Advanced Search (OLGA)

Gene: Steep1 (STING1 ER exit protein 1) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Steep1

Name:

STING1 ER exit protein 1

RGD ID:

1564541

Description:

Predicted to enable protein-macromolecule adaptor activity. Predicted to be involved in endoplasmic reticulum membrane organization; endoplasmic reticulum to Golgi vesicle-mediated transport; and protein exit from endoplasmic reticulum. Predicted to be located in several cellular components, including cell body; centrosome; and nucleoplasm. Predicted to be active in endoplasmic reticulum membrane. Human ortholog(s) of this gene implicated in non-syndromic X-linked intellectual disability 107. Orthologous to human STEEP1 (STING1 ER exit protein 1); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; acrylamide; amitrole.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

hypothetical protein LOC313433; LOC313433; RGD1564541; similar to hypothetical protein FLJ22965; uncharacterized protein LOC313433; UPF0428 protein CXorf56 homolog

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	STEEP1 (STING1 ER exit protein 1)	HGNC	Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther
Mus musculus (house mouse):	Steep1 (STING1 ER exit protein 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Steep1 (STING1 ER exit protein 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	STEEP1 (STING1 ER exit protein 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	STEEP1 (STING1 ER exit protein 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Steep1 (STING1 ER exit protein 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	STEEP1 (STING1 ER exit protein 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	STEEP1 (STING1 ER exit protein 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Steep1 (STING1 ER exit protein 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	STEEP1 (STING1 ER exit protein 1)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Steep1 (STING1 ER exit protein 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	zgc:103697	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG16865	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	Y66D12A.8	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	steep1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	X	120,953,335 - 120,979,861 (-)	NCBI		GRCr8
mRatBN7.2	X	116,087,626 - 116,114,159 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	X	116,060,929 - 116,114,159 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	X	118,189,843 - 118,217,563 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	X	121,758,973 - 121,786,697 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	X	119,305,139 - 119,332,856 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	X	123,460,280 - 123,486,814 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	X	123,460,280 - 123,486,814 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	X	123,605,221 - 123,631,755 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	X	7,992,595 - 8,019,120 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	X	115,317,375 - 115,344,394 (-)	NCBI		Celera
Cytogenetic Map	X	q34	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Steep1	Rat	autistic disorder		ISO	STEEP1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Autism	ClinVar	PMID:21681106 and PMID:30208311
Steep1	Rat	autosomal hemophilia A		ISO	STEEP1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: AUTOSOMAL HEMOPHILIA A	ClinVar	PMID:31690835
Steep1	Rat	factor VIII deficiency		ISO	STEEP1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Factor 8 deficiency and congenital	ClinVar	PMID:31690835
Steep1	Rat	non-syndromic X-linked intellectual disability 107		ISO	STEEP1 (Homo sapiens)	8554872	ClinVar more ...	ClinVar	PMID:25741868 more ...
Steep1	Rat	syndromic X-linked intellectual disability 14		ISO	STEEP1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: INTELLECTUAL DEVELOPMENTAL DISORDER more ...	ClinVar	PMID:17236139 more ...
Steep1	Rat	syndromic X-linked intellectual disability Cabezas type		ISO	STEEP1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Intellectual developmental disorder more ...	ClinVar	PMID:17236139 more ...
Steep1	Rat	syndromic X-linked intellectual disability Lubs type		ISO	STEEP1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Syndromic X-linked intellectual disability Lubs type	ClinVar	PMID:25741868

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Steep1	Rat	non-syndromic X-linked intellectual disability 107		ISO	STEEP1 (Homo sapiens)	7240710		OMIM

