Symbol:
Ppm1j
Name:
protein phosphatase, Mg2+/Mn2+ dependent, 1J
RGD ID:
1359104
Description:
Predicted to enable [pyruvate dehydrogenase (acetyl-transferring)]-phosphatase activity. Predicted to be involved in signal transduction. Predicted to act upstream of or within protein dephosphorylation. Predicted to be active in mitochondrion. Orthologous to human PPM1J (protein phosphatase, Mg2+/Mn2+ dependent 1J); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 6-propyl-2-thiouracil; aflatoxin B1.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
MGC95205; PP2C-zeta; protein phosphatase 1J; protein phosphatase 2a, catalytic subunit, zeta isoform; protein phosphatase 2C isoform zeta; protein phosphatase 2C zeta
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
PPM1J (protein phosphatase, Mg2+/Mn2+ dependent 1J) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Ppm1j (protein phosphatase 1J) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Ppm1j (protein phosphatase, Mg2+/Mn2+ dependent 1J) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
PPM1J (protein phosphatase, Mg2+/Mn2+ dependent 1J) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
PPM1J (protein phosphatase, Mg2+/Mn2+ dependent 1J) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Ppm1j (protein phosphatase, Mg2+/Mn2+ dependent 1J) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
PPM1J (protein phosphatase, Mg2+/Mn2+ dependent 1J) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
PPM1J (protein phosphatase, Mg2+/Mn2+ dependent 1J) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Ppm1j (protein phosphatase, Mg2+/Mn2+ dependent 1J) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Mus musculus (house mouse):
Ppm1j (protein phosphatase 1J)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
PPM1J (protein phosphatase, Mg2+/Mn2+ dependent 1J)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
ppm1j (protein phosphatase, Mg2+/Mn2+ dependent, 1J)
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER|PhylomeDB)
Drosophila melanogaster (fruit fly):
CG17598
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
ppm-1.H
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
ppm1j
Alliance
DIOPT (Ensembl Compara|OMA|PANTHER|PhylomeDB)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 2 194,966,854 - 194,972,228 (+) NCBI GRCr8 mRatBN7.2 2 192,278,597 - 192,283,883 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 2 192,278,517 - 192,283,882 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 2 199,873,234 - 199,878,245 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 2 197,745,513 - 197,750,529 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 2 192,562,458 - 192,567,473 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 2 207,263,307 - 207,268,601 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 2 207,262,934 - 207,268,609 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 2 226,682,751 - 226,687,765 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 2 200,039,684 - 200,044,698 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 2 200,002,437 - 200,007,451 (+) NCBI Celera 2 184,745,409 - 184,750,423 (+) NCBI Celera Cytogenetic Map 2 q34 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Ppm1j Rat 1,2-dimethylhydrazine increases expression ISO Ppm1j (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in increased expression of PPM1J mRNA CTD PMID:22206623 Ppm1j Rat 17alpha-ethynylestradiol increases expression ISO PPM1J (Homo sapiens) 6480464 Ethinyl Estradiol results in increased expression of PPM1J mRNA CTD PMID:18936297 Ppm1j Rat 17beta-estradiol increases expression ISO PPM1J (Homo sapiens) 6480464 Estradiol results in increased expression of PPM1J mRNA CTD PMID:23019147 Ppm1j Rat 2,2',4,4',5,5'-hexachlorobiphenyl multiple interactions ISO Ppm1j (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Ppm1j