Advanced Search (OLGA)

Gene: Apip (APAF1 interacting protein) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Apip

Name:

APAF1 interacting protein

RGD ID:

1564562

Description:

Predicted to enable identical protein binding activity; methylthioribulose 1-phosphate dehydratase activity; and zinc ion binding activity. Predicted to be involved in protein homotetramerization; pyroptotic inflammatory response; and regulation of ERK1 and ERK2 cascade. Predicted to act upstream of or within negative regulation of apoptotic process. Predicted to be located in endomembrane system. Predicted to be active in cytoplasm. Orthologous to human APIP (APAF1 interacting protein); PARTICIPATES IN cysteine and methionine metabolic pathway; INTERACTS WITH 1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane; 2,2',4,4'-Tetrabromodiphenyl ether; 2,3,7,8-tetrachlorodibenzodioxine.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

LOC295961; methylthioribulose-1-phosphate dehydratase; probable methylthioribulose-1-phosphate dehydratase; RGD1564562; similar to MMRP19

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	APIP (APAF1 interacting protein)	HGNC	Ensembl, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Apip (APAF1 interacting protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Apip (APAF1 interacting protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	APIP (APAF1 interacting protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	APIP (APAF1 interacting protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Apip (APAF1 interacting protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	APIP (APAF1 interacting protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	APIP (APAF1 interacting protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Apip (APAF1 interacting protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	ADAMTS19 (ADAM metallopeptidase with thrombospondin type 1 motif 19)	HGNC	OMA
Alliance orthologs ³
Mus musculus (house mouse):	Apip (APAF1 interacting protein)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	APIP (APAF1 interacting protein)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	apip (APAF1 interacting protein)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG11134	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	MDE1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	ZC373.5	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	apip	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	109,886,919 - 109,913,295 (+)	NCBI		GRCr8
mRatBN7.2	3	89,431,964 - 89,458,000 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	89,432,037 - 89,458,340 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	3	92,931,217 - 92,957,295 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	101,530,251 - 101,556,331 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	99,359,187 - 99,385,302 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	92,969,128 - 92,998,104 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	92,969,141 - 92,995,483 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	3	99,612,110 - 99,640,878 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	3	88,306,123 - 88,332,800 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	3	88,509,653 - 88,535,688 (+)	NCBI		Celera
Cytogenetic Map	3	q32	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Apip	Rat	intellectual disability		ISO	APIP (Homo sapiens)	8554872	ClinVar Annotator: match by term: Intellectual disability	ClinVar
Apip	Rat	Pyruvate Dehydrogenase E3-Binding Protein Deficiency		ISO	APIP (Homo sapiens)	8554872	ClinVar Annotator: match by term: Pyruvate dehydrogenase E3-binding protein deficiency	ClinVar	PMID:25741868

