Symbol:
Tm9sf2
Name:
transmembrane 9 superfamily member 2
RGD ID:
1359230
Description:
Predicted to be involved in protein localization to membrane; regulation of heparan sulfate proteoglycan biosynthetic process; and sphingolipid metabolic process. Predicted to be located in Golgi apparatus. Predicted to be active in membrane. Orthologous to human TM9SF2 (transmembrane 9 superfamily member 2); INTERACTS WITH 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine; 2,6-dinitrotoluene.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
MGC93724
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 15 105,606,082 - 105,660,715 (+) NCBI GRCr8 mRatBN7.2 15 99,201,556 - 99,254,054 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 15 99,201,489 - 99,254,049 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 15 103,134,961 - 103,187,448 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 15 104,227,449 - 104,279,876 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 15 101,154,683 - 101,207,116 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 15 108,526,341 - 108,579,268 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 15 108,526,014 - 108,579,256 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 15 111,911,685 - 111,967,206 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 15 107,228,796 - 107,281,296 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 15 107,244,575 - 107,297,076 (+) NCBI Celera 15 97,974,851 - 98,027,262 (+) NCBI Celera Cytogenetic Map 15 q25 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Tm9sf2 Rat 1,2-dimethylhydrazine decreases expression ISO Tm9sf2 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of TM9SF2 mRNA CTD PMID:22206623 Tm9sf2 Rat 1,2-dimethylhydrazine multiple interactions ISO Tm9sf2 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of TM9SF2 mRNA CTD PMID:22206623 Tm9sf2 Rat 17alpha-ethynylestradiol affects expression ISO Tm9sf2 (Mus musculus) 6480464 Ethinyl Estradiol affects the expression of TM9SF2 mRNA CTD PMID:17555576 Tm9sf2 Rat 17beta-estradiol increases expression EXP 6480464 Estradiol results in increased expression of TM9SF2 protein CTD PMID:32145629 Tm9sf2 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Tm9sf2 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of TM9SF2 mRNA CTD PMID:19465110 Tm9sf2 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of TM9SF2 mRNA CTD PMID:33387578 Tm9sf2 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Tm9sf2 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of TM9SF2 mRNA CTD PMID:21570461 and PMID:24680724 Tm9sf2 Rat 2,6-dinitrotoluene affects expression EXP 6480464 2 and 6-dinitrotoluene affects the expression of TM9SF2 mRNA CTD PMID:21346803 Tm9sf2 Rat 2-bromohexadecanoic acid multiple interactions ISO TM9SF2 (Homo sapiens) 6480464 2-bromopalmitate inhibits the reaction [[Cadmium Chloride results in increased abundance of Cadmium] which results in increased palmitoylation of TM9SF2 protein] CTD PMID:38195004 Tm9sf2 Rat 3,3',4,4'-tetrachlorobiphenyl multiple interactions ISO Tm9sf2 (Mus musculus) 6480464 3 more ... CTD PMID:19467301 Tm9sf2 Rat 4,4'-diaminodiphenylmethane increases expression ISO Tm9sf2 (Mus musculus) 6480464 4 and 4'-diaminodiphenylmethane results in increased expression of TM9SF2 mRNA CTD PMID:18648102 Tm9sf2 Rat 4,4'-sulfonyldiphenol decreases expression ISO Tm9sf2 (Mus musculus) 6480464 bisphenol S results in decreased expression of TM9SF2 mRNA CTD PMID:39298647 Tm9sf2 Rat 4-hydroxyphenyl retinamide decreases expression ISO Tm9sf2 (Mus musculus) 6480464 Fenretinide results in decreased expression of TM9SF2 mRNA CTD PMID:28973697 Tm9sf2 Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of TM9SF2 mRNA CTD PMID:30047161 Tm9sf2 Rat aconitine decreases expression EXP 6480464 Aconitine results in decreased expression