Symbol:
Gxylt1
Name:
glucoside xylosyltransferase 1
RGD ID:
1563062
Description:
Predicted to enable UDP-xylosyltransferase activity. Predicted to be involved in O-glycan processing. Predicted to be located in membrane. Orthologous to human GXYLT1 (glucoside xylosyltransferase 1); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; bisphenol A; cefaloridine.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
Glt8d3; glycosyltransferase 8 domain containing 3; glycosyltransferase 8 domain-containing protein 3; LOC300173; S33-D; similar to CG9996-PA
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 7 126,280,349 - 126,320,803 (-) NCBI GRCr8 mRatBN7.2 7 124,400,896 - 124,434,682 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 7 124,400,896 - 124,434,699 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 7 126,175,473 - 126,208,851 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 7 128,401,325 - 128,434,702 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 7 128,322,920 - 128,356,490 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 7 134,447,578 - 134,495,858 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 7 134,447,578 - 134,495,835 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 7 134,118,984 - 134,166,045 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 7 131,726,969 - 131,761,134 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 7 120,799,137 - 120,832,731 (-) NCBI Celera Cytogenetic Map 7 q35 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Gxylt1 Rat 1,2-dichloroethane decreases expression ISO RGD:1622093 6480464 ethylene dichloride results in decreased expression of GXYLT1 mRNA CTD PMID:28960355 Gxylt1 Rat 1,2-dimethylhydrazine decreases expression ISO RGD:1622093 6480464 1,2-Dimethylhydrazine results in decreased expression of GXYLT1 mRNA CTD PMID:22206623 Gxylt1 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO RGD:1606923 6480464 Tetrachlorodibenzodioxin results in decreased expression of GXYLT1 mRNA CTD PMID:20106945|PMID:21632981 Gxylt1 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of GXYLT1 mRNA CTD PMID:33387578 Gxylt1 Rat 2,4,6-tribromophenol increases expression ISO RGD:1606923 6480464 2,4,6-tribromophenol results in increased expression of GXYLT1 mRNA CTD PMID:31675489 Gxylt1 Rat 3,3',5,5'-tetrabromobisphenol A increases expression ISO RGD:1606923 6480464 tetrabromobisphenol A results in increased expression of GXYLT1 protein CTD PMID:31675489 Gxylt1 Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO RGD:1606923 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] more ... CTD PMID:28628672 Gxylt1 Rat 4,4'-sulfonyldiphenol multiple interactions ISO RGD:1606923 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] more ... CTD PMID:28628672 Gxylt1 Rat aflatoxin B1 increases expression ISO RGD:1622093 6480464 Aflatoxin B1 results in increased expression of GXYLT1 mRNA CTD PMID:19770486 Gxylt1 Rat aflatoxin B1 increases expression ISO RGD:1606923 6480464 Aflatoxin B1 results in increased expression of GXYLT1 mRNA CTD PMID:22100608 Gxylt1 Rat aflatoxin M1 decreases expression ISO RGD:1606923 6480464 Aflatoxin M1 results in decreased expression of GXYLT1 mRNA CTD PMID:30928695 Gxylt1 Rat aristolochic acid A decreases expression ISO RGD:1606923 6480464 aristolochic acid I results in decreased expression