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Apip	Rat	1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane	decreases expression	ISO	Apip (Mus musculus)	6480464	o and p'-DDT results in decreased expression of APIP mRNA	CTD	PMID:24096037
Apip	Rat	1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane	decreases expression	EXP		6480464	o and p'-DDT results in decreased expression of APIP mRNA	CTD	PMID:24096037
Apip	Rat	1,2-dichloroethane	decreases expression	ISO	Apip (Mus musculus)	6480464	ethylene dichloride results in decreased expression of APIP mRNA	CTD	PMID:28960355
Apip	Rat	1,2-dimethylhydrazine	multiple interactions	ISO	Apip (Mus musculus)	6480464	[1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of APIP mRNA	CTD	PMID:22206623
Apip	Rat	17beta-hydroxy-5alpha-androstan-3-one	increases expression	ISO	APIP (Homo sapiens)	6480464	Dihydrotestosterone results in increased expression of APIP mRNA	CTD	PMID:29581250
Apip	Rat	2,2',4,4'-Tetrabromodiphenyl ether	increases expression	EXP		6480464	2 more ...	CTD	PMID:31826744
Apip	Rat	2,3,7,8-tetrachlorodibenzodioxine	increases expression	ISO	Apip (Mus musculus)	6480464	Tetrachlorodibenzodioxin results in increased expression of APIP mRNA	CTD	PMID:19770486
Apip	Rat	2,3,7,8-tetrachlorodibenzodioxine	increases expression	EXP		6480464	Tetrachlorodibenzodioxin results in increased expression of APIP mRNA	CTD	PMID:33387578
Apip	Rat	2,3,7,8-tetrachlorodibenzodioxine	affects expression	ISO	Apip (Mus musculus)	6480464	Tetrachlorodibenzodioxin affects the expression of APIP mRNA	CTD	PMID:21570461
Apip	Rat	2,4-dinitrotoluene	affects expression	EXP		6480464	2 and 4-dinitrotoluene affects the expression of APIP mRNA	CTD	PMID:21346803
Apip	Rat	2,6-dinitrotoluene	affects expression	EXP		6480464	2 and 6-dinitrotoluene affects the expression of APIP mRNA	CTD	PMID:21346803
Apip	Rat	4,4'-diaminodiphenylmethane	affects expression	ISO	Apip (Mus musculus)	6480464	4 and 4'-diaminodiphenylmethane affects the expression of APIP mRNA	CTD	PMID:18648102
Apip	Rat	4,4'-sulfonyldiphenol	increases expression	ISO	Apip (Mus musculus)	6480464	bisphenol S results in increased expression of APIP mRNA	CTD	PMID:39298647
Apip	Rat	4,4'-sulfonyldiphenol	increases expression	ISO	APIP (Homo sapiens)	6480464	bisphenol S results in increased expression of APIP protein	CTD	PMID:34186270
Apip	Rat	6-propyl-2-thiouracil	decreases expression	EXP		6480464	Propylthiouracil results in decreased expression of APIP mRNA	CTD	PMID:30047161
Apip	Rat	amitrole	decreases expression	EXP		6480464	Amitrole results in decreased expression of APIP mRNA	CTD	PMID:30047161
Apip	Rat	atrazine	increases expression	ISO	APIP (Homo sapiens)	6480464	Atrazine results in increased expression of APIP mRNA	CTD	PMID:22378314
Apip	Rat	benzo[a]pyrene	increases expression	ISO	Apip (Mus musculus)	6480464	Benzo(a)pyrene results in increased expression of APIP mRNA	CTD	PMID:22228805
Apip	Rat	bisphenol A	increases expression	EXP		6480464	bisphenol A results in increased expression of APIP mRNA	CTD	PMID:25181051
Apip	Rat	bisphenol A	decreases expression	ISO	Apip (Mus musculus)	6480464	bisphenol A results in decreased expression of APIP mRNA	CTD	PMID:33221593
Apip	Rat	bisphenol A	increases expression	ISO	APIP (Homo sapiens)	6480464	bisphenol A results in increased expression of APIP protein	CTD	PMID:32981897
Apip	Rat	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of APIP mRNA	CTD	PMID:30816183
Apip	Rat	cadmium atom	multiple interactions	ISO	APIP (Homo sapiens)	6480464	[Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of APIP mRNA	CTD	PMID:35301059
Apip	Rat	cadmium dichloride	multiple interactions	ISO	APIP (Homo sapiens)	6480464	[Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of APIP mRNA	CTD	PMID:35301059
Apip	Rat	cobalt dichloride	decreases expression	ISO	APIP (Homo sapiens)	6480464	cobaltous chloride results in decreased expression of APIP mRNA	CTD	PMID:19376846
Apip	Rat	dibutyl phthalate	decreases expression	ISO	Apip (Mus musculus)	6480464	Dibutyl Phthalate results in decreased expression of APIP mRNA	CTD	PMID:17361019 and PMID:21266533
Apip	Rat	dicrotophos	decreases expression	ISO	APIP (Homo sapiens)	6480464	dicrotophos results in decreased expression of APIP mRNA	CTD	PMID:28302478
Apip	Rat	enzyme inhibitor	multiple interactions	ISO	APIP (Homo sapiens)	6480464	[Enzyme Inhibitors results in decreased activity of OGA protein] which results in increased O-linked glycosylation of APIP protein	CTD	PMID:23301498
Apip	Rat	ethanol	multiple interactions	ISO	APIP (Homo sapiens)	6480464	[[Gasoline co-treated with Ethanol] results in increased abundance of [Particulate Matter co-treated with Polycyclic Aromatic Hydrocarbons]] which results in decreased expression of APIP mRNA	CTD	PMID:29432896
Apip	Rat	flutamide	increases expression	EXP		6480464	Flutamide results in increased expression of APIP mRNA	CTD	PMID:24136188
Apip	Rat	folic acid	multiple interactions	ISO	Apip (Mus musculus)	6480464	[1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of APIP mRNA	CTD	PMID:22206623
Apip	Rat	FR900359	decreases phosphorylation	ISO	APIP (Homo sapiens)	6480464	FR900359 results in decreased phosphorylation of APIP protein	CTD	PMID:37730182
Apip	Rat	gentamycin	decreases expression	EXP		6480464	Gentamicins results in decreased expression of APIP mRNA	CTD	PMID:33387578
Apip	Rat	glyphosate	decreases expression	EXP		6480464	Glyphosate results in decreased expression of APIP mRNA	CTD	PMID:26302742
Apip	Rat	glyphosate	affects methylation	EXP		6480464	Glyphosate affects the methylation of APIP gene	CTD	PMID:35440735
Apip	Rat	hydrogen peroxide	affects expression	ISO	APIP (Homo sapiens)	6480464	Hydrogen Peroxide affects the expression of APIP mRNA	CTD	PMID:21179406
Apip	Rat	indole-3-methanol	affects expression	EXP		6480464	indole-3-carbinol affects the expression of APIP mRNA	CTD	PMID:21396975
Apip	Rat	ivermectin	decreases expression	ISO	APIP (Homo sapiens)	6480464	Ivermectin results in decreased expression of APIP protein	CTD	PMID:32959892
Apip	Rat	methimazole	decreases expression	EXP		6480464	Methimazole results in decreased expression of APIP mRNA	CTD	PMID:30047161
Apip	Rat	ozone	multiple interactions	ISO	Apip (Mus musculus)	6480464	[Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in increased expression of APIP mRNA	CTD	PMID:34911549
Apip	Rat	paracetamol	affects expression	ISO	Apip (Mus musculus)	6480464	Acetaminophen affects the expression of APIP mRNA	CTD	PMID:17562736
Apip	Rat	perfluorohexanesulfonic acid	increases expression	ISO	Apip (Mus musculus)	6480464	perfluorohexanesulfonic acid results in increased expression of APIP mRNA	CTD	PMID:37995155
Apip	Rat	propiconazole	decreases expression	EXP		6480464	propiconazole results in decreased expression of APIP mRNA	CTD	PMID:30047161
Apip	Rat	sodium arsenite	decreases expression	ISO	APIP (Homo sapiens)	6480464	sodium arsenite results in decreased expression of APIP mRNA	CTD	PMID:29301061 and PMID:38568856
Apip	Rat	sulfadimethoxine	decreases expression	EXP		6480464	Sulfadimethoxine results in decreased expression of APIP mRNA	CTD	PMID:30047161
Apip	Rat	testosterone	decreases expression	ISO	Apip (Mus musculus)	6480464	Testosterone deficiency results in decreased expression of APIP mRNA	CTD	PMID:33848595
Apip	Rat	testosterone	decreases expression	ISO	APIP (Homo sapiens)	6480464	Testosterone results in decreased expression of APIP mRNA	CTD	PMID:33359661
Apip	Rat	tetrachloromethane	decreases expression	ISO	Apip (Mus musculus)	6480464	Carbon Tetrachloride results in decreased expression of APIP mRNA	CTD	PMID:31919559
Apip	Rat	thalidomide	decreases expression	ISO	Apip (Mus musculus)	6480464	Thalidomide results in decreased expression of APIP mRNA	CTD	PMID:26217789
Apip	Rat	titanium dioxide	decreases methylation	ISO	Apip (Mus musculus)	6480464	titanium dioxide results in decreased methylation of APIP gene	CTD	PMID:35295148
Apip	Rat	valproic acid	decreases methylation	ISO	APIP (Homo sapiens)	6480464	Valproic Acid results in decreased methylation of APIP gene	CTD	PMID:29154799
Apip	Rat	valproic acid	decreases expression	ISO	APIP (Homo sapiens)	6480464	Valproic Acid results in decreased expression of APIP mRNA	CTD	PMID:23179753 and PMID:25192806
Apip	Rat	vinclozolin	increases expression	EXP		6480464	vinclozolin results in increased expression of APIP mRNA	CTD	PMID:22570695

