Symbol:
Inka1
Name:
inka box actin regulator 1
RGD ID:
1560778
Description:
Predicted to enable protein kinase binding activity and protein serine/threonine kinase inhibitor activity. Predicted to act upstream of or within neural tube development. Predicted to be located in cytoplasm. Predicted to be active in nucleus. Orthologous to human INKA1 (inka box actin regulator 1); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; acrylamide; all-trans-retinoic acid.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
Fam212a; family with sequence similarity 212, member A; hypothetical protein LOC316001; INKA1 protein; LOC316001; PAK4-inhibitor INKA1; RGD1560778; similar to RIKEN cDNA 6530418L21
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
INKA1 (inka box actin regulator 1) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Inka1 (inka box actin regulator 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Inka1 (inka box actin regulator 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
INKA1 (inka box actin regulator 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
INKA1 (inka box actin regulator 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Inka1 (inka box actin regulator 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
INKA1 (inka box actin regulator 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
INKA1 (inka box actin regulator 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Inka1 (inka box actin regulator 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
KANK1 (KN motif and ankyrin repeat domains 1) HGNC
OMA
Alliance orthologs 3
Homo sapiens (human):
INKA1 (inka box actin regulator 1)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Mus musculus (house mouse):
Inka1 (inka box actin regulator 1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
inka1a
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
inka1b
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
inka1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 8 117,552,875 - 117,554,565 (-) NCBI GRCr8 mRatBN7.2 8 108,674,263 - 108,675,953 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 8 108,674,263 - 108,675,953 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 8 114,300,737 - 114,302,427 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 8 112,500,060 - 112,501,750 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 8 110,342,700 - 110,344,390 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 8 116,763,149 - 116,764,839 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 8 116,763,001 - 116,764,780 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 8 116,117,472 - 116,119,162 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 8 113,253,800 - 113,255,490 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 8 107,978,903 - 107,980,593 (-) NCBI Celera Cytogenetic Map 8 q32 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Inka1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 8 117,552,875 - 117,554,565 (-) NCBI GRCr8 mRatBN7.2 8 108,674,263 - 108,675,953 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 8 108,674,263 - 108,675,953 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 8 114,300,737 - 114,302,427 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 8 112,500,060 - 112,501,750 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 8 110,342,700 - 110,344,390 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 8 116,763,149 - 116,764,839 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 8 116,763,001 - 116,764,780 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 8 116,117,472 - 116,119,162 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 8 113,253,800 - 113,255,490 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 8 107,978,903 - 107,980,593 (-) NCBI Celera Cytogenetic Map 8 q32 NCBI
INKA1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 3 49,803,261 - 49,805,030 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 3 49,803,261 - 49,805,030 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 3 49,840,694 - 49,842,463 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 3 49,815,691 - 49,817,467 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 3 49,806,165 - 49,807,990 (+) NCBI Celera Cytogenetic Map 3 p21.31 NCBI HuRef 3 49,899,736 - 49,901,512 (+) NCBI HuRef CHM1_1 3 49,792,748 - 49,794,524 (+) NCBI CHM1_1 T2T-CHM13v2.0 3 49,833,138 - 49,834,907 (+) NCBI T2T-CHM13v2.0
Inka1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 9 107,861,422 - 107,863,078 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 9 107,861,422 - 107,863,078 (-) Ensembl GRCm39 Ensembl GRCm38 9 107,984,223 - 107,985,916 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 9 107,984,223 - 107,985,879 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 9 107,886,554 - 107,888,247 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 9 107,842,327 - 107,843,980 (-) NCBI MGSCv36 mm8 Celera 9 107,592,634 - 107,594,327 (-) NCBI Celera Cytogenetic Map 9 F1 NCBI cM Map 9 59.07 NCBI
Inka1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955532 1,695,956 - 1,697,485 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955532 1,695,956 - 1,697,521 (+) NCBI ChiLan1.0 ChiLan1.0
INKA1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 2 49,789,227 - 49,791,262 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 3 49,793,983 - 49,796,037 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 3 49,734,616 - 49,736,838 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 3 50,971,208 - 50,973,030 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 3 50,971,394 - 50,972,993 (+) Ensembl panpan1.1 panPan2
INKA1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 20 39,469,103 - 39,477,169 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 20 39,469,146 - 39,470,857 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 20 39,389,947 - 39,398,662 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 20 39,825,978 - 39,834,536 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 20 39,826,021 - 39,827,732 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 20 39,193,011 - 39,201,745 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 20 39,597,246 - 39,605,713 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 20 39,876,813 - 39,885,535 (-) NCBI UU_Cfam_GSD_1.0
Inka1 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405602 64,649,269 - 64,651,526 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936529 1,410,201 - 1,412,023 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936529 1,410,244 - 1,412,023 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
INKA1
INKA1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 22 11,206,066 - 11,208,653 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 22 11,206,914 - 11,209,867 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666041 155,789,672 - 155,791,446 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Inka1
.