Rat 2,2',5,5'-tetrachlorobiphenyl multiple interactions ISO Ppm1j (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Ppm1j Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Ppm1j (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of PPM1J mRNA CTD PMID:21570461 Ppm1j Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of PPM1J mRNA CTD PMID:34747641 Ppm1j Rat 4,4'-sulfonyldiphenol increases expression ISO Ppm1j (Mus musculus) 6480464 bisphenol S results in increased expression of PPM1J mRNA CTD PMID:30951980 Ppm1j Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of PPM1J mRNA CTD PMID:30047161 Ppm1j Rat aflatoxin B1 increases expression ISO PPM1J (Homo sapiens) 6480464 Aflatoxin B1 results in increased expression of PPM1J mRNA CTD PMID:22100608 Ppm1j Rat aflatoxin B1 decreases methylation ISO PPM1J (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of PPM1J gene CTD PMID:27153756 Ppm1j Rat aflatoxin B1 increases expression EXP 6480464 Aflatoxin B1 results in increased expression of PPM1J mRNA CTD PMID:23630614 and PMID:25378103 Ppm1j Rat alpha-Zearalanol multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of PPM1J mRNA CTD PMID:35163327 Ppm1j Rat alpha-Zearalanol decreases expression EXP 6480464 Zeranol results in decreased expression of PPM1J mRNA CTD PMID:35163327 Ppm1j Rat amitrole decreases expression EXP 6480464 Amitrole results in decreased expression of PPM1J mRNA CTD PMID:30047161 Ppm1j Rat amphetamine increases expression EXP 6480464 Amphetamine results in increased expression of PPM1J mRNA CTD PMID:30779732 Ppm1j Rat benzo[a]pyrene decreases expression EXP 6480464 Benzo(a)pyrene results in decreased expression of PPM1J mRNA CTD PMID:21839799 Ppm1j Rat benzo[a]pyrene increases expression ISO PPM1J (Homo sapiens) 6480464 Benzo(a)pyrene results in increased expression of PPM1J mRNA CTD PMID:32234424 Ppm1j Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of PPM1J mRNA CTD PMID:25181051 Ppm1j Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of PPM1J mRNA CTD PMID:34947998 Ppm1j Rat bisphenol A increases methylation ISO Ppm1j (Mus musculus) 6480464 bisphenol A results in increased methylation of PPM1J promoter CTD PMID:27312807 Ppm1j Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of PPM1J gene CTD PMID:28505145 Ppm1j Rat bisphenol A decreases methylation ISO Ppm1j (Mus musculus) 6480464 bisphenol A results in decreased methylation of PPM1J promoter CTD PMID:27312807 Ppm1j Rat butanal increases expression ISO PPM1J (Homo sapiens) 6480464 butyraldehyde results in increased expression of PPM1J mRNA CTD PMID:26079696 Ppm1j Rat cantharidin decreases expression ISO Ppm1j (Mus musculus) 6480464 Cantharidin results in decreased expression of PPM1J mRNA CTD PMID:36907384 Ppm1j Rat carbamazepine affects expression ISO PPM1J (Homo sapiens) 6480464 Carbamazepine affects the expression of PPM1J mRNA CTD PMID:25979313 Ppm1j Rat carbon nanotube increases expression ISO Ppm1j (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 Ppm1j Rat cefaloridine increases expression EXP 6480464 Cephaloridine results in increased expression of PPM1J mRNA CTD PMID:18500788 Ppm1j Rat chromium(6+) affects expression ISO Ppm1j (Mus musculus) 6480464 chromium hexavalent ion affects the expression of PPM1J mRNA CTD PMID:28472532 Ppm1j Rat cisplatin multiple interactions ISO PPM1J (Homo sapiens) 6480464 [Cisplatin co-treated with jinfukang] results in increased expression of PPM1J mRNA CTD PMID:27392435 Ppm1j Rat cisplatin increases expression ISO PPM1J (Homo sapiens) 6480464 Cisplatin results in increased expression of PPM1J mRNA CTD PMID:27392435 Ppm1j Rat clotrimazole decreases expression EXP 6480464 Clotrimazole results in decreased expression of PPM1J mRNA CTD PMID:30047161 Ppm1j Rat Cuprizon increases expression EXP 6480464 Cuprizone results in increased expression of PPM1J mRNA