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Apip	Rat	amino acid biosynthetic process	involved_in	IEA	UniProtKB-KW:KW-0028	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Apip	Rat	apoptotic process	acts_upstream_of	IEA	UniProtKB:Q9WVQ5 and ensembl:ENSMUSP00000011055	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Apip	Rat	apoptotic process	involved_in	IEA	UniProtKB-KW:KW-0053	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Apip	Rat	apoptotic process	acts_upstream_of	ISO	Apip (Mus musculus)	1624291	PMID:15262985	RGD	PMID:15262985
Apip	Rat	L-methionine salvage from methylthioadenosine	involved_in	IEA	UniRule:UR000106743	1600115	GO_REF:0000104	UniProt	GO_REF:0000104
Apip	Rat	L-methionine salvage from methylthioadenosine	involved_in	IEA	UniProtKB:Q96GX9 and ensembl:ENSP00000379133	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Apip	Rat	L-methionine salvage from methylthioadenosine	involved_in	IEA	UniPathway:UPA00904	1600115	GO_REF:0000041	UniProt	GO_REF:0000041
Apip	Rat	L-methionine salvage from methylthioadenosine	involved_in	IBA	PANTHER:PTN000067541 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Apip	Rat	L-methionine salvage from methylthioadenosine	involved_in	IEA	InterPro:IPR017714 and InterPro:IPR027514	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Apip	Rat	L-methionine salvage from methylthioadenosine	involved_in	ISO	APIP (Homo sapiens)	1624291	PMID:22837397 and PMID:23285211	RGD	PMID:22837397 and PMID:23285211
Apip	Rat	methionine biosynthetic process	involved_in	IEA	UniProtKB-KW:KW-0486	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Apip	Rat	negative regulation of apoptotic process	involved_in	ISO	APIP (Homo sapiens)	1624291	PMID:22837397 and PMID:24367089	RGD	PMID:22837397 and PMID:24367089
Apip	Rat	negative regulation of apoptotic process	involved_in	IEA	UniProtKB:Q96GX9 and ensembl:ENSP00000379133	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Apip	Rat	negative regulation of apoptotic process	acts_upstream_of_or_within	IEA	UniProtKB:Q9WVQ5 and ensembl:ENSMUSP00000011055	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Apip	Rat	negative regulation of apoptotic process	acts_upstream_of_or_within	ISO	Apip (Mus musculus)	1624291	PMID:15262985	RGD	PMID:15262985
Apip	Rat	negative regulation of apoptotic process	involved_in	ISO	Apip (Mus musculus)	1624291	PMID:17086211	RGD	PMID:17086211
Apip	Rat	protein homotetramerization	involved_in	ISO	APIP (Homo sapiens)	1624291	PMID:24367089	RGD	PMID:24367089
Apip	Rat	protein homotetramerization	involved_in	IEA	UniProtKB:Q96GX9 and ensembl:ENSP00000379133	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Apip	Rat	pyroptotic inflammatory response	involved_in	ISO	APIP (Homo sapiens)	1624291	PMID:24367089	RGD	PMID:24367089
Apip	Rat	pyroptotic inflammatory response	involved_in	IEA	UniProtKB:Q96GX9 and ensembl:ENSP00000379133	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Apip	Rat	regulation of ERK1 and ERK2 cascade	involved_in	ISO	Apip (Mus musculus)	1624291	PMID:17086211	RGD	PMID:17086211
Apip	Rat	regulation of ERK1 and ERK2 cascade	involved_in	IEA	UniProtKB:Q9WVQ5 and ensembl:ENSMUSP00000011055	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Apip	Rat	cytoplasm	located_in	ISO	APIP (Homo sapiens)	1624291	PMID:23285211	RGD	PMID:23285211
Apip	Rat	cytoplasm	located_in	IEA	UniProtKB-KW:KW-0963	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Apip	Rat	cytoplasm	located_in	IEA	UniProtKB:Q96GX9 and ensembl:ENSP00000379133	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Apip	Rat	cytoplasm	located_in	IEA	UniProtKB-SubCell:SL-0086	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Apip	Rat	cytoplasm	is_active_in	IBA	PANTHER:PTN000067541 and UniProtKB:Q96GX9	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Apip	Rat	cytoplasm	located_in	IEA	InterPro:IPR017714 and InterPro:IPR027514	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Apip	Rat	endomembrane system	located_in	IEA	UniProtKB-SubCell:SL-0147	1600115	GO_REF:0000044	UniProt	GO_REF:0000044