of TM9SF2 protein CTD PMID:33236894 Tm9sf2 Rat aflatoxin B1 decreases expression ISO Tm9sf2 (Mus musculus) 6480464 Aflatoxin B1 results in decreased expression of TM9SF2 mRNA CTD PMID:19770486 Tm9sf2 Rat amitrole increases expression EXP 6480464 Amitrole results in increased expression of TM9SF2 mRNA CTD PMID:30047161 Tm9sf2 Rat ampicillin multiple interactions EXP 6480464 [Ampicillin co-treated with Neomycin co-treated with Gentamicins co-treated with Metronidazole co-treated with Vancomycin] results in increased expression of TM9SF2 protein CTD PMID:30545405 Tm9sf2 Rat aristolochic acid A decreases expression ISO TM9SF2 (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of TM9SF2 mRNA CTD PMID:33212167 Tm9sf2 Rat Aroclor 1254 decreases expression ISO Tm9sf2 (Mus musculus) 6480464 Chlorodiphenyl (54% Chlorine) results in decreased expression of TM9SF2 mRNA CTD PMID:23650126 Tm9sf2 Rat arsenite(3-) decreases expression ISO Tm9sf2 (Mus musculus) 6480464 arsenite results in decreased expression of TM9SF2 protein CTD PMID:37955338 Tm9sf2 Rat benzo[a]pyrene increases expression ISO Tm9sf2 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of TM9SF2 mRNA CTD PMID:22228805 Tm9sf2 Rat bilirubin IXalpha decreases expression ISO TM9SF2 (Homo sapiens) 6480464 Bilirubin results in decreased expression of TM9SF2 mRNA CTD PMID:20196124 Tm9sf2 Rat bis(2-ethylhexyl) phthalate increases expression ISO Tm9sf2 (Mus musculus) 6480464 Diethylhexyl Phthalate results in increased expression of TM9SF2 mRNA CTD PMID:33754040 Tm9sf2 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of TM9SF2 mRNA CTD PMID:25181051 Tm9sf2 Rat bisphenol A increases expression ISO TM9SF2 (Homo sapiens) 6480464 bisphenol A results in increased expression of TM9SF2 protein CTD PMID:34186270 Tm9sf2 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of TM9SF2 mRNA CTD PMID:34947998 Tm9sf2 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of TM9SF2 protein CTD PMID:32145629 Tm9sf2 Rat bisphenol F increases expression ISO Tm9sf2 (Mus musculus) 6480464 bisphenol F results in increased expression of TM9SF2 mRNA CTD PMID:38685157 Tm9sf2 Rat cadmium atom multiple interactions ISO TM9SF2 (Homo sapiens) 6480464 2-bromopalmitate inhibits the reaction [[Cadmium Chloride results in increased abundance of Cadmium] which results in increased palmitoylation of TM9SF2 protein] and [Cadmium Chloride results in increased abundance of Cadmium] which results in increased palmitoylation of TM9SF2 protein CTD PMID:38195004 Tm9sf2 Rat cadmium dichloride multiple interactions ISO TM9SF2 (Homo sapiens) 6480464 2-bromopalmitate inhibits the reaction [[Cadmium Chloride results in increased abundance of Cadmium] which results in increased palmitoylation of TM9SF2 protein] and [Cadmium Chloride results in increased abundance of Cadmium] which results in increased palmitoylation of TM9SF2 protein CTD PMID:38195004 Tm9sf2 Rat cannabidiol decreases expression ISO TM9SF2 (Homo sapiens) 6480464 Cannabidiol results in decreased expression of TM9SF2 protein CTD PMID:34122009 Tm9sf2 Rat chromium(6+) multiple interactions ISO TM9SF2 (Homo sapiens) 6480464 [zinc chromate results in increased abundance of chromium hexavalent ion] which results in increased expression of TM9SF2 mRNA CTD PMID:38479592 Tm9sf2 Rat clozapine decreases expression ISO TM9SF2 (Homo sapiens) 6480464 Clozapine results in decreased expression of TM9SF2 protein CTD PMID:34122009 Tm9sf2 Rat copper(II) sulfate decreases expression ISO TM9SF2 (Homo sapiens) 6480464 Copper Sulfate results in decreased expression of TM9SF2 mRNA CTD PMID:19549813 Tm9sf2 Rat cyclosporin A decreases expression ISO TM9SF2 (Homo sapiens) 6480464 Cyclosporine results in decreased expression of TM9SF2 mRNA CTD PMID:20106945 Tm9sf2 Rat doxorubicin decreases expression ISO TM9SF2 (Homo sapiens) 