,541,658 - 24,546,118 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	7	25,326,677 - 25,331,024 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	7	24,250,418 - 24,254,765 (-)	NCBI		MGSCv36	mm8
Celera	7	19,155,756 - 19,160,110 (-)	NCBI		Celera
Cytogenetic Map	7	A3	NCBI
cM Map	7	11.38	NCBI

Pinlyp
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0	NW_004955555	1,316,543 - 1,322,241 (+)	NCBI	ChiLan1.0	ChiLan1.0

PINLYP
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	20	49,734,139 - 49,741,031 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	19	51,603,669 - 51,613,026 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	19	40,517,393 - 40,524,027 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	19	49,126,946 - 49,132,243 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	19	49,126,946 - 49,132,243 (+)	Ensembl	panpan1.1		panPan2

PINLYP
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	1	111,543,894 - 111,547,656 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	1	111,544,005 - 111,547,581 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	1	111,023,620 - 111,027,380 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	1	112,154,025 - 112,157,785 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	1	112,153,211 - 112,157,712 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	1	111,742,114 - 111,745,873 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	1	111,375,953 - 111,379,709 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	1	112,260,229 - 112,263,989 (-)	NCBI		UU_Cfam_GSD_1.0

Pinlyp
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024409349	16,436,889 - 16,441,290 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936706	784,865 - 789,463 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936706	786,338 - 788,983 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

PINLYP
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1	6	50,426,551 - 50,432,273 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	6	46,183,472 - 46,186,423 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