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Apip	Rat	identical protein binding	enables	ISO	APIP (Homo sapiens)	1624291	UniProtKB:Q96GX9 more ...	RGD	PMID:16189514 more ...
Apip	Rat	identical protein binding	enables	IEA	UniProtKB:Q96GX9 and ensembl:ENSP00000379133	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Apip	Rat	lyase activity	enables	IEA	UniProtKB-KW:KW-0456	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Apip	Rat	metal ion binding	enables	IEA	UniProtKB-KW:KW-0479	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Apip	Rat	metal ion binding	enables	IEA	InterPro:IPR017714 and InterPro:IPR027514	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Apip	Rat	methylthioribulose 1-phosphate dehydratase activity	enables	ISO	APIP (Homo sapiens)	1624291	PMID:24367089	RGD	PMID:24367089
Apip	Rat	methylthioribulose 1-phosphate dehydratase activity	enables	IEA	UniProtKB:Q96GX9 and ensembl:ENSP00000379133	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Apip	Rat	methylthioribulose 1-phosphate dehydratase activity	enables	IBA	PANTHER:PTN000067541 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Apip	Rat	methylthioribulose 1-phosphate dehydratase activity	enables	IEA	EC:4.2.1.109	1600115	GO_REF:0000003	UniProt	GO_REF:0000003
Apip	Rat	methylthioribulose 1-phosphate dehydratase activity	enables	IEA	UniRule:UR000106743	1600115	GO_REF:0000104	UniProt	GO_REF:0000104
Apip	Rat	protein binding	enables	ISO	APIP (Homo sapiens)	1624291	UniProtKB:O00560 more ...	RGD	PMID:16189514 more ...
Apip	Rat	zinc ion binding	enables	ISO	APIP (Homo sapiens)	1624291	PMID:24367089	RGD	PMID:24367089
Apip	Rat	zinc ion binding	enables	IEA	UniProtKB:Q96GX9 and ensembl:ENSP00000379133	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Apip	Rat	zinc ion binding	enables	IEA	UniRule:UR000106743	1600115	GO_REF:0000104	UniProt	GO_REF:0000104