CTD PMID:27523638 Ppm1j Rat DDE decreases expression ISO PPM1J (Homo sapiens) 6480464 Dichlorodiphenyl Dichloroethylene results in decreased expression of PPM1J mRNA CTD PMID:38568856 Ppm1j Rat diazinon increases methylation ISO PPM1J (Homo sapiens) 6480464 Diazinon results in increased methylation of PPM1J gene CTD PMID:22964155 Ppm1j Rat Dibutyl phosphate affects expression ISO PPM1J (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of PPM1J mRNA CTD PMID:37042841 Ppm1j Rat dorsomorphin multiple interactions ISO PPM1J (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Ppm1j Rat elemental selenium increases expression ISO PPM1J (Homo sapiens) 6480464 Selenium results in increased expression of PPM1J mRNA CTD PMID:19244175 Ppm1j Rat entinostat increases expression ISO PPM1J (Homo sapiens) 6480464 entinostat results in increased expression of PPM1J mRNA CTD PMID:26272509 Ppm1j Rat entinostat multiple interactions ISO PPM1J (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of PPM1J mRNA CTD PMID:27188386 Ppm1j Rat FR900359 increases phosphorylation ISO PPM1J (Homo sapiens) 6480464 FR900359 results in increased phosphorylation of PPM1J protein CTD PMID:37730182 Ppm1j Rat furan increases expression EXP 6480464 furan results in increased expression of PPM1J mRNA CTD PMID:25539665 Ppm1j Rat genistein increases expression ISO PPM1J (Homo sapiens) 6480464 Genistein results in increased expression of PPM1J mRNA CTD PMID:23019147 Ppm1j Rat isoprenaline decreases expression ISO Ppm1j (Mus musculus) 6480464 Isoproterenol results in decreased expression of PPM1J mRNA CTD PMID:20003209 Ppm1j Rat lead(0) affects expression ISO PPM1J (Homo sapiens) 6480464 Lead affects the expression of PPM1J mRNA CTD PMID:28903495 Ppm1j Rat monocrotaline multiple interactions ISO PPM1J (Homo sapiens) 6480464 [CYP3A4 protein results in increased metabolism of Monocrotaline] which results in decreased expression of PPM1J mRNA CTD PMID:33884520 Ppm1j Rat N-methyl-4-phenylpyridinium increases expression EXP 6480464 1-Methyl-4-phenylpyridinium results in increased expression of PPM1J mRNA CTD PMID:28801915 Ppm1j Rat O-methyleugenol increases expression ISO PPM1J (Homo sapiens) 6480464 methyleugenol results in increased expression of PPM1J mRNA CTD PMID:32234424 Ppm1j Rat orphenadrine affects expression EXP 6480464 Orphenadrine affects the expression of PPM1J mRNA CTD PMID:23665939 Ppm1j Rat panobinostat multiple interactions ISO PPM1J (Homo sapiens) 6480464 [NOG protein co-treated with Panobinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of PPM1J mRNA CTD PMID:27188386 Ppm1j Rat panobinostat increases expression ISO PPM1J (Homo sapiens) 6480464 panobinostat results in increased expression of PPM1J mRNA CTD PMID:26272509 Ppm1j Rat paracetamol increases expression ISO PPM1J (Homo sapiens) 6480464 Acetaminophen results in increased expression of PPM1J mRNA CTD PMID:29067470 Ppm1j Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of PPM1J mRNA CTD PMID:33387578 Ppm1j Rat paraquat increases expression EXP 6480464 Paraquat results in increased expression of PPM1J mRNA CTD PMID:32680482 Ppm1j Rat PCB138 multiple interactions ISO Ppm1j (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Ppm1j Rat pentanal increases expression ISO PPM1J (Homo sapiens) 6480464 pentanal results in increased expression of PPM1J mRNA CTD PMID:26079696 Ppm1j Rat perfluorooctanoic acid multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of PPM1J mRNA CTD PMID:35163327 Ppm1j Rat pravastatin decreases expression EXP 6480464 Pravastatin results in decreased expression of PPM1J mRNA CTD PMID:27225895 Ppm1j Rat pravastatin increases expression ISO Ppm1j (Mus musculus) 6480464 Pravastatin results in increased expression of PPM1J mRNA CTD PMID:27225895 Ppm1j Rat propanal increases expression ISO PPM1J (Homo sapiens) 6480464 propionaldehyde results in