PINLYP
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	6	37,095,060 - 37,101,645 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666073	16,638,037 - 16,644,083 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Pinlyp
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla 1.0	NW_004624907	1,113,466 - 1,118,751 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Pinlyp
17 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	88
Count of miRNA genes:	76
Interacting mature miRNAs:	82
Transcripts:	ENSRNOT00000026946
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2313059	Bss55	Bone structure and strength QTL 55	3.2	0.0001	tibia size trait (VT:0100001)	tibia midshaft cross-sectional area (CMO:0001717)	1	43284731	118944897	Rat
631688	Hcas2	Hepatocarcinoma susceptibility QTL 2	3	0.0001	liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	1	5925874	115540829	Rat
1578649	Bmd8	Bone mineral density QTL 8	4.9		femur mineral mass (VT:0010011)	trabecular volumetric bone mineral density (CMO:0001729)	1	49393172	94393172	Rat
1582234	Gluco18	Glucose level QTL 18	3.4	0.0003	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	78479925	123479925	Rat
1358359	Sradr1	Stress Responsive Adrenal Weight QTL 1	4.74		adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	1	30882023	123479925	Rat
634314	Niddm44	Non-insulin dependent diabetes mellitus QTL 44			blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	49393289	199050459	Rat
4889929	Bss87	Bone structure and strength QTL 87	6.7		tibia area (VT:1000281)	tibia-fibula cortical bone endosteal cross-sectional area (CMO:0001722)	1	53895117	82174945	Rat
2313062	Bmd73	Bone mineral density QTL 73	3.9	0.0001	tibia mineral mass (VT:1000283)	compact volumetric bone mineral density (CMO:0001730)	1	11481312	82174945	Rat
1578654	Bss10	Bone structure and strength QTL 10	4		femur morphology trait (VT:0000559)	femoral neck cortical cross-sectional area (CMO:0001702)	1	49393172	159356837	Rat
1554320	Bmd1	Bone mineral density QTL 1	12.2	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	1	509108	86060548	Rat
2302059	Pia36	Pristane induced arthritis QTL 36	3.8	0.001	blood immunoglobulin amount (VT:0002460)	serum immunoglobulin G1 level (CMO:0002115)	1	43333002	88333002	Rat
2313065	Bss67	Bone structure and strength QTL 67	3.1	0.0001	tibia area (VT:1000281)	tibia total energy absorbed before break (CMO:0001736)	1	11481312	82174945	Rat
1300121	Hrtrt1	Heart rate QTL 1	3.7		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	1	65789093	115540829	Rat
7421628	Bp361	Blood pressure QTL 361		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	66023617	118608521	Rat
2313069	Bss68	Bone structure and strength QTL 68	2.9	0.0001	tibia size trait (VT:0100001)	tibia total energy absorbed before break (CMO:0001736)	1	11481312	82174945	Rat
631495	Bp96	Blood pressure QTL 96	4.52		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	22340647	102268831	Rat
2313075	Bss66	Bone structure and strength QTL 66	3.4	0.0001	tibia length (VT:0004357)	tibia length (CMO:0000450)	1	11481312	82174945	Rat
70225	Bp58	Blood pressure QTL 58	3.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	32356093	162846471	Rat
631512	Scl6	Serum cholesterol level QTL 6	9.6		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	1	72197680	90508767	Rat
2298545	Neuinf8	Neuroinflammation QTL 8	4.6		nervous system integrity trait (VT:0010566)	spinal cord beta-2 microglobulin mRNA level (CMO:0002125)	1	57336763	151090257	Rat
2313072	Bss53	Bone structure and strength QTL 53	4.3	0.0001	tibia length (VT:0004357)	tibia length (CMO:0000450)	1	43284731	118944897	Rat
10059597	Bp377	Blood pressure QTL 377	3.42	0.025	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	32737458	199368955	Rat
2313078	Bss54	Bone structure and strength QTL 54	3.5	0.0001	tibia area (VT:1000281)	tibia midshaft cross-sectional area (CMO:0001717)	1	43284731	118944897	Rat
2313077	Bss69	Bone structure and strength QTL 69	3.5	0.0001	tibia strength trait (VT:1000284)	bone polar moment of inertia (CMO:0001558)	1	11481312	82174945	Rat
1549903	Bp267	Blood pressure QTL 267			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	77876254	106047988	Rat
2313402	Anxrr24	Anxiety related response QTL 24			aggression-related behavior trait (VT:0015014)	tameness/aggressiveness composite score (CMO:0002136)	1	48963584	144267916	Rat
61342	Bp27	Blood pressure QTL 27	3.4	0.0006	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	56732668	98773277	Rat
1300172	Bp172	Blood pressure QTL 172	3.56		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	1	32737273	90665040	Rat
4889962	Bss94	Bone structure and strength QTL 94	3.8		tibia area (VT:1000281)	tibia-fibula cortical bone endosteal cross-sectional area (CMO:0001722)	1	49361465	82174945	Rat
61344	Bp29	Blood pressure QTL 29	7.5		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	78350581	123350581	Rat
1358192	Ept13	Estrogen-induced pituitary tumorigenesis QTL 13	3.4		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	1	77494165	122494165	Rat
2313094	Bss58	Bone structure and strength QTL 58	3.7	0.0001	tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	1	43284731	118944897	Rat
6903308	Scl36	Serum cholesterol QTL 36	2	0.0125	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	1	53863041	90532583	Rat
2313092	Bmd72	Bone mineral density QTL 72	2.5	0.0001	tibia mineral mass (VT:1000283)	total volumetric bone mineral density (CMO:0001728)	1	11481312	82174945	Rat
2300164	Bmd44	Bone mineral density QTL 44	5.4	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	1	56949932	101949932	Rat
2313099	Bss56	Bone structure and strength QTL 56	2.4	0.0001	tibia size trait (VT:0100001)	tibia midshaft endosteal cross-sectional area (CMO:0001716)	1	43284731	118944897	Rat
2313098	Bmd70	Bone mineral density QTL 70	3.6	0.0001	tibia mineral mass (VT:1000283)	compact volumetric bone mineral density (CMO:0001730)	1	43284731	118944897	Rat
2313097	Bss70	Bone structure and strength QTL 70	3.5	0.0001	tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	1	11481312	82174945	Rat
152025249	Scl82	Serum cholesterol level QTL 82	4.77		blood cholesterol amount (VT:0000180)		1	50343510	99980958	Rat
10054135	Gmadr2	Adrenal mass QTL 2	1.97	0.0129	adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	1	77857876	122857876	Rat
7411712	Strs4	Sensitivity to stroke QTL 4	8.7		cerebrum integrity trait (VT:0010549)	percentage of study population developing cerebrovascular lesions during a period of time (CMO:0000932)	1	78430536	123430536	Rat
4889919	Bss86	Bone structure and strength QTL 86	4.1		tibia area (VT:1000281)	tibia midshaft total cross-sectional area (CMO:0001715)	1	53895117	82174945	Rat
2313051	Bss57	Bone structure and strength QTL 57	3.7	0.0001	tibia strength trait (VT:1000284)	bone polar moment of inertia (CMO:0001558)	1	43284731	118944897	Rat
61433	Cia2	Collagen induced arthritis QTL 2	5		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	1	78430754	91209302	Rat

RH129761

Rat Assembly	Chr	Position (strand)	Source	JBrowse
RH 3.4 Map	1	821.9	UniSTS
Cytogenetic Map	1	q21	UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
6	11	34	84	34	43	12	13	12	6	129	60	74	43	59	31


RefSeq Transcripts	NM_001107488	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017589117	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH473979	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000001	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000026946 ⟹ ENSRNOP00000026946