Imported Annotations - KEGG (archival)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Apip	Rat	cysteine and methionine metabolic pathway		IEA		6907045		KEGG	rno:00270

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
3.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

PMID:15262985	PMID:16189514	PMID:17086211	PMID:19060904	PMID:22837397	PMID:23285211	PMID:24367089	PMID:25416956	PMID:31515488

Apip
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	109,886,919 - 109,913,295 (+)	NCBI		GRCr8
mRatBN7.2	3	89,431,964 - 89,458,000 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	89,432,037 - 89,458,340 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	3	92,931,217 - 92,957,295 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	101,530,251 - 101,556,331 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	99,359,187 - 99,385,302 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	92,969,128 - 92,998,104 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	92,969,141 - 92,995,483 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	3	99,612,110 - 99,640,878 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	3	88,306,123 - 88,332,800 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	3	88,509,653 - 88,535,688 (+)	NCBI		Celera
Cytogenetic Map	3	q32	NCBI

APIP
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	11	34,882,295 - 34,916,379 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	11	34,853,094 - 34,916,379 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	11	34,903,842 - 34,937,926 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	11	34,860,421 - 34,894,484 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	11	35,051,185 - 35,085,276 (-)	NCBI		Celera
Cytogenetic Map	11	p13	NCBI
HuRef	11	34,602,325 - 34,636,417 (-)	NCBI		HuRef
CHM1_1	11	34,902,113 - 34,936,196 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	11	35,020,271 - 35,054,314 (-)	NCBI		T2T-CHM13v2.0

Apip
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	2	102,904,020 - 102,922,994 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	2	102,904,020 - 102,922,989 (+)	Ensembl		GRCm39 Ensembl
GRCm38	2	103,073,675 - 103,092,649 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	2	103,073,675 - 103,092,644 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	2	102,913,832 - 102,932,806 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	2	102,874,514 - 102,893,460 (+)	NCBI		MGSCv36	mm8
Celera	2	104,317,769 - 104,336,727 (+)	NCBI		Celera
Cytogenetic Map	2	E2	NCBI
cM Map	2	54.29	NCBI

Apip
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955422	11,405,721 - 11,429,146 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955422	11,405,721 - 11,426,700 (+)	NCBI	ChiLan1.0	ChiLan1.0

APIP
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	9	37,103,066 - 37,137,097 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	11	37,107,771 - 37,141,802 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	11	34,855,437 - 34,889,486 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	11	34,730,671 - 34,764,732 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	11	34,730,671 - 34,764,732 (-)	Ensembl	panpan1.1		panPan2

APIP
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	18	33,012,049 - 33,033,453 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	18	33,011,121 - 33,033,435 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	18	32,617,866 - 32,639,261 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	18	33,623,160 - 33,644,563 (+)	NCBI		ROS_Cfam_1.0
UMICH_Zoey_3.1	18	33,183,124 - 33,204,482 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	18	32,774,401 - 32,795,973 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	18	33,409,813 - 33,431,215 (+)	NCBI		UU_Cfam_GSD_1.0

Apip
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404947	30,091,219 - 30,114,204 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936533	3,216,187 - 3,238,776 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936533	3,216,020 - 3,238,999 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

APIP
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	2	26,095,038 - 26,115,462 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	2	26,095,020 - 26,115,462 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	2	28,461,921 - 28,482,434 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