6480464 Doxorubicin results in decreased expression of TM9SF2 mRNA CTD PMID:29803840 Tm9sf2 Rat folic acid multiple interactions ISO Tm9sf2 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of TM9SF2 mRNA CTD PMID:22206623 Tm9sf2 Rat gentamycin multiple interactions EXP 6480464 [Ampicillin co-treated with Neomycin co-treated with Gentamicins co-treated with Metronidazole co-treated with Vancomycin] results in increased expression of TM9SF2 protein CTD PMID:30545405 Tm9sf2 Rat gentamycin decreases expression EXP 6480464 Gentamicins results in decreased expression of TM9SF2 mRNA CTD PMID:33387578 Tm9sf2 Rat haloperidol decreases expression ISO TM9SF2 (Homo sapiens) 6480464 Haloperidol results in decreased expression of TM9SF2 protein CTD PMID:34122009 Tm9sf2 Rat ivermectin decreases expression ISO TM9SF2 (Homo sapiens) 6480464 Ivermectin results in decreased expression of TM9SF2 protein CTD PMID:32959892 Tm9sf2 Rat Mesaconitine increases expression EXP 6480464 mesaconitine results in increased expression of TM9SF2 protein CTD PMID:37182599 Tm9sf2 Rat metronidazole multiple interactions EXP 6480464 [Ampicillin co-treated with Neomycin co-treated with Gentamicins co-treated with Metronidazole co-treated with Vancomycin] results in increased expression of TM9SF2 protein CTD PMID:30545405 Tm9sf2 Rat neomycin multiple interactions EXP 6480464 [Ampicillin co-treated with Neomycin co-treated with Gentamicins co-treated with Metronidazole co-treated with Vancomycin] results in increased expression of TM9SF2 protein CTD PMID:30545405 Tm9sf2 Rat paracetamol decreases expression ISO TM9SF2 (Homo sapiens) 6480464 Acetaminophen results in decreased expression of TM9SF2 mRNA CTD PMID:21420995 and PMID:29067470 Tm9sf2 Rat phenobarbital affects expression ISO TM9SF2 (Homo sapiens) 6480464 Phenobarbital affects the expression of TM9SF2 mRNA CTD PMID:19159669 Tm9sf2 Rat phenobarbital affects expression ISO Tm9sf2 (Mus musculus) 6480464 Phenobarbital affects the expression of TM9SF2 mRNA CTD PMID:23091169 Tm9sf2 Rat rotenone increases expression ISO TM9SF2 (Homo sapiens) 6480464 Rotenone results in increased expression of TM9SF2 mRNA CTD PMID:33512557 Tm9sf2 Rat SB 431542 multiple interactions ISO TM9SF2 (Homo sapiens) 6480464 [LDN 193189 co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide co-treated with FGF2 protein] results in decreased expression of TM9SF2 protein CTD PMID:37664457 Tm9sf2 Rat silicon dioxide decreases expression ISO Tm9sf2 (Mus musculus) 6480464 Silicon Dioxide results in decreased expression of TM9SF2 mRNA CTD PMID:19073995 Tm9sf2 Rat sodium arsenite increases expression ISO Tm9sf2 (Mus musculus) 6480464 sodium arsenite results in increased expression of TM9SF2 protein CTD PMID:29044176 Tm9sf2 Rat sodium arsenite increases expression ISO TM9SF2 (Homo sapiens) 6480464 sodium arsenite results in increased expression of TM9SF2 mRNA CTD PMID:38568856 Tm9sf2 Rat sodium fluoride decreases expression ISO Tm9sf2 (Mus musculus) 6480464 Sodium Fluoride results in decreased expression of TM9SF2 protein CTD PMID:28918527 Tm9sf2 Rat sulfadimethoxine increases expression EXP 6480464 Sulfadimethoxine results in increased expression of TM9SF2 mRNA CTD PMID:30047161 Tm9sf2 Rat tamoxifen affects expression ISO Tm9sf2 (Mus musculus) 6480464 Tamoxifen affects the expression of TM9SF2 mRNA CTD PMID:17555576 Tm9sf2 Rat temozolomide decreases expression ISO TM9SF2 (Homo sapiens) 6480464 Temozolomide results in decreased expression of TM9SF2 mRNA CTD PMID:31758290 Tm9sf2 Rat tert-butyl hydroperoxide decreases expression ISO TM9SF2 (Homo sapiens) 6480464 tert-Butylhydroperoxide results in decreased expression of TM9SF2 mRNA CTD PMID:15336504 Tm9sf2 Rat tetrachloromethane increases expression ISO Tm9sf2 (Mus musculus) 6480464 Carbon Tetrachloride results in increased expression of