of GXYLT1 mRNA CTD PMID:33212167 Gxylt1 Rat benzo[a]pyrene increases expression ISO RGD:1622093 6480464 Benzo(a)pyrene results in increased expression of GXYLT1 mRNA CTD PMID:22228805 Gxylt1 Rat benzo[a]pyrene increases expression ISO RGD:1606923 6480464 Benzo(a)pyrene results in increased expression of GXYLT1 mRNA CTD PMID:26238291 Gxylt1 Rat benzo[a]pyrene diol epoxide I increases expression ISO RGD:1606923 6480464 7,8-Dihydro-7,8-dihydroxybenzo(a)pyrene 9,10-oxide results in increased expression of GXYLT1 mRNA CTD PMID:26238291 Gxylt1 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of GXYLT1 mRNA CTD PMID:25181051 Gxylt1 Rat bisphenol A increases expression ISO RGD:1606923 6480464 bisphenol A results in increased expression of GXYLT1 protein CTD PMID:33376534 Gxylt1 Rat bisphenol A decreases expression ISO RGD:1622093 6480464 bisphenol A results in decreased expression of GXYLT1 mRNA CTD PMID:33221593 Gxylt1 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of GXYLT1 mRNA CTD PMID:30816183|PMID:32528016 Gxylt1 Rat bisphenol F increases expression ISO RGD:1622093 6480464 bisphenol F results in increased expression of GXYLT1 mRNA CTD PMID:38685157 Gxylt1 Rat cadmium atom increases expression ISO RGD:1606923 6480464 Cadmium results in increased expression of GXYLT1 mRNA CTD PMID:24376830 Gxylt1 Rat captan increases expression ISO RGD:1622093 6480464 Captan results in increased expression of GXYLT1 mRNA CTD PMID:31558096 Gxylt1 Rat carbon nanotube increases expression ISO RGD:1622093 6480464 Nanotubes, Carbon analog results in increased expression of GXYLT1 mRNA CTD PMID:25554681 Gxylt1 Rat cefaloridine decreases expression EXP 6480464 Cephaloridine results in decreased expression of GXYLT1 mRNA CTD PMID:18500788 Gxylt1 Rat CGP 52608 multiple interactions ISO RGD:1606923 6480464 CGP 52608 promotes the reaction [RORA protein binds to GXYLT1 gene] CTD PMID:28238834 Gxylt1 Rat choline multiple interactions ISO RGD:1622093 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation more ... CTD PMID:20938992 Gxylt1 Rat crotonaldehyde decreases expression ISO RGD:1606923 6480464 2-butenal results in decreased expression of GXYLT1 mRNA CTD PMID:20471460 Gxylt1 Rat Cuprizon increases expression EXP 6480464 Cuprizone results in increased expression of GXYLT1 mRNA CTD PMID:27523638 Gxylt1 Rat cyclosporin A decreases expression ISO RGD:1622093 6480464 Cyclosporine results in decreased expression of GXYLT1 mRNA CTD PMID:19770486 Gxylt1 Rat cyclosporin A decreases expression ISO RGD:1606923 6480464 Cyclosporine results in decreased expression of GXYLT1 mRNA CTD PMID:25562108 Gxylt1 Rat decabromodiphenyl ether increases expression ISO RGD:1606923 6480464 decabromobiphenyl ether results in increased expression of GXYLT1 protein CTD PMID:31675489 Gxylt1 Rat dexamethasone multiple interactions ISO RGD:1606923 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] more ... CTD PMID:28628672 Gxylt1 Rat Dibutyl phosphate affects expression ISO RGD:1606923 6480464 di-n-butylphosphoric acid affects the expression of GXYLT1 mRNA CTD PMID:37042841 Gxylt1 Rat dicrotophos decreases expression ISO RGD:1606923 6480464 dicrotophos results in decreased expression of GXYLT1 mRNA CTD PMID:28302478 Gxylt1 Rat ethanol increases expression ISO RGD:1622093 6480464 Ethanol results in increased expression of GXYLT1 