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	80,134,643 - 80,139,996 (-)	Ensembl
Rnor_6.0 Ensembl	1	81,406,576 - 81,412,251 (-)	Ensembl

RefSeq Acc Id:

NM_001107488 ⟹ NP_001100958

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	89,262,560 - 89,267,913 (-)	NCBI
mRatBN7.2	1	80,134,643 - 80,139,996 (-)	NCBI
Rnor_6.0	1	81,406,633 - 81,412,077 (-)	NCBI
Rnor_5.0	1	82,666,950 - 82,673,380 (-)	NCBI
RGSC_v3.4	1	79,827,538 - 79,832,891 (-)	RGD
Celera	1	74,587,684 - 74,593,037 (-)	RGD

Sequence:

show sequence

GGGTTCACACACCATGATTCTGTTTAGAAGACACAGGACCTTCCTGCTGGCCTTAACACTGCTCTGTACCCTCCTGGGTCTCGGCTGCCCTCTAAGTTGTGAAGTGTGCAAAGGCTCGGGGCACACAT
GCAGCGGTAAGATGAAGACCTGTGAAGCCGGCAAAGACGCATGCGTGGTCCTCGTGGGCGAGTCCAGCACAAAGGGCCGAAAGTCAGTGAACACCTTCAAGGCCTGCATGAAGTTCAAAGACTGCTAC
TCAGGCTTCGTATCGACCACCATGAGTCCCAATGACTACATGGTGTCCAACGCCCACTGCTGTCAAAGTGACGGTTGCAACAGTGGCTCCGTGCCCCCTCCCCCGAACAACCGGACTGAGAATGGCCT
GATGTGTCCCTCCTGCATTGCGCCCTTCCAGGAGACCTGTCCAGGAACCCAGGCAGCCCGCTGCGTGGGCCGGGAAACACACTGCATCTATTTTGCTGGCAATGTGCAGGCTGGTATTATCAACACGA
AATTTGCCACGAGGGGCTGTGCTACAGAGAGCGCCTGCTACACGAAGGCAGGAGCTGAGGTCCCTTCTGCTTCCTATCTCTACTTCCTGCGCCGGGCAGACTGCCTTCCCGCACCTTACCCGCCTGGC
AGGGGAGAGTGAAGAACCAAGAAGTGTGTGATTTGAGGAGCCCTGCAGCTCTCCAGATGCCTGTAAATTAAAACACGTCGATAGTACAAACCTC

hide sequence

RefSeq Acc Id:

XM_017589117 ⟹ XP_017444606

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	89,262,559 - 89,268,402 (-)	NCBI
mRatBN7.2	1	80,134,642 - 80,140,488 (-)	NCBI
Rnor_6.0	1	81,406,632 - 81,412,602 (-)	NCBI

Sequence:

show sequence

GGCTGGAGCTGGACACAGCTCAGATACAGAAGCATGAGAGTGAGACAGGCACACGAAAGAGAAAGGAAAGGCGACAAGGCGCCCGGCCCCCGCAGGACAGGCCTAGACATGCTGGGCGCTCCCAGGGT
GAAGGTGGGACCAGACCCGCCCTTCCCCAGCTTCCTATAAGGGCCGAGGACCTGGGACTCCGGGTTCACACACCATGATTCTGTTTAGAAGACACAGGACCTTCCTGCTGGCCTTAACACTGCTCTGT
ACCCTCCTGGGTCTCGGCTGCCCTCTAAGTTGTGAAGTGTGCAAAGGCTCGGGGCACACATGCAGCGGTAAGATGAAGACCTGTGAAGCCGGCAAAGACGCATGCGTGGTCCTCGTGGGCGAGTCCAG
CACAAAGGGCCGAAAGTCAGTGAACACCTTCAAGGCCTGCATGAAGTTCAAAGACTGCTACTCAGGCTTCGTATCGACCACCATGAGTCCCAATGACTACATGGTGTCCAACGCCCACTGCTGTCAAA
GTGACGGTTGCAACAGTGGCTCCGTGCCCCCTCCCCCGAACAACCGGACTGAGAATGGCCTGATGTGTCCCTCCTGCATTGCGCCCTTCCAGGAGACCTGTCCAGGAACCCAGGCAGCCCGCTGCGTG
GGCCGGGAAACACACTGCATCTATTTTGCTGGCAATGTGCAGGCTGGTATTATCAACACGAAATTTGCCACGAGGGGCTGTGCTACAGAGAGCGCCTGCTACACGAAGGCAGGAGCTGAGGTCCCTTC
TGCTTCCTATCTCTACTTCCTGCGCCGGGCAGACTGCCTTCCCGCACCTTACCCGCCTGGCAGGGGAGAGTGAAGAACCAAGAAGTGTGTGATTTGAGGAGCCCTGCAGCTCTCCAGATGCCTGTAAA
TTAAAACACGTCGATAGTACAAACCTCA

hide sequence


Protein RefSeqs	NP_001100958	(Get FASTA)	NCBI Sequence Viewer
	XP_017444606	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDM08088	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000026946
	ENSRNOP00000026946.3