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Steep1	Rat	2,3,7,8-tetrachlorodibenzodioxine	decreases expression	EXP		6480464	Tetrachlorodibenzodioxin results in decreased expression of STEEP1 mRNA	CTD	PMID:34747641
Steep1	Rat	3-isobutyl-1-methyl-7H-xanthine	multiple interactions	ISO	STEEP1 (Homo sapiens)	6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of STEEP1 mRNA more ...	CTD	PMID:28628672
Steep1	Rat	4,4'-sulfonyldiphenol	multiple interactions	ISO	STEEP1 (Homo sapiens)	6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] results in increased expression of STEEP1 mRNA	CTD	PMID:28628672
Steep1	Rat	acrylamide	affects expression	EXP		6480464	Acrylamide affects the expression of STEEP1 mRNA	CTD	PMID:28959563
Steep1	Rat	amitrole	decreases expression	EXP		6480464	Amitrole results in decreased expression of STEEP1 mRNA	CTD	PMID:38685447
Steep1	Rat	antirheumatic drug	decreases expression	ISO	STEEP1 (Homo sapiens)	6480464	Antirheumatic Agents results in decreased expression of STEEP1 mRNA	CTD	PMID:24449571
Steep1	Rat	arsane	multiple interactions	ISO	STEEP1 (Homo sapiens)	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of STEEP1 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of STEEP1 mRNA	CTD	PMID:39836092
Steep1	Rat	arsenic atom	multiple interactions	ISO	STEEP1 (Homo sapiens)	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of STEEP1 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of STEEP1 mRNA	CTD	PMID:39836092
Steep1	Rat	atrazine	decreases expression	ISO	STEEP1 (Homo sapiens)	6480464	Atrazine results in decreased expression of STEEP1 mRNA	CTD	PMID:22378314
Steep1	Rat	benzo[a]pyrene	increases expression	ISO	STEEP1 (Homo sapiens)	6480464	Benzo(a)pyrene results in increased expression of STEEP1 protein	CTD	PMID:32717239
Steep1	Rat	benzo[a]pyrene	affects methylation	ISO	STEEP1 (Homo sapiens)	6480464	Benzo(a)pyrene affects the methylation of STEEP1 promoter	CTD	PMID:27901495
Steep1	Rat	benzo[a]pyrene	decreases methylation	ISO	STEEP1 (Homo sapiens)	6480464	Benzo(a)pyrene results in decreased methylation of STEEP1 exon	CTD	PMID:27901495
Steep1	Rat	bisphenol A	multiple interactions	ISO	STEEP1 (Homo sapiens)	6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of STEEP1 mRNA	CTD	PMID:28628672
Steep1	Rat	bisphenol A	decreases expression	ISO	Steep1 (Mus musculus)	6480464	bisphenol A results in decreased expression of STEEP1 mRNA	CTD	PMID:33221593
Steep1	Rat	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of STEEP1 mRNA	CTD	PMID:25181051
Steep1	Rat	bisphenol F	multiple interactions	ISO	STEEP1 (Homo sapiens)	6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of STEEP1 mRNA	CTD	PMID:28628672
Steep1	Rat	bisphenol F	increases expression	ISO	Steep1 (Mus musculus)	6480464	bisphenol F results in increased expression of STEEP1 mRNA	CTD	PMID:38685157
Steep1	Rat	cadmium dichloride	increases expression	EXP		6480464	Cadmium Chloride results in increased expression of STEEP1 mRNA	CTD	PMID:33453195
Steep1	Rat	cadmium dichloride	increases expression	ISO	STEEP1 (Homo sapiens)	6480464	Cadmium Chloride results in increased expression of STEEP1 mRNA	CTD	PMID:26472689
Steep1	Rat	copper atom	multiple interactions	ISO	STEEP1 (Homo sapiens)	6480464	[Disulfiram binds to Copper] which results in decreased expression of STEEP1 mRNA	CTD	PMID:24690739
Steep1	Rat	copper(0)	multiple interactions	ISO	STEEP1 (Homo sapiens)	6480464	[Disulfiram binds to Copper] which results in decreased expression of STEEP1 mRNA	CTD	PMID:24690739
Steep1	Rat	decabromodiphenyl ether	decreases expression	EXP		6480464	decabromobiphenyl ether results in decreased expression of STEEP1 mRNA	CTD	PMID:23640034
Steep1	Rat	dexamethasone	multiple interactions	ISO	STEEP1 (Homo sapiens)	6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of STEEP1 mRNA more ...	CTD	PMID:28628672
Steep1	Rat	Dibutyl phosphate	affects expression	ISO	STEEP1 (Homo sapiens)	6480464	di-n-butylphosphoric acid affects the expression of CXORF56 mRNA	CTD	PMID:37042841
Steep1	Rat	disodium selenite	decreases expression	ISO	STEEP1 (Homo sapiens)	6480464	Sodium Selenite results in decreased expression of STEEP1 mRNA	CTD	PMID:18175754
Steep1	Rat	disulfiram	multiple interactions	ISO	STEEP1 (Homo sapiens)	6480464	[Disulfiram binds to Copper] which results in decreased expression of STEEP1 mRNA	CTD	PMID:24690739
Steep1	Rat	entinostat	decreases expression	ISO	STEEP1 (Homo sapiens)	6480464	entinostat results in decreased expression of STEEP1 mRNA	CTD	PMID:27188386
Steep1	Rat	gallic acid	increases expression	ISO	STEEP1 (Homo sapiens)	6480464	Gallic Acid results in increased expression of STEEP1 mRNA	CTD	PMID:34408198
Steep1	Rat	gentamycin	increases expression	EXP		6480464	Gentamicins results in increased expression of STEEP1 mRNA	CTD	PMID:33387578
Steep1	Rat	indometacin	multiple interactions	ISO	STEEP1 (Homo sapiens)	6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of STEEP1 mRNA more ...	CTD	PMID:28628672
Steep1	Rat	manganese atom	multiple interactions	ISO	STEEP1 (Homo sapiens)	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of STEEP1 mRNA	CTD	PMID:39836092
Steep1	Rat	manganese(0)	multiple interactions	ISO	STEEP1 (Homo sapiens)	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of STEEP1 mRNA	CTD	PMID:39836092
Steep1	Rat	manganese(II) chloride	multiple interactions	ISO	STEEP1 (Homo sapiens)	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of STEEP1 mRNA	CTD	PMID:39836092
Steep1	Rat	resveratrol	multiple interactions	ISO	STEEP1 (Homo sapiens)	6480464	[Plant Extracts co-treated with Resveratrol] results in increased expression of STEEP1 mRNA	CTD	PMID:23557933
Steep1	Rat	sodium arsenite	increases expression	ISO	STEEP1 (Homo sapiens)	6480464	sodium arsenite results in increased expression of CXORF56 mRNA	CTD	PMID:38568856
Steep1	Rat	sodium arsenite	multiple interactions	ISO	STEEP1 (Homo sapiens)	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of STEEP1 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of STEEP1 mRNA	CTD	PMID:39836092
Steep1	Rat	sunitinib	increases expression	ISO	STEEP1 (Homo sapiens)	6480464	Sunitinib results in increased expression of STEEP1 mRNA	CTD	PMID:31533062
Steep1	Rat	valproic acid	decreases expression	ISO	STEEP1 (Homo sapiens)	6480464	Valproic Acid results in decreased expression of STEEP1 mRNA	CTD	PMID:23179753 and PMID:27188386