mRNA CTD PMID:30319688 Gxylt1 Rat ethyl methanesulfonate increases expression ISO RGD:1606923 6480464 Ethyl Methanesulfonate results in increased expression of GXYLT1 mRNA CTD PMID:23649840 Gxylt1 Rat folic acid multiple interactions ISO RGD:1622093 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation more ... CTD PMID:20938992 Gxylt1 Rat folpet increases expression ISO RGD:1622093 6480464 folpet results in increased expression of GXYLT1 mRNA CTD PMID:31558096 Gxylt1 Rat formaldehyde decreases expression ISO RGD:1606923 6480464 Formaldehyde results in decreased expression of GXYLT1 mRNA CTD PMID:20655997 Gxylt1 Rat formaldehyde increases expression ISO RGD:1606923 6480464 Formaldehyde results in increased expression of GXYLT1 mRNA CTD PMID:23649840 Gxylt1 Rat fulvestrant increases methylation ISO RGD:1606923 6480464 Fulvestrant results in increased methylation of GXYLT1 gene CTD PMID:31601247 Gxylt1 Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of GXYLT1 mRNA CTD PMID:22061828 Gxylt1 Rat gentamycin decreases expression EXP 6480464 Gentamicins results in decreased expression of GXYLT1 mRNA CTD PMID:33387578 Gxylt1 Rat indole-3-methanol affects expression EXP 6480464 indole-3-carbinol affects the expression of GXYLT1 mRNA CTD PMID:21396975 Gxylt1 Rat indometacin multiple interactions ISO RGD:1606923 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] more ... CTD PMID:28628672 Gxylt1 Rat ivermectin decreases expression ISO RGD:1606923 6480464 Ivermectin results in decreased expression of GXYLT1 protein CTD PMID:32959892 Gxylt1 Rat L-methionine multiple interactions ISO RGD:1622093 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation more ... CTD PMID:20938992 Gxylt1 Rat leflunomide decreases expression ISO RGD:1606923 6480464 leflunomide results in decreased expression of GXYLT1 mRNA CTD PMID:28988120 Gxylt1 Rat methyl methanesulfonate increases expression ISO RGD:1606923 6480464 Methyl Methanesulfonate results in increased expression of GXYLT1 mRNA CTD PMID:23649840 Gxylt1 Rat methylmercury chloride decreases expression ISO RGD:1606923 6480464 methylmercuric chloride results in decreased expression of GXYLT1 mRNA CTD PMID:28001369 Gxylt1 Rat paracetamol increases expression ISO RGD:1606923 6480464 Acetaminophen results in increased expression of GXYLT1 mRNA CTD PMID:22230336 Gxylt1 Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of GXYLT1 mRNA CTD PMID:33387578 Gxylt1 Rat perfluorooctane-1-sulfonic acid decreases expression ISO RGD:1606923 6480464 perfluorooctane sulfonic acid results in decreased expression of GXYLT1 mRNA CTD PMID:27153767 Gxylt1 Rat perfluorooctanoic acid decreases expression ISO RGD:1606923 6480464 perfluorooctanoic acid results in decreased expression of GXYLT1 protein CTD PMID:26879310 Gxylt1 Rat picoxystrobin increases expression ISO RGD:1606923 6480464 picoxystrobin results in increased expression of GXYLT1 mRNA CTD PMID:33512557 Gxylt1 Rat resveratrol multiple interactions ISO RGD:1606923 6480464 [Plant Extracts co-treated with Resveratrol] results in increased expression of GXYLT1 mRNA CTD PMID:23557933 Gxylt1 Rat sodium arsenite decreases expression ISO RGD:1622093 6480464 sodium arsenite results in decreased expression of GXYLT1 mRNA CTD PMID:37682722 Gxylt1 Rat temozolomide decreases expression ISO RGD:1606923 6480464 Temozolomide