Predicted Target Of
Count of predictions: 23 Count of miRNA genes: 22 Interacting mature miRNAs: 23 Transcripts: ENSRNOT00000026216 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
2303171 Bp331 Blood pressure QTL 331 5.57 0.005 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 8 61290298 119084929 Rat 1549909 Stresp11 Stress response QTL 11 6.83 0.0019 stress-related behavior trait (VT:0010451) number of approaches toward negative stimulus before onset of defensive burying response (CMO:0001960) 8 73473045 118473045 Rat 631210 Bw3 Body weight QTL3 5.9 mesenteric fat pad mass (VT:0010427) mesenteric fat pad weight to body weight ratio (CMO:0000654) 8 69349194 112783834 Rat 1358903 Bp252 Blood pressure QTL 252 7 0.0001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 8 93965141 123900184 Rat 1554321 Bmd3 Bone mineral density QTL 3 7.9 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 8 40952565 123900184 Rat 9590292 Uminl3 Urine mineral level QTL 3 3.62 0.001 urine mineral amount (VT:0015086) urine electrolyte level (CMO:0000593) 8 71888757 116888757 Rat 8694446 Bw170 Body weight QTL 170 12.07 0.001 retroperitoneal fat pad mass (VT:0010430) retroperitoneal fat pad weight to body weight ratio (CMO:0000635) 8 71888757 116888757 Rat 631650 Stl6 Serum triglyceride level QTL 6 4 0.0019 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 8 10378157 112202585 Rat 631653 Bp125 Blood pressure QTL 125 3.3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 8 66142385 111142385 Rat 1581557 Eae16 Experimental allergic encephalomyelitis QTL 16 3.8 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046) 8 8462195 110921472 Rat 738011 Anxrr9 Anxiety related response QTL 9 6.1 exploratory behavior trait (VT:0010471) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 8 93535351 123900184 Rat 724539 Cm19 Cardiac mass QTL 19 2.6 heart mass (VT:0007028) calculated heart weight (CMO:0000073) 8 100149864 120994388 Rat 70197 BpQTLcluster8 Blood pressure QTL cluster 8 3.482 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 8 46531639 119088626 Rat 738014 Anxrr15 Anxiety related response QTL 15 3.6 0.005 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 8 95718998 123900184 Rat 2300182 Bmd56 Bone mineral density QTL 56 5.4 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 8 95718998 123900184 Rat 2300181 Bmd55 Bone mineral density QTL 55 5.7 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 8 76468691 121468691 Rat 1300171 Bp184 Blood pressure QTL 184 3.66 arterial blood pressure trait (VT:2000000) blood pressure time series experimental set point of the baroreceptor response (CMO:0002593) 8 70513503 118219066 Rat 631217 Activ1 Activity QTL 1 15.9 voluntary movement trait (VT:0003491) number of photobeam interruptions in an experimental apparatus (CMO:0001517) 8 102370617 108923645 Rat 1358893 Bp263 Blood pressure QTL 263 5.01 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 8 93965141 123900184 Rat 2313400 