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Steep1	Rat	endoplasmic reticulum membrane organization	involved_in	ISO	STEEP1 (Homo sapiens)	1624291	PMID:32690950	RGD	PMID:32690950
Steep1	Rat	endoplasmic reticulum membrane organization	involved_in	IEA	UniProtKB:Q9H5V9 and ensembl:ENSP00000494123	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Steep1	Rat	endoplasmic reticulum membrane organization	involved_in	IBA	PANTHER:PTN005299648 and UniProtKB:Q9H5V9	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Steep1	Rat	endoplasmic reticulum to Golgi vesicle-mediated transport	involved_in	ISO	STEEP1 (Homo sapiens)	1624291	PMID:32690950	RGD	PMID:32690950
Steep1	Rat	endoplasmic reticulum to Golgi vesicle-mediated transport	involved_in	IEA	UniProtKB:Q9H5V9 and ensembl:ENSP00000494123	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Steep1	Rat	endoplasmic reticulum to Golgi vesicle-mediated transport	involved_in	IBA	PANTHER:PTN005299648 and UniProtKB:Q9H5V9	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Steep1	Rat	protein exit from endoplasmic reticulum	involved_in	ISO	STEEP1 (Homo sapiens)	1624291	PMID:32690950 and PMID:37832545	RGD	PMID:32690950 and PMID:37832545
Steep1	Rat	protein exit from endoplasmic reticulum	involved_in	IEA	UniProtKB:Q9H5V9 and ensembl:ENSP00000494123	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Steep1	Rat	cell body	located_in	ISO	Steep1 (Mus musculus)	1624291	PMID:29374277	RGD	PMID:29374277
Steep1	Rat	cell body	located_in	IEA	UniProtKB:Q8VDP2 and ensembl:ENSMUSP00000110903	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Steep1	Rat	centrosome	located_in	ISO	STEEP1 (Homo sapiens) more ...	1624291		RGD	GO_REF:0000052
Steep1	Rat	centrosome	located_in	IEA	UniProtKB:Q9H5V9 and ensembl:ENSP00000494123	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Steep1	Rat	cytoplasm	located_in	ISO	STEEP1 (Homo sapiens)	1624291	PMID:32690950	RGD	PMID:32690950
Steep1	Rat	cytoplasm	located_in	IEA	UniProtKB:Q9H5V9 and ensembl:ENSP00000494123	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Steep1	Rat	endoplasmic reticulum	is_active_in	IEA	UniProtKB:Q9H5V9 and ensembl:ENSP00000494123	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Steep1	Rat	endoplasmic reticulum	is_active_in	ISO	STEEP1 (Homo sapiens)	1624291	PMID:37832545	RGD	PMID:37832545
Steep1	Rat	endoplasmic reticulum membrane	is_active_in	ISO	STEEP1 (Homo sapiens)	1624291	PMID:32690950	RGD	PMID:32690950
Steep1	Rat	endoplasmic reticulum membrane	is_active_in	IEA	UniProtKB:Q9H5V9 and ensembl:ENSP00000494123	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Steep1	Rat	nucleoplasm	located_in	ISO	STEEP1 (Homo sapiens) more ...	1624291		RGD	GO_REF:0000052
Steep1	Rat	nucleoplasm	located_in	IEA	UniProtKB:Q9H5V9 and ensembl:ENSP00000494123	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Steep1	Rat	nucleus	located_in	IEA	UniProtKB:Q9H5V9 and ensembl:ENSP00000494123	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Steep1	Rat	nucleus	located_in	IEA	UniProtKB:Q8VDP2 and ensembl:ENSMUSP00000110903	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Steep1	Rat	nucleus	located_in	ISO	STEEP1 (Homo sapiens)	1624291	PMID:29374277 and PMID:32690950	RGD	PMID:29374277 and PMID:32690950
Steep1	Rat	nucleus	located_in	ISO	Steep1 (Mus musculus)	1624291	PMID:29374277	RGD	PMID:29374277