results in decreased expression of GXYLT1 mRNA CTD PMID:31758290 Gxylt1 Rat testosterone decreases expression ISO RGD:1606923 6480464 Testosterone results in decreased expression of GXYLT1 mRNA CTD PMID:33359661 Gxylt1 Rat thimerosal decreases expression ISO RGD:1606923 6480464 Thimerosal results in decreased expression of GXYLT1 mRNA CTD PMID:27188386 Gxylt1 Rat titanium dioxide decreases methylation ISO RGD:1622093 6480464 titanium dioxide results in decreased methylation of GXYLT1 gene; titanium dioxide results in decreased methylation more ... CTD PMID:35295148 Gxylt1 Rat trichloroethene decreases expression EXP 6480464 Trichloroethylene results in decreased expression of GXYLT1 mRNA CTD PMID:33387578 Gxylt1 Rat triphenyl phosphate affects expression ISO RGD:1606923 6480464 triphenyl phosphate affects the expression of GXYLT1 mRNA CTD PMID:37042841 Gxylt1 Rat triptonide increases expression ISO RGD:1622093 6480464 triptonide results in increased expression of GXYLT1 mRNA CTD PMID:33045310 Gxylt1 Rat troglitazone decreases expression ISO RGD:1622093 6480464 troglitazone results in decreased expression of GXYLT1 mRNA CTD PMID:28973697 Gxylt1 Rat urethane increases expression ISO RGD:1606923 6480464 Urethane results in increased expression of GXYLT1 mRNA CTD PMID:28818685 Gxylt1 Rat valproic acid increases expression ISO RGD:1606923 6480464 Valproic Acid results in increased expression of GXYLT1 mRNA CTD PMID:29154799 Gxylt1 Rat vorinostat decreases expression ISO RGD:1606923 6480464 vorinostat results in decreased expression of GXYLT1 mRNA CTD PMID:27188386
1,2-dichloroethane (ISO) 1,2-dimethylhydrazine (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4,6-tribromophenol (ISO) 3,3',5,5'-tetrabromobisphenol A (ISO) 3-isobutyl-1-methyl-7H-xanthine (ISO) 4,4'-sulfonyldiphenol (ISO) aflatoxin B1 (ISO) aflatoxin M1 (ISO) aristolochic acid A (ISO) benzo[a]pyrene (ISO) benzo[a]pyrene diol epoxide I (ISO) bisphenol A (EXP,ISO) bisphenol F (ISO) cadmium atom (ISO) captan (ISO) carbon nanotube (ISO) cefaloridine (EXP) CGP 52608 (ISO) choline (ISO) crotonaldehyde (ISO) Cuprizon (EXP) cyclosporin A (ISO) decabromodiphenyl ether (ISO) dexamethasone (ISO) Dibutyl phosphate (ISO) dicrotophos (ISO) ethanol (ISO) ethyl methanesulfonate (ISO) folic acid (ISO) folpet (ISO) formaldehyde (ISO) fulvestrant (ISO) gentamycin (EXP) indole-3-methanol (EXP) indometacin (ISO) ivermectin (ISO) L-methionine (ISO) leflunomide (ISO) methyl methanesulfonate (ISO) methylmercury chloride (ISO) paracetamol (EXP,ISO) perfluorooctane-1-sulfonic acid (ISO) perfluorooctanoic acid (ISO) picoxystrobin (ISO) resveratrol (ISO) sodium arsenite (ISO) temozolomide (ISO) testosterone (ISO) thimerosal (ISO) titanium dioxide (ISO) trichloroethene (EXP) triphenyl phosphate (ISO) triptonide (ISO) troglitazone (ISO) urethane (ISO) valproic acid (ISO) vorinostat (ISO)
Gxylt1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 7 126,280,349 - 126,320,803 (-) NCBI GRCr8 mRatBN7.2 7 124,400,896 - 124,434,682 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 7 124,400,896 - 124,434,699 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 7 126,175,473 - 126,208,851 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 7 128,401,325 - 128,434,702 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 7 128,322,920 - 128,356,490 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 7 134,447,578 - 134,495,858 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 7 134,447,578 - 134,495,835 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 7 134,118,984 - 134,166,045 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 7 131,726,969 - 131,761,134 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 7 120,799,137 - 120,832,731 (-) NCBI Celera Cytogenetic Map 7 q35 NCBI