RefSeq Acc Id:	NP_001100958 ⟸ NM_001107488
- Peptide Label:	precursor
- UniProtKB:	D4A499 (UniProtKB/TrEMBL), A6J8Z6 (UniProtKB/TrEMBL)
- Sequence:	show sequence MILFRRHRTFLLALTLLCTLLGLGCPLSCEVCKGSGHTCSGKMKTCEAGKDACVVLVGESSTKGRKSVNTFKACMKFKDCYSGFVSTTMSPNDYMVSNAHCCQSDGCNSGSVPPPPNNRTENGLMCPS CIAPFQETCPGTQAARCVGRETHCIYFAGNVQAGIINTKFATRGCATESACYTKAGAEVPSASYLYFLRRADCLPAPYPPGRGE hide sequence

RefSeq Acc Id:	XP_017444606 ⟸ XM_017589117
- Peptide Label:	isoform X1
- UniProtKB:	D4A499 (UniProtKB/TrEMBL), A6J8Z6 (UniProtKB/TrEMBL)
- Sequence:	show sequence MILFRRHRTFLLALTLLCTLLGLGCPLSCEVCKGSGHTCSGKMKTCEAGKDACVVLVGESSTKGRKSVNTFKACMKFKDCYSGFVSTTMSPNDYMVSNAHCCQSDGCNSGSVPPPPNNRTENGLMCPS CIAPFQETCPGTQAARCVGRETHCIYFAGNVQAGIINTKFATRGCATESACYTKAGAEVPSASYLYFLRRADCLPAPYPPGRGE hide sequence

Ensembl Acc Id:

ENSRNOP00000026946 ⟸ ENSRNOT00000026946

Protein Domains

Phospholipase A2 inhibitor N-terminal UPAR/Ly6

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D4A499-F1-model_v2	AlphaFold	D4A499	1-212	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-60439	BioCyc
Ensembl Genes	ENSRNOG00000019862	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000026946	ENTREZGENE
	ENSRNOT00000026946.6	UniProtKB/TrEMBL
Gene3D-CATH	2.10.60.10	UniProtKB/TrEMBL
InterPro	CNF-like_PLA2_Inhibitor	UniProtKB/TrEMBL
	LY6_UPA_recep-like	UniProtKB/TrEMBL
	PLA2_inh	UniProtKB/TrEMBL
	Snake_toxin-like_sf	UniProtKB/TrEMBL
KEGG Report	rno:308429	UniProtKB/TrEMBL
NCBI Gene	308429	ENTREZGENE
PANTHER	LY6/PLAUR DOMAIN-CONTAINING PROTEIN 8	UniProtKB/TrEMBL
	PHOSPHOLIPASE A2 INHIBITOR AND LY6/PLAUR DOMAIN-CONTAINING PROTEIN	UniProtKB/TrEMBL
Pfam	PLA2_inh	UniProtKB/TrEMBL
	UPAR_LY6	UniProtKB/TrEMBL
PhenoGen	Pinlyp	PhenoGen
PROSITE	PROKAR_LIPOPROTEIN	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000019862	RatGTEx
Superfamily-SCOP	SSF57302	UniProtKB/TrEMBL
UniProt	A6J8Z6	ENTREZGENE, UniProtKB/TrEMBL
	D4A499	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2022-09-15	Pinlyp	phospholipase A2 inhibitor and Ly6/Plaur domain containing	Pinlyp	phospholipase A2 inhibitor and LY6/PLAUR domain containing	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2012-10-12	Pinlyp	phospholipase A2 inhibitor and LY6/PLAUR domain containing	RGD1565787	similar to RIKEN cDNA 1810065E05	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-04-30	RGD1565787	similar to RIKEN cDNA 1810065E05	RGD1565787_predicted	similar to RIKEN cDNA 1810065E05 (predicted)	'predicted' is removed	2292626	APPROVED
2006-03-07	RGD1565787_predicted	similar to RIKEN cDNA 1810065E05 (predicted)	LOC308429	similar to RIKEN cDNA 1810065E05	Symbol and Name status set to approved	1299863	APPROVED
2006-02-09	LOC308429	similar to RIKEN cDNA 1810065E05			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Send us a Message

Imported Disease Annotations - ClinVar