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Steep1	Rat	protein binding	enables	ISO	STEEP1 (Homo sapiens)	1624291	UniProtKB:O14929 more ...	RGD	PMID:32296183
Steep1	Rat	protein-macromolecule adaptor activity	enables	ISO	STEEP1 (Homo sapiens)	1624291	PMID:32690950 and PMID:37832545	RGD	PMID:32690950 and PMID:37832545
Steep1	Rat	protein-macromolecule adaptor activity	enables	IEA	UniProtKB:Q9H5V9 and ensembl:ENSP00000494123	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

PMID:29374277

Steep1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	X	120,953,335 - 120,979,861 (-)	NCBI		GRCr8
mRatBN7.2	X	116,087,626 - 116,114,159 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	X	116,060,929 - 116,114,159 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	X	118,189,843 - 118,217,563 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	X	121,758,973 - 121,786,697 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	X	119,305,139 - 119,332,856 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	X	123,460,280 - 123,486,814 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	X	123,460,280 - 123,486,814 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	X	123,605,221 - 123,631,755 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	X	7,992,595 - 8,019,120 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	X	115,317,375 - 115,344,394 (-)	NCBI		Celera
Cytogenetic Map	X	q34	NCBI

STEEP1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	X	119,538,149 - 119,565,409 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	X	119,538,149 - 119,565,409 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	X	118,672,112 - 118,699,372 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	X	118,557,529 - 118,583,392 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	X	119,126,840 - 119,154,108 (-)	NCBI		Celera
Cytogenetic Map	X	q24	NCBI
HuRef	X	108,165,833 - 108,192,856 (-)	NCBI		HuRef
CHM1_1	X	118,583,359 - 118,610,624 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	X	117,915,908 - 117,943,135 (-)	NCBI		T2T-CHM13v2.0

Steep1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	X	36,087,388 - 36,127,956 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	X	36,087,390 - 36,137,764 (-)	Ensembl		GRCm39 Ensembl
GRCm38	X	36,827,161 - 36,864,303 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	X	36,823,737 - 36,874,111 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	X	34,388,538 - 34,404,241 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	X	33,255,180 - 33,305,588 (-)	NCBI		MGSCv36	mm8
Celera	X	23,572,190 - 23,587,885 (-)	NCBI		Celera
Cytogenetic Map	X	A3.3	NCBI
cM Map	X	21.23	NCBI

Steep1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955534	429,029 - 476,987 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955534	429,207 - 443,810 (+)	NCBI	ChiLan1.0	ChiLan1.0

STEEP1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	X	118,918,801 - 118,947,108 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	X	118,923,387 - 118,950,670 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	X	108,570,634 - 108,598,045 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	X	118,997,850 - 119,024,661 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	X	118,997,850 - 119,024,661 (-)	Ensembl	panpan1.1		panPan2