GXYLT1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 12 42,081,845 - 42,144,874 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 12 42,081,845 - 42,144,874 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 12 42,475,647 - 42,538,676 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 12 40,761,914 - 40,824,940 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 12 41,277,461 - 41,340,510 (-) NCBI Celera Cytogenetic Map 12 q12 NCBI HuRef 12 39,502,946 - 39,566,034 (-) NCBI HuRef CHM1_1 12 42,441,063 - 42,504,087 (-) NCBI CHM1_1 T2T-CHM13v2.0 12 42,039,739 - 42,102,776 (-) NCBI T2T-CHM13v2.0
Gxylt1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 15 93,137,611 - 93,173,060 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 15 93,137,623 - 93,173,060 (-) Ensembl GRCm39 Ensembl GRCm38 15 93,239,730 - 93,275,336 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 15 93,239,742 - 93,275,179 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 15 93,070,173 - 93,105,515 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 15 93,067,922 - 93,103,264 (-) NCBI MGSCv36 mm8 Celera 15 95,381,488 - 95,418,772 (-) NCBI Celera Cytogenetic Map 15 E3 NCBI cM Map 15 47.34 NCBI
Gxylt1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955500 1,479,159 - 1,511,731 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955500 1,479,159 - 1,511,385 (-) NCBI ChiLan1.0 ChiLan1.0
GXYLT1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 10 51,998,816 - 52,075,968 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 12 51,995,551 - 52,072,729 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 12 46,570,205 - 46,631,899 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 12 47,445,059 - 47,496,939 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 12 47,448,871 - 47,491,021 (+) Ensembl panpan1.1 panPan2
GXYLT1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 27 11,754,609 - 11,810,245 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 27 11,765,072 - 11,807,787 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 27 34,493,350 - 34,548,355 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 27 11,951,517 - 12,006,551 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 27 11,951,375 - 12,089,405 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 27 11,769,474 - 11,824,431 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 27 11,800,377 - 11,855,383 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 27 34,743,882 - 34,794,670 (-) NCBI UU_Cfam_GSD_1.0
Gxylt1
GXYLT1
GXYLT1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 11 38,320,163 - 38,377,157 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 11 38,321,991 - 38,377,166 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666037 208,196,085 - 208,257,506 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Gxylt1
.
Predicted Target Of