Anxrr25 Anxiety related response QTL 25 aggression-related behavior trait (VT:0015014) tameness/aggressiveness composite score (CMO:0002136) 8 89265192 114019816 Rat 8694200 Abfw4 Abdominal fat weight QTL 4 9.07 0.001 visceral adipose mass (VT:0010063) abdominal fat pad weight to body weight ratio (CMO:0000095) 8 71888757 116888757 Rat 8694392 Bw161 Body weight QTL 161 8.06 0.001 body lean mass (VT:0010483) lean tissue morphological measurement (CMO:0002184) 8 71888757 116888757 Rat 61437 Cia6 Collagen induced arthritis QTL 6 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 8 82460758 122812818 Rat
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
79
78
49
23
49
6
206
95
93
45
59
29
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000026216 ⟹ ENSRNOP00000026216
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 8 108,674,263 - 108,675,953 (-) Ensembl Rnor_6.0 Ensembl 8 116,763,001 - 116,764,780 (-) Ensembl
RefSeq Acc Id:
NM_001108187 ⟹ NP_001101657
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 117,552,875 - 117,554,565 (-) NCBI mRatBN7.2 8 108,674,263 - 108,675,953 (-) NCBI Rnor_6.0 8 116,763,149 - 116,764,839 (-) NCBI Rnor_5.0 8 116,117,472 - 116,119,162 (-) NCBI RGSC_v3.4 8 113,253,800 - 113,255,490 (-) RGD Celera 8 107,978,903 - 107,980,593 (-) RGD
Sequence:
TGTTGGGGCGGCAGCGGCCGGAGCTACTGAGGGAGTAAGGAGCCTTGGAGTAAGGCAAGGGTGAGGACGCCACTAGCGGGCCGACTCGGCCCACTCTGCGCCGCTCCCGCGGGTGATCGGCGGTGAGC
hide sequence
RefSeq Acc Id:
NP_001101657 ⟸ NM_001108187
- UniProtKB:
D4AA62 (UniProtKB/TrEMBL), A6I321 (UniProtKB/TrEMBL)
- Sequence:
MHSARLDSFLSQLRWELLCARDTASPPMPGPLQPKPKTDQNIQPKRRFRASDVLEEDSVCCVEEEEEEGLVAEDRGAPLGCPREHALDWDSGFSEVSGSTWREEELSVPRRQAPPERPPHSQRFSVSD
hide sequence
Ensembl Acc Id:
ENSRNOP00000026216 ⟸ ENSRNOT00000026216
RGD ID: 13696286 Promoter ID: EPDNEW_R6811 Type: single initiation site Name: Fam212a_1 Description: family with sequence similarity 212, member A SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 8 116,764,842 - 116,764,902 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2018-04-30
Inka1
inka box actin regulator 1
Fam212a
family with sequence similarity 212, member A
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2011-12-06
Fam212a
family with sequence similarity 212, member A
Fam212a
family with sequence similarity 212, member A
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2011-12-06
Fam212a
family with sequence similarity 212, member A
RGD1560778
similar to RIKEN cDNA 6530418L21
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-04-30
RGD1560778
similar to RIKEN cDNA 6530418L21
RGD1560778_predicted
similar to RIKEN cDNA 6530418L21 (predicted)
'predicted' is removed
2292626 APPROVED
2006-03-07
RGD1560778_predicted
similar to RIKEN cDNA 6530418L21 (predicted)
LOC316001
similar to RIKEN cDNA 6530418L21
Symbol and Name status set to approved
1299863 APPROVED
2006-02-09
LOC316001
similar to RIKEN cDNA 6530418L21
Symbol and Name status set to provisional
70820 PROVISIONAL