STEEP1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	X	91,573,392 - 91,598,523 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	X	91,575,882 - 91,598,425 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	X	77,648,136 - 77,673,310 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	X	93,312,436 - 93,337,629 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	X	93,312,910 - 93,337,616 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	X	90,765,359 - 90,790,317 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	X	92,523,931 - 92,549,044 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	X	92,253,041 - 92,278,233 (-)	NCBI		UU_Cfam_GSD_1.0

Steep1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	X	90,612,443 - 90,636,476 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936479	10,351,059 - 10,404,657 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936479	10,351,016 - 10,373,416 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

STEEP1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	X	97,974,604 - 97,986,278 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	X	97,974,596 - 97,986,281 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	X	113,678,599 - 113,690,302 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

STEEP1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Vero_WHO_p1.0	NW_023666065	32,291,932 - 32,316,567 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Steep1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624895	3,497,784 - 3,536,122 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624895	3,522,085 - 3,535,934 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Steep1
66 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	999
Count of miRNA genes:	342
Interacting mature miRNAs:	483
Transcripts:	ENSRNOT00000016993
Prediction methods:	Microtar, Miranda, Pita, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1598872	Memor14	Memory QTL 14	4.5		exploratory behavior trait (VT:0010471)	difference between time of physical contact/close proximity of test subject and social stimulus during sample phase and test phase (CMO:0002678)	X	93956491	138956491	Rat
1598856	Memor1	Memory QTL 1	1.9		exploratory behavior trait (VT:0010471)	total horizontal distance resulting from voluntary locomotion in an experimental apparatus (CMO:0001443)	X	103312877	148312877	Rat
1598809	Memor15	Memory QTL 15	4.4		exploratory behavior trait (VT:0010471)	difference between time of physical contact/close proximity of test subject and social stimulus during sample phase and test phase (CMO:0002678)	X	103312877	148312877	Rat
738025	Stresp3	Stress response QTL 3	4.61	0.0066	stress-related behavior trait (VT:0010451)	defensive burying - approach	X	100567703	150256146	Rat
61430	Cia18	Collagen induced arthritis QTL 18	3.1		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	X	14843113	120568734	Rat
738029	Stresp2	Stress response QTL 2	3.4	0.0004	stress-related behavior trait (VT:0010451)	defensive burying - approach	X	112934952	138400867	Rat
61431	Cia19	Collagen induced arthritis QTL 19	4.4		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	X	65612192	120568734	Rat
5685004	Bss104	Bone structure and strength QTL 104	3.9		tibia area (VT:1000281)	tibia area measurement (CMO:0001382)	X	113805422	126975220	Rat
10059603	Bw174	Body weight QTL 174	3.4	0.025	body mass (VT:0001259)	body weight (CMO:0000012)	X	113937816	152453651	Rat
724551	Glom1	Glomerulus QTL 1	2.8	0.0004	kidney glomerulus morphology trait (VT:0005325)	count of superficial glomeruli not directly contacting the kidney surface (CMO:0001002)	X	75294106	120294106	Rat
1598837	Memor13	Memory QTL 13	3.2		exploratory behavior trait (VT:0010471)	difference between time of physical contact/close proximity of test subject and social stimulus during sample phase and test phase (CMO:0002678)	X	41052407	146860749	Rat

RH130940

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	X	116,087,909 - 116,088,106 (+)	MAPPER	mRatBN7.2
Rnor_6.0	X	123,460,564 - 123,460,760	NCBI	Rnor6.0
Rnor_5.0	X	123,605,505 - 123,605,701	UniSTS	Rnor5.0
RGSC_v3.4	X	8,018,640 - 8,018,836	UniSTS	RGSC3.4
Celera	X	115,317,659 - 115,317,855	UniSTS
Cytogenetic Map	X	q12	UniSTS

RH126553

Rat Assembly	Chr	Position (strand)	Source	JBrowse
GRCr8	X	120,954,035 - 120,954,283 (+)	Marker Load Pipeline
mRatBN7.2	X	116,088,325 - 116,088,574 (+)	MAPPER	mRatBN7.2
Rnor_6.0	X	123,460,980 - 123,461,228	NCBI	Rnor6.0
Rnor_5.0	X	123,605,921 - 123,606,169	UniSTS	Rnor5.0
RGSC_v3.4	X	8,018,172 - 8,018,420	UniSTS	RGSC3.4
Celera	X	115,318,075 - 115,318,323	UniSTS
Cytogenetic Map	X	q12	UniSTS