TM9SF2 mRNA CTD PMID:31919559 Tm9sf2 Rat thapsigargin increases expression ISO TM9SF2 (Homo sapiens) 6480464 Thapsigargin results in increased expression of TM9SF2 mRNA CTD PMID:22378314 Tm9sf2 Rat titanium dioxide decreases methylation ISO Tm9sf2 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of TM9SF2 gene CTD PMID:35295148 Tm9sf2 Rat triphenyl phosphate affects expression ISO TM9SF2 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of TM9SF2 mRNA CTD PMID:37042841 Tm9sf2 Rat tungsten increases expression ISO Tm9sf2 (Mus musculus) 6480464 Tungsten results in increased expression of TM9SF2 mRNA CTD PMID:30912803 Tm9sf2 Rat valproic acid increases expression ISO TM9SF2 (Homo sapiens) 6480464 Valproic Acid results in increased expression of TM9SF2 mRNA CTD PMID:23179753 Tm9sf2 Rat vancomycin multiple interactions EXP 6480464 [Ampicillin co-treated with Neomycin co-treated with Gentamicins co-treated with Metronidazole co-treated with Vancomycin] results in increased expression of TM9SF2 protein CTD PMID:30545405 Tm9sf2 Rat vinclozolin decreases expression EXP 6480464 vinclozolin results in decreased expression of TM9SF2 mRNA CTD PMID:23034163
1,2-dimethylhydrazine (ISO) 17alpha-ethynylestradiol (ISO) 17beta-estradiol (EXP) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,6-dinitrotoluene (EXP) 2-bromohexadecanoic acid (ISO) 3,3',4,4'-tetrachlorobiphenyl (ISO) 4,4'-diaminodiphenylmethane (ISO) 4,4'-sulfonyldiphenol (ISO) 4-hydroxyphenyl retinamide (ISO) 6-propyl-2-thiouracil (EXP) aconitine (EXP) aflatoxin B1 (ISO) amitrole (EXP) ampicillin (EXP) aristolochic acid A (ISO) Aroclor 1254 (ISO) arsenite(3-) (ISO) benzo[a]pyrene (ISO) bilirubin IXalpha (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol F (ISO) cadmium atom (ISO) cadmium dichloride (ISO) cannabidiol (ISO) chromium(6+) (ISO) clozapine (ISO) copper(II) sulfate (ISO) cyclosporin A (ISO) doxorubicin (ISO) folic acid (ISO) gentamycin (EXP) haloperidol (ISO) ivermectin (ISO) Mesaconitine (EXP) metronidazole (EXP) neomycin (EXP) paracetamol (ISO) phenobarbital (ISO) rotenone (ISO) SB 431542 (ISO) silicon dioxide (ISO) sodium arsenite (ISO) sodium fluoride (ISO) sulfadimethoxine (EXP) tamoxifen (ISO) temozolomide (ISO) tert-butyl hydroperoxide (ISO) tetrachloromethane (ISO) thapsigargin (ISO) titanium dioxide (ISO) triphenyl phosphate (ISO) tungsten (ISO) valproic acid (ISO) vancomycin (EXP) vinclozolin (EXP)
Tm9sf2 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 15 105,606,082 - 105,660,715 (+) NCBI GRCr8 mRatBN7.2 15 99,201,556 - 99,254,054 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 15 99,201,489 - 99,254,049 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 15 103,134,961 - 103,187,448 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 15 104,227,449 - 104,279,876 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 15 101,154,683 - 101,207,116 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 15 108,526,341 - 108,579,268 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 15 108,526,014 - 108,579,256 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 15 111,911,685 - 111,967,206 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 15 107,228,796 - 107,281,296 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 15 107,244,575 - 107,297,076 (+) NCBI Celera 15 97,974,851 - 98,027,262 (+) NCBI Celera Cytogenetic Map 15 q25 NCBI
TM9SF2 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 13 99,501,472 - 99,564,048 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 13 99,446,311 - 99,564,048 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 13 100,153,726 - 100,216,302 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 13 98,951,729 - 99,013,279 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 13 98,951,728 - 99,013,277 NCBI Celera 13 80,998,257 - 81,059,812 (+) NCBI Celera Cytogenetic Map 13 q32.3 NCBI HuRef 13 80,748,449 - 80,811,058 (+) NCBI HuRef CHM1_1 13 100,123,519 - 100,186,222 (+) NCBI CHM1_1 T2T-CHM13v2.0 13 98,712,365 - 98,774,941 (+) NCBI T2T-CHM13v2.0