Count of predictions: 907 Count of miRNA genes: 328 Interacting mature miRNAs: 455 Transcripts: ENSRNOT00000058349 Prediction methods: Microtar, Miranda, Targetscan Result types: miRGate_prediction
1300179 Kidm5 Kidney mass QTL 5 3.51 kidney mass (VT:0002707) left kidney wet weight (CMO:0000083) 7 43747012 135012528 Rat 1354582 Stl11 Serum triglyceride level QTL 11 3.42 blood triglyceride amount (VT:0002644) serum triglyceride level (CMO:0000360) 7 119513385 135012528 Rat 731176 Glom5 Glomerulus QTL 5 2.5 0.0035 kidney glomerulus morphology trait (VT:0005325) count of superficial glomeruli not directly contacting the kidney surface (CMO:0001002) 7 96670164 135012528 Rat 1300112 Bp183 Blood pressure QTL 183 3.51 arterial blood pressure trait (VT:2000000) blood pressure time series experimental set point of the baroreceptor response (CMO:0002593) 7 111182207 135012528 Rat 2306821 Bp335 Blood pressure QTL 335 0.001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 7 106571501 135012528 Rat 631663 Bw6 Body weight QTL 6 3.4 body mass (VT:0001259) body weight (CMO:0000012) 7 111075573 134976056 Rat 1331731 Bp216 Blood pressure QTL 216 2.851 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 7 102297359 133492884 Rat 2298475 Eau6 Experimental allergic uveoretinitis QTL 6 0.0029 uvea integrity trait (VT:0010551) experimental autoimmune uveitis score (CMO:0001504) 7 84257275 129257275 Rat 1558655 Swd4 Spike wave discharge measurement QTL 4 3.68 0.0002 brain electrophysiology trait (VT:0010557) brain spike-and-wave discharge severity grade (CMO:0001988) 7 86983365 131983365 Rat 631201 Panci1 Pancreas inflammation QTL 1 0 0.001 pancreas integrity trait (VT:0010560) percentage of study population displaying chronic pancreatitis at a point in time (CMO:0001214) 7 116677189 127103496 Rat 71114 Niddm14 Non-insulin dependent diabetes mellitus QTL 14 4.5 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 7 84257275 129257275 Rat 1331768 Kidm10 Kidney mass QTL 10 4.62096 kidney mass (VT:0002707) left kidney wet weight (CMO:0000083) 7 80221299 125221299 Rat 731174 Uae23 Urinary albumin excretion QTL 23 2.4 0.0042 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 7 104603555 135012528 Rat 631687 Hcas1 Hepatocarcinoma susceptibility QTL 1 3.9 0.001 liver integrity trait (VT:0010547) liver tumorous lesion volume to total liver volume ratio (CMO:0001082) 7 91412594 129807172 Rat 1357339 Stl14 Serum triglyceride level QTL 14 3.45 0.0001 blood triglyceride amount (VT:0002644) serum triglyceride level (CMO:0000360) 7 112729683 133492707 Rat 1331748 Bp215 Blood pressure QTL 215 4.043 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 7 112308254 133492884 Rat 634331 Pia17 Pristane induced arthritis QTL 17 4.7 joint integrity trait (VT:0010548) arthritic paw count (CMO:0001460) 7 73829340 130221005 Rat 1358914 Bp266 Blood pressure QTL 266 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 7 83591953 134666232 Rat 2299163 Iddm34 Insulin dependent diabetes mellitus QTL 34 2.71 blood glucose amount (VT:0000188) age at onset/diagnosis of type 1 diabetes mellitus (CMO:0001140) 7 91281130 135012528 Rat 634322 Bw12 Body weight QTL 12 0 body mass (VT:0001259) body weight (CMO:0000012) 7 83153392 128153392 Rat 70173 Niddm19 Non-insulin dependent diabetes mellitus QTL 19 4.33 0.00005 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 7 64002457 135012528 Rat 1549899 Stresp8 Stress response QTL 8 4.37 0.0008 stress-related behavior trait (VT:0010451) defensive burying duration (CMO:0001961) 7 90482196 135012528 Rat 2317052 Aia17 Adjuvant induced arthritis QTL 17 2.13 joint integrity trait (VT:0010548) left rear ankle joint diameter (CMO:0002149) 7 81737938 126737938 Rat 1358891 Bp265 Blood pressure QTL 265 2.21 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 7 83591953 134666232 Rat