MARC_21759-21760:1023907404:5

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	X	116,091,612 - 116,092,364 (+)	MAPPER	mRatBN7.2
Rnor_6.0	X	123,464,266 - 123,465,017	NCBI	Rnor6.0
Rnor_5.0	X	123,609,207 - 123,609,958	UniSTS	Rnor5.0
RGSC_v3.4	X	8,014,383 - 8,015,134	UniSTS	RGSC3.4
Celera	X	115,321,361 - 115,322,112	UniSTS
Cytogenetic Map	X	q12	UniSTS

px-14c7

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	X	116,106,432 - 116,106,569 (+)	MAPPER	mRatBN7.2
Rnor_6.0	X	123,479,092 - 123,479,228	NCBI	Rnor6.0
Rnor_5.0	X	123,624,033 - 123,624,169	UniSTS	Rnor5.0
RGSC_v3.4	X	8,000,181 - 8,000,317	UniSTS	RGSC3.4
Celera	X	115,335,842 - 115,335,978	UniSTS
Cytogenetic Map	X	q12	UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31


RefSeq Transcripts	NM_001107950	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH473991	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ222389	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ230433	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000021	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000016993 ⟹ ENSRNOP00000016993

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	X	116,087,626 - 116,114,159 (-)	Ensembl
Rnor_6.0 Ensembl	X	123,460,280 - 123,486,814 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000092415 ⟹ ENSRNOP00000075789

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	X	123,472,761 - 123,474,154 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000092455 ⟹ ENSRNOP00000075907

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	X	116,060,929 - 116,101,527 (-)	Ensembl
Rnor_6.0 Ensembl	X	123,462,333 - 123,474,288 (-)	Ensembl

RefSeq Acc Id:

NM_001107950 ⟹ NP_001101420

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	X	120,953,335 - 120,979,861 (-)	NCBI
mRatBN7.2	X	116,087,626 - 116,114,159 (-)	NCBI
Rnor_6.0	X	123,460,280 - 123,486,814 (-)	NCBI
Rnor_5.0	X	123,605,221 - 123,631,755 (-)	NCBI
RGSC_v3.4	X	7,992,595 - 8,019,120 (+)	RGD
Celera	X	115,317,375 - 115,344,394 (-)	RGD

Sequence:

show sequence

CCTTCAACTGTCGGGAATTTAAAAGGGAAACGCATGGGCTCCACTTGCGGATTTGAAGAGGAACCCCTGCGAAGTTTTCTTTTTATACAGCCTCCCCCGCCTCCCCCTGCATCTCAGCGGGATGGGAT
GTTCCGGAAGTTAATCAAGCCGGTATCAACACGTGACCAGGGTGGGGAAACGGTCTGGCGCGAGTGTCTGTGACGCCATCTCGCCGCGACTCATTTTCTTCGACTTTTCTGCCTGTTCTGCCGGAGCT
ATGCCGAAAGTCGTATCGCGGTCCGTGGTCTGCTCAGACACCCGGGACCGCGAGGAATATGATGATGGCGAGAAGCCCCTCCATGTTTACTACTGTTTATGCGGACAGATGGTCCTGGTGCTGGATTG
CCAGTTAGAGAAATTGCCCATGAGACCCCGGGACCGGTCTCGCGTGATCGATGCTGCCAAACACGCTCATAAGTTTTGTAACACAGAAGATGAGGAGACTACTTATCTTCGGAGGCCTGAGGGCATTG
AACGTCAATACAGGAAGAAGTGTGCAAAGTGTGGACTGCCGCTCTTCTACCAGTCTCAGCCGAAGAATGCTCCTGTGACCTTCATTGTGGATGGAGCAGTAGTGAAATTTGGCCAAGGCTTTGGGAAA
ACCAATATATATACTCAGAAACAAGAGCCTCCTAAGAAGGTTATGATGACCAAAAGGACTAAAGACATGGGCAAGTTCAGCTCTGTTACTGTGTCTACCATTGATGAGGAAGAAGAAGAGATAGAGGC
TCGGGAAGTTGCTGACTCCTATGCACAGAATGCCAAAGTGATTGAAAAACAGCTGGAGCGCAAAGGCATGAGCAAGAGGCGGCTGCAAGAGTTGGCTGAATTGGAAGCCAAGAAAGCAAAAATGAAGG
GGACCCTGATCGACAACCAGTTCAAATAATCAGGATCTTTCTGAACTCAGACTGGGGGCAGCACTTACATCAGGAAGAGTAGCTTCAAGATCTCATGGTCTGGTTTCTGTTTGCCCCAGGACTGTTCT
CTGGCAGTCCCATTGGTTTTCTGACACTGTTTATCTTCTTCTTCTTTTTCTTTTTTTTCTTTTTTTTTCTTTTTTTTTTTTTCTTTTTTTCGGAGCTGGGGACCGAACCCAGGGCCTTGCGCTTTCTA
GGCAAGCGCTCTACCACTGAGCTAAATCCCCAACCCCTGTTTATCTTCTTTCATTGAAGTCCTTGACTCCATTTCAGGACGTAGATTGTAAAATCTCTGTGTATGTGTTTTCTACCCTTCTTGACTTT
GAGATCAGATCCTGTTACACGCCAGAGGATGGCCTTGAACTCTCTGAGCCTCCTATCTTAGCCTCTAGTACTGAAGTTACAGGACCGCATCACCACGCCTGGCTTCTGCAGCAGTCCTCTTTTCATTT
GAAGTACACTTCTCCGATGTAGCTAGAACTAGTTAGTAAGTGTTTGAGTGTCTCTTGTATCTGAGGTAGATTTTTTTTTCTTCAAAGTTGTTGCAGTGTTTAAAGATTTTTTTAAATATGTAAGTAGG
AAAGTAGCAAAAATTAAGTTTAAAATTACAGACAGGTAGATGGATACTTTTACGAAACTCTGTCTCTAATCTTTAAACTGTTCTTAGAATGGACTGTGGTTGGAATCTTTCTCCTATCAGTAGAGAAC
AGATAGATACCTGATCTGCAGAAATATTTCTTTACTCAACCATGCTATGTCAGATTTCAGAATAAAAGAAGGAAAAGCCATGTGGCTGGGGGTGTAGCTGGGTAGTAGAATGCATGCTAGGCATGTGT
GAGGACATCTCCAGTACAAAAAAAAAATAGGAAAGCCAGATCACAGTTGCTCAGATAGCTCAGGTCTGATTTTAAATATGGCCTTGATAAGTAGCCCAAAGGCATTAGTGAGTCAGCTGAGAGAATAC
TCTGTGAGTACACGGAAGCAGACATAGTGAGAATAGCTTATCTGTTGGGCATCTGGTTTTATATTTGCTATTTGCAGAAGAGCATTTTAAATGTGTCACTCTCCTTCAATTATGTCAATATCCATGTG
ATTCTTCCATATTGTTCTCTGTTTGCCTGTATTGCAAGGCCCAAGGAGACATGGAATGTGTTGTCCTCCTCGTGTTGTCTATGATGGGTTGCACTTTTTAAATACTCAAGGCTCGTTGGTGAGGTGTT
GCCAGGAAATAGGGTTTTTTTTTTTTTTGCCTGTTTTTCTGTTTTTTGTGGGGGAGAGGTGTTGCCAGGAAATAGTTTTTTTTTTGCCTGTTTTTCTGGTTTTTGTGGGGGAAAGCTGGTTATAGTAG
AGGTACAGTTGAGCTAGCAATAACTGGACAGACATGGATTGGGGATCCTGGGAATGTGAAGAGTGGAGGTATGTTACCACCTTCCCAGTTATTCTGCAGCCTGTAGGGTCTTTTTATAGCTACTTTTT
AACCTCATTTTCTGTTCTAGTTGTAAGACAGAATGAACATTTGTGAATGGACAAATATGTCCAGACAATGGCCTCTACCTTTACGCCATTTTATCCCCAAATTCTTGGTATACAACTTGGATATACCA
AGACCACCTTAGAAATTCAGGCTTCTATTCTCTGGCCACCGCCTCCAACTATTTCTAGTCTCATGTGCTCCCATCCTTGTAGACCTTTTTAGATGTGATTTTTGATTTGAGGGGTGATTATTTTGCTA
GTAATAATGAAACATAATTGTGGCAATAGCACCATTAATACTCACTCGTCTCTATTGAGTACCTGGTTGTAGGAAGCACTTTAAAGGCATTAGCTCACCTCCTAGGAGATAAGATAACCGTTGTCATC
ACTGTTAGATAAACTAGTACTCTGAAGCTCTGAATTTTCCTCTCCCAAGATCTACTGGCCAGTAACTAGTAAAATCAGAAGACTGACTTTAAAACTCAAACTCTTTCCTGTGCTGAACTGCTGCTTCT
GTAGAATCTTGTATCATTTGATCAGAACATAATTTCATTTTGAAAAAACCACTGAAGTGCAATGTAAAATATTCAGCTGGAGAACCCCCTAAAGCAATTCTGTAGTTAATGCTTCTACGTATTTTCTG
AGATAACTCGCTCTTAGAGAAAGTCTAGCCATTTGAACATCTGGCTCAAGTTACACATTTTGCTGCTCGAAGGATAATGAAATACTATGTCATTAGTATCAAGTAAGTGTATACTTTTCATTATATTT
TACTCTTTTTATTGGAAGTTATTAAAAGATGTACTTTCTCTATTCTTTATTAACTTCCAGTGATTTTTATAGCAAATGTGTTTTAATATTAATAAGAGGAGCCATATTGACATTTGGAAAGTCGGAAC
TCTTGTTCTTTTCTTCCTTTTGCAAATGATCAACTGTGGCAAAATTATGAAAATGTTATGAAATATTCTTACTCTAATAGTTGGTGACATTTGGAATTGTAACTGTCATTTAAGAAAAATTAAAAAGC
TTTTTAAAGACTAACCTGTCTTGTTGGGGGTGCTGACATGTATGAATAGTTCTAACACTTAGGAGGATCACTTTGTTCAGGAGTTCGAGACCAATCTGAGCGCCATAGCAAGCAAAACTCTCTTTAAA
ATGAAATAAAATAAATAATAATGGAATG