APIP
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	1	30,344,658 - 30,374,741 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	1	30,344,690 - 30,374,737 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666038	127,458,535 - 127,492,516 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Apip
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624767	12,257,597 - 12,280,154 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624767	12,257,591 - 12,285,968 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Apip
105 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	8
Count of miRNA genes:	8
Interacting mature miRNAs:	8
Transcripts:	ENSRNOT00000009797
Prediction methods:	Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1300178	Hrtrt4	Heart rate QTL 4	3.74		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	3	43827364	90905114	Rat
61377	Edpm3	Estrogen-dependent pituitary mass QTL 3	7.05	0.038	pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	3	53184692	89878207	Rat
2301414	Kidm37	Kidney mass QTL 37		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	3	70653097	121056321	Rat
1582238	Bw68	Body weight QTL 68	3.2	0.0064	body mass (VT:0001259)	body weight (CMO:0000012)	3	53184593	115665732	Rat
1582239	Epfw1	Epididymal fat weight QTL 1	4.5	0.0006	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	3	53184593	115665732	Rat
70216	Cm14	Cardiac mass QTL 14	2.1		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	3	31172320	163586636	Rat
2292591	Esta4	Estrogen-induced thymic atrophy QTL 4			thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	3	47233211	147415807	Rat
1358362	Srcrt2	Stress Responsive Cort QTL 2	2.78		blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	3	38192233	133483320	Rat
737818	Hcar12	Hepatocarcinoma resistance QTL 12	2.6		liver integrity trait (VT:0010547)	volume of individual liver tumorous lesion (CMO:0001078)	3	29463235	118376539	Rat
1582218	Bw74	Body weight QTL 74	3.9	0.0021	body mass (VT:0001259)	body weight (CMO:0000012)	3	53184593	115665732	Rat
1582221	Kidm30	Kidney mass QTL 30	3.5	0.0008	kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	3	64655305	115665732	Rat
1581568	Rf53	Renal function QTL 53			urine total protein amount (VT:0000032)	urine protein excretion rate to body weight ratio (CMO:0001099)	3	56395968	161299569	Rat
1582210	Bw71	Body weight QTL 71	3.3	0.0012	body mass (VT:0001259)	body weight (CMO:0000012)	3	64655305	115665732	Rat
7387306	Bw124	Body weight QTL 124	3.2	0.0003	body mass (VT:0001259)	body weight (CMO:0000012)	3	84091273	129091273	Rat
1300111	Rf12	Renal function QTL 12	3.78		renal blood flow trait (VT:2000006)	absolute change in renal blood flow rate (CMO:0001168)	3	61017749	121056321	Rat
724523	Tsu1	Thymus enlargement suppressive QTL 1	3.84		thymus mass (VT:0004954)	thymus weight to body weight ratio (CMO:0000612)	3	50437504	115638231	Rat
1600376	Arunc5	Aerobic running capacity QTL 5		0.21	exercise endurance trait (VT:0002332)	maximum distance run on treadmill (CMO:0001406)	3	73376539	118376539	Rat
2302273	Gluco35	Glucose level QTL 35	5.3	0.001	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	3	80800231	114297550	Rat
8662816	Vetf4	Vascular elastic tissue fragility QTL 4	4		renal artery integrity trait (VT:0010642)	number of ruptures of the internal elastic lamina of the renal arteries (CMO:0002563)	3	59242096	157323038	Rat
1559282	Emca5	Estrogen-induced mammary cancer QTL 5	3.9		mammary gland integrity trait (VT:0010552)	percentage of study population developing mammary tumors during a period of time (CMO:0000948)	3	43827364	169034231	Rat
1581503	Cm58	Cardiac mass QTL 58	2.7	0.05	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	3	43827364	121056321	Rat
2292613	Ept16	Estrogen-induced pituitary tumorigenesis QTL 16	8.3		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	3	47233430	110362260	Rat
731180	Bp152	Blood pressure QTL 152		0.03	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	53781112	91609953	Rat
61419	Cia11	Collagen induced arthritis QTL 11	5.6		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	3	30356773	98535386	Rat
12879848	Bw181	Body weght QTL 181		0.015	body mass (VT:0001259)	body weight (CMO:0000012)	3	70348525	121056321	Rat
1358905	Hrtrt17	Heart rate QTL 17	5.9	0.000014	heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	3	10861912	89878372	Rat
2301971	Cm71	Cardiac mass QTL 71	4.63		heart left ventricle mass (VT:0007031)	heart left ventricle weight (CMO:0000776)	3	41874578	155617519	Rat
1358885	Bp251	Blood pressure QTL 251	3.8		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	14489145	121056321	Rat
1354597	Kidm13	Kidney mass QTL 13	2.9		kidney mass (VT:0002707)	right kidney wet weight (CMO:0000082)	3	41874578	104104347	Rat
2301970	Bw81	Body weight QTL 81	5.19		body mass (VT:0001259)	body weight (CMO:0000012)	3	41874578	155617519	Rat
1581546	Pur13	Proteinuria QTL 13	2.93	0.0335	urine total protein amount (VT:0000032)	urine protein excretion rate (CMO:0000759)	3	78196190	146592722	Rat
2290452	Scl56	Serum cholesterol level QTL 56	2.26		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	3	1	91609953	Rat
1354604	Bw36	Body weight QTL 36	2.9		body mass (VT:0001259)	body weight (CMO:0000012)	3	33703347	104104347	Rat
631665	Bw8	Body weight QTL 8	5.5		body mass (VT:0001259)	body weight (CMO:0000012)	3	50437042	119183768	Rat
1358888	Bp264	Blood pressure QTL 264	4.43		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	14489145	121056321	Rat
1358186	Ept2	Estrogen-induced pituitary tumorigenesis QTL 2	8.3		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	3	47233430	110362260	Rat