Tm9sf2 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 14 122,342,290 - 122,397,015 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 14 122,344,450 - 122,397,016 (+) Ensembl GRCm39 Ensembl GRCm38 14 122,107,082 - 122,159,603 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 14 122,107,038 - 122,159,604 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 14 122,506,304 - 122,558,825 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 14 121,242,262 - 121,294,783 (+) NCBI MGSCv36 mm8 Celera 14 120,669,650 - 120,722,278 (+) NCBI Celera Cytogenetic Map 14 E5 NCBI cM Map 14 65.86 NCBI
Tm9sf2 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955404 11,069,843 - 11,129,056 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955404 11,071,716 - 11,128,758 (-) NCBI ChiLan1.0 ChiLan1.0
TM9SF2 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 14 101,025,667 - 101,088,026 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 13 99,695,871 - 99,758,225 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 13 80,669,277 - 80,731,340 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 13 99,806,942 - 99,869,456 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 13 99,807,555 - 99,869,456 (+) Ensembl panpan1.1 panPan2
TM9SF2 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 22 49,515,350 - 49,578,519 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 22 49,515,382 - 49,577,905 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 22 49,296,268 - 49,359,483 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 22 49,957,024 - 50,020,235 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 22 49,957,036 - 50,020,235 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 22 49,607,692 - 49,671,749 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 22 49,642,267 - 49,704,740 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 22 49,678,708 - 49,741,653 (+) NCBI UU_Cfam_GSD_1.0
Tm9sf2 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404945 184,945,849 - 185,005,895 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936472 10,945,906 - 11,006,324 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936472 10,946,263 - 11,006,311 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
TM9SF2 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 11 68,404,975 - 68,469,953 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 11 68,407,834 - 68,469,956 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 11 75,772,893 - 75,775,385 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
TM9SF2 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 3 78,143,850 - 78,217,461 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 3 78,144,078 - 78,216,828 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666046 34,638,569 - 34,713,435 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Tm9sf2
.
Predicted Target Of
Count of predictions: 214 Count of miRNA genes: 149 Interacting mature miRNAs: 167 Transcripts: ENSRNOT00000017211 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
731177 Uae26 Urinary albumin excretion QTL 26 2.4 0.025 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 15 67588667 101769107 Rat 1549844 Bss7 Bone structure and strength QTL 7 6.4 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 15 75788062 101769107 Rat 2300326 Plaw1 Placental weight QTL 1 15 0.005 placenta mass (VT:0004257) placenta wet weight (CMO:0002088) 15 68327165 100062518 Rat 1641889 Colcr6 Colorectal carcinoma resistance QTL 6 2.9 0.0126 intestine integrity trait (VT:0010554) benign colorectal tumor surface area measurement (CMO:0001799) 15 73690518 99794247 Rat 70155 Gcs1 Gastric cancer susceptibility QTL1 3.8 stomach morphology trait (VT:0000470) stomach tumor susceptibility score (CMO:0002043) 15 76306099 101769107 Rat 2317055 Aia10 Adjuvant induced arthritis QTL 10 3.41 joint integrity trait (VT:0010548) left rear ankle joint diameter (CMO:0002149) 15 75788062 101769107 Rat 631655 Bp126 Blood pressure QTL 126 4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 15 58156477 101769107 Rat