hide sequence


Protein RefSeqs	NP_001101420	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDM10824	(Get FASTA)	NCBI Sequence Viewer
	EDM10825	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000016993
	ENSRNOP00000016993.4
	ENSRNOP00000075907.2

RefSeq Acc Id:

NP_001101420 ⟸ NM_001107950

- UniProtKB:

D4A067 (UniProtKB/TrEMBL), A6JMG3 (UniProtKB/TrEMBL), A0A0U1RS26 (UniProtKB/TrEMBL), A6JMG2 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MPKVVSRSVVCSDTRDREEYDDGEKPLHVYYCLCGQMVLVLDCQLEKLPMRPRDRSRVIDAAKHAHKFCNTEDEETTYLRRPEGIERQYRKKCAKCGLPLFYQSQPKNAPVTFIVDGAVVKFGQGFGK
TNIYTQKQEPPKKVMMTKRTKDMGKFSSVTVSTIDEEEEEIEAREVADSYAQNAKVIEKQLERKGMSKRRLQELAELEAKKAKMKGTLIDNQFK

hide sequence

Ensembl Acc Id:

ENSRNOP00000075789 ⟸ ENSRNOT00000092415

Ensembl Acc Id:

ENSRNOP00000075907 ⟸ ENSRNOT00000092455

Ensembl Acc Id:

ENSRNOP00000016993 ⟸ ENSRNOT00000016993

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D4A067-F1-model_v2	AlphaFold	D4A067	1-222	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

RGD ID:

13701987

Promoter ID:

EPDNEW_R12507

Type:

multiple initiation site

Name:

RGD1564541_1

Description:

similar to hypothetical protein FLJ22965

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	X	123,474,135 - 123,474,195	EPDNEW

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-1304	BioCyc
Ensembl Genes	ENSRNOG00000012564	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000016993	ENTREZGENE
	ENSRNOT00000016993.6	UniProtKB/TrEMBL
	ENSRNOT00000092455.2	UniProtKB/TrEMBL
InterPro	UPF0428	UniProtKB/TrEMBL
KEGG Report	rno:313433	UniProtKB/TrEMBL
NCBI Gene	313433	ENTREZGENE
PANTHER	PTHR46355	UniProtKB/TrEMBL
	STING ER EXIT PROTEIN	UniProtKB/TrEMBL
PhenoGen	Steep1	PhenoGen
RatGTEx	ENSRNOG00000012564	RatGTEx
UniProt	A0A0U1RS26	ENTREZGENE, UniProtKB/TrEMBL
	A6JMG2	ENTREZGENE, UniProtKB/TrEMBL
	A6JMG3	ENTREZGENE, UniProtKB/TrEMBL
	D4A067	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2020-12-10	Steep1	STING1 ER exit protein 1	RGD1564541	similar to hypothetical protein FLJ22965	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-04-30	RGD1564541	similar to hypothetical protein FLJ22965	RGD1564541_predicted	similar to hypothetical protein FLJ22965 (predicted)	'predicted' is removed	2292626	APPROVED
2006-03-07	RGD1564541_predicted	similar to hypothetical protein FLJ22965 (predicted)	LOC313433	similar to hypothetical protein FLJ22965	Symbol and Name status set to approved	1299863	APPROVED
2006-02-09	LOC313433	similar to hypothetical protein FLJ22965			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Imported Disease Annotations - ClinVar

Imported Disease Annotations - OMIM

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - OMIM