AU047000

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	3	89,442,844 - 89,442,958 (+)	MAPPER	mRatBN7.2
Rnor_6.0	3	92,980,075 - 92,980,188	NCBI	Rnor6.0
Rnor_5.0	3	99,622,849 - 99,622,962	UniSTS	Rnor5.0
RGSC_v3.4	3	88,317,646 - 88,317,759	UniSTS	RGSC3.4
Celera	3	88,520,536 - 88,520,649	UniSTS
Cytogenetic Map	3	q32	UniSTS

RH135014

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	3	89,445,012 - 89,445,226 (+)	MAPPER	mRatBN7.2
Rnor_6.0	3	92,982,243 - 92,982,456	NCBI	Rnor6.0
Rnor_5.0	3	99,625,017 - 99,625,230	UniSTS	Rnor5.0
RGSC_v3.4	3	88,319,814 - 88,320,027	UniSTS	RGSC3.4
Celera	3	88,522,704 - 88,522,917	UniSTS
RH 3.4 Map	3	670.3	UniSTS
Cytogenetic Map	3	q32	UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31


RefSeq Transcripts	NM_001106492	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_006234638	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039104529	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH473949	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000003	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000009797 ⟹ ENSRNOP00000009797

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	3	89,432,037 - 89,458,340 (+)	Ensembl
Rnor_6.0 Ensembl	3	92,969,141 - 92,995,483 (+)	Ensembl

RefSeq Acc Id:

NM_001106492 ⟹ NP_001099962

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	109,886,919 - 109,912,955 (+)	NCBI
mRatBN7.2	3	89,431,964 - 89,458,000 (+)	NCBI
Rnor_6.0	3	92,969,178 - 92,995,229 (+)	NCBI
Rnor_5.0	3	99,612,110 - 99,640,878 (+)	NCBI
RGSC_v3.4	3	88,306,123 - 88,332,800 (+)	RGD
Celera	3	88,509,653 - 88,535,688 (+)	RGD

Sequence:

show sequence

TGCTTCTCGCTCTTGCTCCGCCCCCAGACTGCCCGCTTTGCAGACTAATAGCGTTCTTGTGGACCACTTAGACGTAGAACGTGCTCGGGGTGGCTAACTGAGCGGAGTTAGAACCATGTCTGGCTGTC
AAGCGCAAGGAGACTGTTGCTCGCGGCCGTATGGCGCGCAGGACAAGGAACATCCCAGATTCCTGATCCCAGAACTTTGCAAACAGTTTTACCATCTGGGCTGGGTCACTGGCACTGGAGGAGGAATC
AGCTTGAAGCATGGCAATGAAATCTACATTGCTCCCTCAGGCGTGCAAAAGGAGCGCATTCAGCCAGAAGACATGTTTGTTTGTGACATCAATGAGCAGGACATAAGTGGGCCTCCAGCATCTAAGAA
TCTTAAGAAAAGCCAGTGTACGCCTCTTTTCATGAACGCTTACACCATGAGAGGAGCAGGCGCAGTGATTCATACCCACTCTAAAGCTGCTGTGATGGCTACCCTTCTGTTTCCAGGACAGGAGTTTA
AAATTACACATCAAGAGATGATCAAAGGAATAAGGAAATGTACCTCTGGAGGGTATTACAGATACGATGATATATTAGTGGTACCCATTATTGAGAACACTCCTGAAGAGAAGGACCTCAAAGAACGG
ATGGCTCGTGCCATGAATGAATACCCAGACTCCTGTGCAGTTCTAGTCAGGCGTCACGGGGTGTACGTGTGGGGAGAAACATGGGAGAAAGCAAAAACCATGTGTGAGTGTTATGATTACCTGTTTGA
CATTGCTGTCTCCATGAAGAAGATGGGGCTGGATCCAACGCAGTTCCCAGTTGGAGAACATGGAATCGTATAAGCCAAGTGGACGCCTAAGAATCTCCAAAAATAAAACAAACTCAATTACGCCTTAA
ATAAAACTCTGCTACTTTTAAATG

hide sequence

RefSeq Acc Id:

XM_039104529 ⟹ XP_038960457

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	109,904,152 - 109,913,295 (+)	NCBI
mRatBN7.2	3	89,449,197 - 89,457,997 (+)	NCBI


Protein RefSeqs	NP_001099962	(Get FASTA)	NCBI Sequence Viewer
	XP_038960457	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDL79656	(Get FASTA)	NCBI Sequence Viewer
	EDL79657	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000009797
	ENSRNOP00000009797.6

RefSeq Acc Id:	NP_001099962 ⟸ NM_001106492
- UniProtKB:	D3ZUI1 (UniProtKB/TrEMBL), A6HNQ5 (UniProtKB/TrEMBL)
- Sequence:	show sequence MFVCDINEQDISGPPASKNLKKSQCTPLFMNAYTMRGAGAVIHTHSKAAVMATLLFPGQEFKITHQEMIKGIRKCTSGGYYRYDDILVVPIIENTPEEKDLKERMARAMNEYPDSCAVLVRRHGVYVW GETWEKAKTMCECYDYLFDIAVSMKKMGLDPTQFPVGEHGIV hide sequence

Ensembl Acc Id:

ENSRNOP00000009797 ⟸ ENSRNOT00000009797

RefSeq Acc Id:	XP_038960457 ⟸ XM_039104529
- Peptide Label:	isoform X1
- UniProtKB:	A6HNQ6 (UniProtKB/TrEMBL)

Protein Domains

Class II aldolase/adducin N-terminal

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D3ZUI1-F1-model_v2	AlphaFold	D3ZUI1	1-241	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

RGD ID:

13692251

Promoter ID:

EPDNEW_R2776

Type:

initiation region

Name:

Apip_1

Description:

APAF1 interacting protein

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	3	92,969,189 - 92,969,249	EPDNEW

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-48586	BioCyc
Ensembl Genes	ENSRNOG00000007446	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000009797	ENTREZGENE
	ENSRNOT00000009797.7	UniProtKB/TrEMBL
Gene3D-CATH	3.40.225.10	UniProtKB/TrEMBL
InterPro	Aldolase_II/adducin_N	UniProtKB/TrEMBL
	Aldolase_II/adducin_N_sf	UniProtKB/TrEMBL
	MethylthioRu-1-P_deHdtase_MtnB	UniProtKB/TrEMBL
	Salvage_MtnB_euk	UniProtKB/TrEMBL
KEGG Report	rno:295961	UniProtKB/TrEMBL
NCBI Gene	295961	ENTREZGENE
PANTHER	METHYLTHIORIBULOSE-1-PHOSPHATE DEHYDRATASE	UniProtKB/TrEMBL
	PTHR10640	UniProtKB/TrEMBL
Pfam	Aldolase_II	UniProtKB/TrEMBL
PhenoGen	Apip	PhenoGen
RatGTEx	ENSRNOG00000007446	RatGTEx
SMART	Aldolase_II	UniProtKB/TrEMBL
Superfamily-SCOP	Aldolase_II_N	UniProtKB/TrEMBL
UniProt	A6HNQ5	ENTREZGENE, UniProtKB/TrEMBL
	A6HNQ6	ENTREZGENE, UniProtKB/TrEMBL
	D3ZUI1	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-04-30	Apip	APAF1 interacting protein	Apip_predicted	APAF1 interacting protein (predicted)	'predicted' is removed	2292626	APPROVED
2006-03-30	Apip_predicted	APAF1 interacting protein (predicted)	RGD1564562_predicted	similar to MMRP19 (predicted)	Symbol and Name updated	1299863	APPROVED
2006-03-07	RGD1564562_predicted	similar to MMRP19 (predicted)	LOC295961	similar to MMRP19	Symbol and Name status set to approved	1299863	APPROVED
2006-02-09	LOC295961	similar to MMRP19			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Send us a Message

Imported Disease Annotations - ClinVar

Imported Annotations - KEGG (archival)