increased expression of PPM1J mRNA CTD PMID:26079696 Ppm1j Rat SB 431542 multiple interactions ISO PPM1J (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Ppm1j Rat selenium atom increases expression ISO PPM1J (Homo sapiens) 6480464 Selenium results in increased expression of PPM1J mRNA CTD PMID:19244175 Ppm1j Rat silicon dioxide increases expression ISO Ppm1j (Mus musculus) 6480464 Silicon Dioxide results in increased expression of PPM1J mRNA CTD PMID:29341224 Ppm1j Rat sulfadimethoxine decreases expression EXP 6480464 Sulfadimethoxine results in decreased expression of PPM1J mRNA CTD PMID:30047161 Ppm1j Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of PPM1J mRNA CTD PMID:34492290 Ppm1j Rat titanium dioxide increases methylation ISO Ppm1j (Mus musculus) 6480464 titanium dioxide results in increased methylation of PPM1J gene CTD PMID:35295148 Ppm1j Rat titanium dioxide decreases methylation ISO Ppm1j (Mus musculus) 6480464 titanium dioxide results in decreased methylation of PPM1J gene and titanium dioxide results in decreased methylation of PPM1J promoter alternative form CTD PMID:35295148 Ppm1j Rat trichostatin A affects expression ISO PPM1J (Homo sapiens) 6480464 trichostatin A affects the expression of PPM1J mRNA CTD PMID:28542535 Ppm1j Rat triclosan decreases expression ISO PPM1J (Homo sapiens) 6480464 Triclosan results in decreased expression of PPM1J mRNA CTD PMID:30510588 Ppm1j Rat valproic acid increases expression ISO Ppm1j (Mus musculus) 6480464 Valproic Acid results in increased expression of PPM1J mRNA CTD PMID:21427059 Ppm1j Rat valproic acid affects expression ISO PPM1J (Homo sapiens) 6480464 Valproic Acid affects the expression of PPM1J mRNA CTD PMID:25979313 Ppm1j Rat valproic acid increases expression ISO PPM1J (Homo sapiens) 6480464 Valproic Acid results in increased expression of PPM1J mRNA CTD PMID:19101580 more ... Ppm1j Rat valproic acid multiple interactions ISO PPM1J (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of PPM1J mRNA CTD PMID:27188386 Ppm1j Rat vitamin E increases expression ISO PPM1J (Homo sapiens) 6480464 Vitamin E results in increased expression of PPM1J mRNA CTD PMID:19244175
1,2-dimethylhydrazine (ISO) 17alpha-ethynylestradiol (ISO) 17beta-estradiol (ISO) 2,2',4,4',5,5'-hexachlorobiphenyl (ISO) 2,2',5,5'-tetrachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 4,4'-sulfonyldiphenol (ISO) 6-propyl-2-thiouracil (EXP) aflatoxin B1 (EXP,ISO) alpha-Zearalanol (EXP) amitrole (EXP) amphetamine (EXP) benzo[a]pyrene (EXP,ISO) bisphenol A (EXP,ISO) butanal (ISO) cantharidin (ISO) carbamazepine (ISO) carbon nanotube (ISO) cefaloridine (EXP) chromium(6+) (ISO) cisplatin (ISO) clotrimazole (EXP) Cuprizon (EXP) DDE (ISO) diazinon (ISO) Dibutyl phosphate (ISO) dorsomorphin (ISO) elemental selenium (ISO) entinostat (ISO) FR900359 (ISO) furan (EXP) genistein (ISO) isoprenaline (ISO) lead(0) (ISO) monocrotaline (ISO) N-methyl-4-phenylpyridinium (EXP) O-methyleugenol (ISO) orphenadrine (EXP) panobinostat (ISO) paracetamol (EXP,ISO) paraquat (EXP) PCB138 (ISO) pentanal (ISO) perfluorooctanoic acid (EXP) pravastatin (EXP,ISO) propanal (ISO) SB 431542 (ISO) selenium atom (ISO) silicon dioxide (ISO) sulfadimethoxine (EXP) thioacetamide (EXP) titanium dioxide (ISO) trichostatin A (ISO) triclosan (ISO) valproic acid (ISO) vitamin E (ISO)
1.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.
A novel protein phosphatase 2C family member (PP2Czeta) is able to associate with ubiquitin conjugating enzyme 9.
Kashiwaba M, etal., FEBS Lett 2003 Mar 13;538(1-3):197-202.
3.
Molecular cloning of PP2Ceta, a novel member of the protein phosphatase 2C family.
Komaki K, etal., Biochim Biophys Acta 2003 Nov 30;1630(2-3):130-7.
4.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
5.
GOA pipeline
RGD automated data pipeline
6.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
7.
Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
Ppm1j Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 2 194,966,854 - 194,972,228 (+) NCBI GRCr8 mRatBN7.2 2 192,278,597 - 192,283,883 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 2 192,278,517 - 192,283,882 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 2 199,873,234 - 199,878,245 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 2 197,745,513 - 197,750,529 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 2 192,562,458 - 192,567,473 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 2 207,263,307 - 207,268,601 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 2 207,262,934 - 207,268,609 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 2 226,682,751 - 226,687,765 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 2 200,039,684 - 200,044,698 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 2 200,002,437 - 200,007,451 (+) NCBI Celera 2 184,745,409 - 184,750,423 (+) NCBI Celera Cytogenetic Map 2 q34 NCBI
PPM1J Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 1 112,709,998 - 112,715,332 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 1 112,709,994 - 112,715,332 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 1 113,252,620 - 113,257,954 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 1 113,054,139 - 113,059,473 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 1 111,483,060 - 111,488,379 (-) NCBI Celera Cytogenetic Map 1 p13.2 NCBI HuRef 1 111,111,007 - 111,116,341 (-) NCBI HuRef CHM1_1 1 113,367,818 - 113,373,152 (-) NCBI CHM1_1 T2T-CHM13v2.0 1 112,722,547 - 112,727,883 (-) NCBI T2T-CHM13v2.0
Ppm1j Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 3 104,688,322 - 104,693,334 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 3 104,688,372 - 104,693,334 (+) Ensembl GRCm39 Ensembl GRCm38 3 104,780,952 - 104,786,023 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 3 104,781,056 - 104,786,018 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 3 104,583,974 - 104,588,936 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 3 104,909,112 - 104,914,004 (+) NCBI MGSCv36 mm8 Celera 3 106,976,413 - 106,981,377 (+) NCBI Celera Cytogenetic Map 3 F2.2 NCBI cM Map 3 45.85 NCBI
Ppm1j Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955435 16,121,206 - 16,129,296 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955435 16,124,087 - 16,129,296 (-) NCBI ChiLan1.0 ChiLan1.0
PPM1J Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 1 114,321,041 - 114,326,385 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 1 113,469,169 - 113,474,513 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 1 115,362,626 - 115,367,968 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 1 124,984,454 - 124,989,928 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 1 124,984,624 - 124,992,615 (+) Ensembl panpan1.1 panPan2
PPM1J Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 17 62,858,620 - 62,863,869 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 17 62,858,338 - 62,863,884 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 17 62,372,319 - 62,377,558 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 17 64,031,992 - 64,037,231 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 17 64,031,698 - 64,039,294 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 17 62,766,663 - 62,771,901 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 17 62,824,684 - 62,829,917 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 17 63,584,435 - 63,589,674 (+) NCBI UU_Cfam_GSD_1.0
Ppm1j Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405058 16,207,754 - 16,213,782 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936690 1,263,925 - 1,269,764 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936690 1,263,949 - 1,269,707 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
PPM1J Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 4 107,723,437 - 107,728,919 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 4 107,723,427 - 107,728,919 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 4 117,792,201 - 117,797,397 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
PPM1J Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 20 20,924,437 - 20,929,923 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 20 20,924,571 - 20,929,749 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666038 23,741,363 - 23,746,886 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Ppm1j
.
Predicted Target Of