D7Got125
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 7 124,429,308 - 124,429,503 (+) MAPPER mRatBN7.2 Rnor_6.0 7 134,490,327 - 134,490,521 NCBI Rnor6.0 Rnor_5.0 7 134,160,537 - 134,160,731 UniSTS Rnor5.0 RGSC_v3.4 7 131,755,807 - 131,756,002 RGD RGSC3.4 RGSC_v3.4 7 131,755,808 - 131,756,002 UniSTS RGSC3.4 RGSC_v3.1 7 131,832,245 - 131,832,439 RGD Celera 7 120,827,406 - 120,827,600 UniSTS RH 3.4 Map 7 1021.8 UniSTS RH 3.4 Map 7 1021.8 RGD RH 2.0 Map 7 742.5 RGD Cytogenetic Map 7 q35 UniSTS
BF389068
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 7 124,402,248 - 124,402,401 (+) MAPPER mRatBN7.2 Rnor_6.0 7 134,448,931 - 134,449,083 NCBI Rnor6.0 Rnor_5.0 7 134,120,337 - 134,120,489 UniSTS Rnor5.0 RGSC_v3.4 7 131,728,322 - 131,728,474 UniSTS RGSC3.4 Celera 7 120,800,494 - 120,800,646 UniSTS RH 3.4 Map 7 1021.4 UniSTS Cytogenetic Map 7 q35 UniSTS
RH131635
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 7 124,400,952 - 124,401,164 (+) MAPPER mRatBN7.2 Rnor_6.0 7 134,447,635 - 134,447,846 NCBI Rnor6.0 Rnor_5.0 7 134,119,041 - 134,119,252 UniSTS Rnor5.0 RGSC_v3.4 7 131,727,026 - 131,727,237 UniSTS RGSC3.4 Celera 7 120,799,194 - 120,799,405 UniSTS RH 3.4 Map 7 1021.1 UniSTS Cytogenetic Map 7 q35 UniSTS
RH138193
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 7 124,410,980 - 124,411,106 (+) MAPPER mRatBN7.2 Rnor_6.0 7 134,471,848 - 134,471,973 NCBI Rnor6.0 Rnor_5.0 7 134,142,058 - 134,142,183 UniSTS Rnor5.0 RGSC_v3.4 7 131,737,482 - 131,737,607 UniSTS RGSC3.4 Celera 7 120,809,216 - 120,809,341 UniSTS RH 3.4 Map 7 1021.1 UniSTS Cytogenetic Map 7 q35 UniSTS
AI231622
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 7 124,403,024 - 124,403,174 (+) MAPPER mRatBN7.2 Rnor_6.0 7 134,449,707 - 134,449,856 NCBI Rnor6.0 Rnor_5.0 7 134,121,113 - 134,121,262 UniSTS Rnor5.0 RGSC_v3.4 7 131,729,098 - 131,729,247 UniSTS RGSC3.4 Celera 7 120,801,270 - 120,801,419 UniSTS RH 3.4 Map 7 1018.9 UniSTS Cytogenetic Map 7 q35 UniSTS
AI412638
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 7 124,436,930 - 124,437,132 (+) MAPPER mRatBN7.2 Rnor_6.0 7 134,498,131 - 134,498,332 NCBI Rnor6.0 Rnor_5.0 7 134,168,341 - 134,168,542 UniSTS Rnor5.0 RGSC_v3.4 7 131,763,430 - 131,763,631 UniSTS RGSC3.4 Celera 7 120,835,027 - 120,835,228 UniSTS RH 3.4 Map 7 1017.7 UniSTS Cytogenetic Map 7 q35 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000058349 ⟹ ENSRNOP00000055150
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 124,400,896 - 124,434,636 (-) Ensembl Rnor_6.0 Ensembl 7 134,447,578 - 134,495,835 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000081104 ⟹ ENSRNOP00000073028
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 124,405,776 - 124,421,589 (-) Ensembl Rnor_6.0 Ensembl 7 134,452,458 - 134,482,607 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000099240 ⟹ ENSRNOP00000091433