RH142372
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 15 99,253,734 - 99,253,892 (+) MAPPER mRatBN7.2 Rnor_6.0 15 108,578,949 - 108,579,106 NCBI Rnor6.0 Rnor_5.0 15 111,966,887 - 111,967,044 UniSTS Rnor5.0 RGSC_v3.4 15 107,280,977 - 107,281,134 UniSTS RGSC3.4 Celera 15 98,026,943 - 98,027,100 UniSTS RH 3.4 Map 15 708.6 UniSTS Cytogenetic Map 15 q25 UniSTS
BE120307
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 15 99,254,050 - 99,254,210 (+) MAPPER mRatBN7.2 Rnor_6.0 15 108,579,265 - 108,579,424 NCBI Rnor6.0 Rnor_5.0 15 111,967,203 - 111,967,362 UniSTS Rnor5.0 RGSC_v3.4 15 107,281,293 - 107,281,452 UniSTS RGSC3.4 Celera 15 98,027,259 - 98,027,418 UniSTS RH 3.4 Map 15 710.3 UniSTS Cytogenetic Map 15 q25 UniSTS
RH124295
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 15 99,245,496 - 99,245,591 (+) MAPPER mRatBN7.2 Rnor_6.0 15 108,570,368 - 108,570,462 NCBI Rnor6.0 Rnor_5.0 15 111,958,306 - 111,958,400 UniSTS Rnor5.0 RGSC_v3.4 15 107,272,740 - 107,272,834 UniSTS RGSC3.4 Celera 15 98,018,706 - 98,018,800 UniSTS Cytogenetic Map 15 q25 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000017211 ⟹ ENSRNOP00000017211
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 15 99,201,496 - 99,254,049 (+) Ensembl Rnor_6.0 Ensembl 15 108,526,014 - 108,579,256 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000113532 ⟹ ENSRNOP00000086158
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 15 99,201,489 - 99,254,049 (+) Ensembl
RefSeq Acc Id:
NM_001005554 ⟹ NP_001005554
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 15 105,608,208 - 105,660,715 (+) NCBI mRatBN7.2 15 99,201,556 - 99,254,054 (+) NCBI Rnor_6.0 15 108,526,341 - 108,579,268 (+) NCBI Rnor_5.0 15 111,911,685 - 111,967,206 (+) NCBI RGSC_v3.4 15 107,228,796 - 107,281,296 (+) RGD Celera 15 97,974,851 - 98,027,262 (+) RGD
Sequence:
CTTCGGTTTCTGTCGCGGGGCCGGTGGTGTCTCCTAGCGTAACCGGAACTAGCCGTTGCGGGCCGGCCTTCTCTGCGCTCGGGCCTTGAGGTGATCTCCGAGGCCCCCGCCCCTCCTCCCTCGTCGTC
hide sequence
RefSeq Acc Id:
XM_063274359 ⟹ XP_063130429
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 15 105,606,082 - 105,660,714 (+) NCBI
RefSeq Acc Id:
XM_063274360 ⟹ XP_063130430
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 15 105,606,104 - 105,660,714 (+) NCBI
RefSeq Acc Id:
NP_001005554 ⟸ NM_001005554
- Peptide Label:
precursor
- UniProtKB:
Q66HG5 (UniProtKB/Swiss-Prot)
- Sequence:
MSSRPPASLPARGPRLLLLSLLLLGTVPGPRPGSAFYLPGLAPVNFCTEEKKSNECKAEIELFVNRLDSVESVLPYEYTAFDFCQASEGKRPSENLGQVLFGERIEPSPYKFTFNKEETCKLVCTKTY
hide sequence
Ensembl Acc Id:
ENSRNOP00000017211 ⟸ ENSRNOT00000017211
Ensembl Acc Id:
ENSRNOP00000086158 ⟸ ENSRNOT00000113532
RefSeq Acc Id:
XP_063130429 ⟸ XM_063274359
- Peptide Label:
isoform X1
- UniProtKB:
Q66HG5 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_063130430 ⟸ XM_063274360
- Peptide Label:
isoform X1
- UniProtKB:
Q66HG5 (UniProtKB/Swiss-Prot)
RGD ID: 13699882 Promoter ID: EPDNEW_R10406 Type: initiation region Name: Tm9sf2_1 Description: transmembrane 9 superfamily member 2 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 15 108,526,376 - 108,526,436 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2006-03-30
Tm9sf2
transmembrane 9 superfamily member 2
Symbol and Name status set to approved
1299863 APPROVED
2005-07-29
Tm9sf2
transmembrane 9 superfamily member 2
Symbol and Name status set to provisional
70820 PROVISIONAL