Count of predictions: 80 Count of miRNA genes: 70 Interacting mature miRNAs: 73 Transcripts: ENSRNOT00000016833 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1578648 Bss11 Bone structure and strength QTL 11 4.7 femur morphology trait (VT:0000559) femoral neck cortical cross-sectional area (CMO:0001702) 2 114837527 211674221 Rat 1358356 Srcrt1 Stress Responsive Cort QTL1 3.66 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 2 161699179 222436696 Rat 1331734 Bp204 Blood pressure QTL 204 3.61192 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 168358098 223265385 Rat 1298074 Bp164 Blood pressure QTL 164 0.003 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 42804607 202447032 Rat 1354648 Bp239 Blood pressure QTL 239 0.001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 66118463 226797303 Rat 1354649 Kidm17 Kidney mass QTL 17 2.9 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 2 81754530 227146641 Rat 10755499 Bp389 Blood pressure QTL 389 2.61 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 2 18960362 228801039 Rat 1298076 Bp166 Blood pressure QTL 166 0.0009 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 136445150 202447032 Rat 152025245 Scl81 Serum cholesterol level QTL 81 3.49 blood cholesterol amount (VT:0000180) 2 122609194 206936711 Rat 61458 Bp10 Blood pressure QTL 10 3.42 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 189020722 215287351 Rat 70162 Bp63 Blood pressure QTL 63 5.64 arterial blood pressure trait (VT:2000000) blood pressure measurement (CMO:0000003) 2 169745596 214745596 Rat 1554319 Bmd2 Bone mineral density QTL 2 13.4 0.0001 lumbar vertebra area (VT:0010570) lumbar vertebra cross-sectional area (CMO:0001689) 2 114837675 212549332 Rat 1581569 Uae32 Urinary albumin excretion QTL 32 0.0001 urine protein amount (VT:0005160) urine albumin excretion rate (CMO:0000757) 2 78665619 219826953 Rat 1302793 Bw16 Body weight QTL 16 5 0.0001 body mass (VT:0001259) body weight (CMO:0000012) 2 157142209 202446871 Rat 10043139 Iddm55 Insulin dependent diabetes mellitus QTL 55 3.1 0.0001 blood glucose amount (VT:0000188) age at onset/diagnosis of type 1 diabetes mellitus (CMO:0001140) 2 190602746 192625452 Rat 61467 Bp14 Blood pressure QTL 14 2.2 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 43154682 202446871 Rat 61469 Bp16 Blood pressure QTL 16 5.64 arterial blood pressure trait (VT:2000000) blood pressure measurement (CMO:0000003) 2 169745596 214745596 Rat 70175 BpQTLCluster3 Blood pressure QTL cluster 3 4.128 arterial blood pressure trait (VT:2000000) absolute change in systolic blood pressure (CMO:0000607) 2 135552573 202446871 Rat 1358900 Bw48 Body weight QTL 48 4.88 body mass (VT:0001259) body weight (CMO:0000012) 2 157142078 211086598 Rat 4889834 Pur24 Proteinuria QTL 24 5.8 0.014 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 2 184114274 202447032 Rat 1359031 Bp275 Blood pressure QTL 275 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 2 185876309 219753474 Rat 1581499 Esta2 Estrogen-induced thymic atrophy QTL 2 thymus mass (VT:0004954) thymus wet weight (CMO:0000855) 2 189599258 226936289 Rat 1331760 Bp206 Blood pressure QTL 206 3.62454 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 56043031 202447032 Rat 9589044 Scfw1 Subcutaneous fat weight QTL 1 5.8 0.001 subcutaneous adipose mass (VT:1000472) abdominal subcutaneous fat pad weight (CMO:0002069) 2 182171407 227171407 Rat 8694435 Bw166 Body weight QTL 166 14.08 0.001 retroperitoneal fat pad mass (VT:0010430) retroperitoneal fat pad weight to body weight ratio (CMO:0000635) 2 182171407 227171407 Rat 1359032 Hrtrt18 Heart rate QTL 18 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 2 157142078 192625452 Rat 2301966 Bp322 Blood pressure QTL 322 3.58 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 150540301 202447032 Rat 1298083 Bp158 Blood pressure QTL 158 2.62 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 189020722 215287351 Rat 1298080 Bp163 Blood pressure QTL 163 0.02 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 66118275 202447032 Rat 8662832 Vetf7 Vascular elastic tissue fragility QTL 7 3.5 aorta elastin amount (VT:0003905) aorta wall extracellular elastin dry weight to aorta wall dry weight ratio (CMO:0002002) 2 81689826 221035911 Rat 1331745 Bp203 Blood pressure QTL 203 4.377 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 189599258 218414891 Rat 1298085 Bp165 Blood pressure QTL 165 0.0006 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 42804607 202447032 Rat 8694194 Abfw1 Abdominal fat weight QTL 1 11.7 0.001 visceral adipose mass (VT:0010063) abdominal fat pad weight to body weight ratio (CMO:0000095) 2 182171407 227171407 Rat 61366 Iddm3 Insulin dependent diabetes mellitus QTL 3 4.7 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 2 189599258 234599258 Rat 1359022 Ppulsi1 Prepulse inhibition QTL 1 3.63 prepulse inhibition trait (VT:0003088) acoustic startle response measurement (CMO:0001519) 2 136916935 213594495 Rat 1641891 Alcrsp17 Alcohol response QTL 17 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 2 149559561 249053267 Rat 724534 Uae6 Urinary albumin excretion QTL 6 10 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 2 78665619 249053267 Rat 61374 Edpm2 Estrogen-dependent pituitary mass QTL 2 