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 124,405,775 - 124,434,699 (-) Ensembl
RefSeq Acc Id:
NM_001100887 ⟹ NP_001094357
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 126,280,349 - 126,314,087 (-) NCBI mRatBN7.2 7 124,400,896 - 124,434,636 (-) NCBI Rnor_6.0 7 134,447,578 - 134,495,835 (-) NCBI Rnor_5.0 7 134,118,984 - 134,166,045 (-) NCBI RGSC_v3.4 7 131,726,969 - 131,761,134 (-) RGD Celera 7 120,799,137 - 120,832,731 (-) RGD
Sequence:
GGCGGCGGCGGTGAGGGCGGCAGCGGCGGTGGCGGTAGCGCGGGCCGGGATGCGGCGCTACCTGCGGGTCGTAGGGCTGTGCCTGGCCTGCGGCTTCTGCTCGCTGCTGTACGCCTTCAGCCAGCTCG
hide sequence
RefSeq Acc Id:
XM_006242192 ⟹ XP_006242254
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 126,280,349 - 126,320,803 (-) NCBI mRatBN7.2 7 124,400,896 - 124,434,674 (-) NCBI Rnor_6.0 7 134,447,578 - 134,495,858 (-) NCBI Rnor_5.0 7 134,118,984 - 134,166,045 (-) NCBI
Sequence:
TAGTTCGCCCGGGCGGGAGAGGCGGCGGCGGCGGTGAGGGCGGCAGCGGCGGTGGCGGTAGCGC
hide sequence
RefSeq Acc Id:
XM_039078904 ⟹ XP_038934832
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 126,280,349 - 126,305,304 (-) NCBI mRatBN7.2 7 124,400,896 - 124,434,399 (-) NCBI
RefSeq Acc Id:
XM_039078905 ⟹ XP_038934833
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 126,289,726 - 126,314,125 (-) NCBI mRatBN7.2 7 124,410,735 - 124,434,682 (-) NCBI
RefSeq Acc Id:
XM_039078906 ⟹ XP_038934834
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 126,289,726 - 126,314,125 (-) NCBI mRatBN7.2 7 124,410,735 - 124,434,680 (-) NCBI
RefSeq Acc Id:
XM_039078907 ⟹ XP_038934835
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 126,280,349 - 126,298,532 (-) NCBI mRatBN7.2 7 124,405,667 - 124,419,083 (-) NCBI
RefSeq Acc Id:
NP_001094357 ⟸ NM_001100887
- UniProtKB:
Q6GX83 (UniProtKB/Swiss-Prot), A6K7S6 (UniProtKB/TrEMBL)
- Sequence:
MRRYLRVVGLCLACGFCSLLYAFSQLAVSLEEGAAVGRRPQAAVASWLADGGRGTGRGAGSAGPGRTGRCKEVSLSYWNPYWMLPSDVCGVNCFWEAAFRYGLKTRPTEKMHLAVVACGDRLEETVTM
hide sequence
RefSeq Acc Id:
XP_006242254 ⟸ XM_006242192
- Peptide Label:
isoform X1
- UniProtKB:
A0A8I6AFF2 (UniProtKB/TrEMBL), A6K7S5 (UniProtKB/TrEMBL)
- Sequence:
MRRYLRVVGLCLACGFCSLLYAFSQLAVSLEEGAAVGRRPQAAVASWLADGGRGTGRGAGSAGP
hide sequence
Ensembl Acc Id:
ENSRNOP00000055150 ⟸ ENSRNOT00000058349
Ensembl Acc Id:
ENSRNOP00000073028 ⟸ ENSRNOT00000081104
RefSeq Acc Id:
XP_038934832 ⟸ XM_039078904
- Peptide Label:
isoform X2
- UniProtKB:
B2RZ91 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038934835 ⟸ XM_039078907
- Peptide Label:
isoform X5
RefSeq Acc Id:
XP_038934833 ⟸ XM_039078905
- Peptide Label:
isoform X3
RefSeq Acc Id:
XP_038934834 ⟸ XM_039078906
- Peptide Label:
isoform X4
Ensembl Acc Id:
ENSRNOP00000091433 ⟸ ENSRNOT00000099240
RGD ID: 13695600 Promoter ID: EPDNEW_R6125 Type: multiple initiation site Name: Gxylt1_1 Description: glucoside xylosyltransferase 1 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 7 134,495,859 - 134,495,919 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2011-08-02
Gxylt1
glucoside xylosyltransferase 1
Glt8d3
glycosyltransferase 8 domain containing 3
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-03-04
Glt8d3
glycosyltransferase 8 domain containing 3
LOC300173
similar to CG9996-PA
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2006-02-09
LOC300173
similar to CG9996-PA
Symbol and Name status set to provisional
70820 PROVISIONAL