4.42 0.86 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 2 76539322 202447032 Rat 2300189 Bmd48 Bone mineral density QTL 48 5.8 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 2 179335906 224335906 Rat 8662843 Vetf9 Vascular elastic tissue fragility QTL 9 2.05 thoracic aorta molecular composition trait (VT:0010568) aorta wall extracellular elastin dry weight to aorta wall extracellular collagen weight ratio (CMO:0002003) 2 157142078 226277316 Rat 2301408 Kidm36 Kidney mass QTL 36 0.002 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 2 190613715 226808892 Rat 631501 Bp101 Blood pressure QTL 101 2.4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 150341684 202446871 Rat 2307174 Activ3 Activity QTL 3 4.83 0.000058 locomotor behavior trait (VT:0001392) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 2 168594495 213594495 Rat 1331794 Bp202 Blood pressure QTL 202 3.66819 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 141194931 223265385 Rat 71113 Cari2 Carrageenan-induced inflammation QTL 2 2.7 0.009 hypodermis integrity trait (VT:0010550) inflammatory exudate volume (CMO:0001429) 2 141596551 202447032 Rat 1331805 Cm29 Cardiac mass QTL 29 3.50746 heart mass (VT:0007028) heart wet weight (CMO:0000069) 2 141194931 223265385 Rat 634308 Sach6 Saccharin preference QTL 6 4.9 taste sensitivity trait (VT:0001986) saccharin intake volume to total fluid intake volume ratio (CMO:0001601) 2 112456140 212696837 Rat 1358917 Cm42 Cardiac mass QTL 42 2.82 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 2 25413423 203928301 Rat 724568 Uae13 Urinary albumin excretion QTL 13 4.4 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 2 143157029 210020885 Rat 7488929 Bp366 Blood pressure QTL 366 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 184974550 193094998 Rat 1358913 Cm41 Cardiac mass QTL 41 2.73 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 2 25413423 203928301 Rat 1300165 Rf9 Renal function QTL 9 3.28 kidney glomerulus integrity trait (VT:0010546) index of glomerular damage (CMO:0001135) 2 133914684 202447032 Rat 738013 Alc15 Alcohol consumption QTL 15 4.1 0.00022 consumption behavior trait (VT:0002069) ethanol drink intake rate to body weight ratio (CMO:0001616) 2 184165752 229165752 Rat 61398 Bp50 Blood pressure QTL 50 4.4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 189599258 234599258 Rat 631507 Bp105 Blood pressure QTL 105 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 112456140 212696837 Rat 1641925 Alcrsp2 Alcohol response QTL 2 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 2 149559561 221167075 Rat 1354609 Niddm62 Non-insulin dependent diabetes mellitus QTL 62 4.72 0.000006 insulin secretion trait (VT:0003564) plasma insulin level (CMO:0000342) 2 150540301 202447032 Rat 1598833 Bp295 Blood pressure QTL 295 3.5 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 147798556 192798556 Rat 61417 Cia10 Collagen induced arthritis QTL 10 3.4 joint integrity trait (VT:0010548) experimental arthritis severity measurement (CMO:0001459) 2 179946951 224946951 Rat 1354622 Kidm16 Kidney mass QTL 16 3 kidney mass (VT:0002707) left kidney wet weight (CMO:0000083) 2 81754530 222436696 Rat 631266 Bp132 Blood pressure QTL 132 0.0005 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 46123260 202447032 Rat 8694383 Bw158 Body weight QTL 158 7.69 0.001 body lean mass (VT:0010483) lean tissue morphological measurement (CMO:0002184) 2 182171407 227171407 Rat 7488927 Bp365 Blood pressure QTL 365 0.008 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 162765032 207765032 Rat 1598838 Bp290 Blood pressure QTL 290 1.9 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 166539266 211539266 Rat 7488925 Bp364 Blood pressure QTL 364 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 160564068 205564068 Rat 2306901 Bp337 Blood pressure QTL 337 0.01 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 164073756 227146641 Rat 1354605 Rf48 Renal function QTL 48 2.9 blood creatinine amount (VT:0005328) plasma creatinine level (CMO:0000537) 2 74786664 206665859 Rat 2293084 Iddm26 Insulin dependent diabetes mellitus QTL 26 2.9 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 2 174930955 213594495 Rat
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
81
80
50
24
50
6
208
96
93
45
60
30
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000016833 ⟹ ENSRNOP00000016833
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 2 192,278,517 - 192,283,882 (+) Ensembl Rnor_6.0 Ensembl 2 207,262,934 - 207,268,609 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000110381 ⟹ ENSRNOP00000079348
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 2 192,278,839 - 192,283,882 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000118224 ⟹ ENSRNOP00000082364
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 2 192,278,517 - 192,283,882 (+) Ensembl
RefSeq Acc Id:
NM_001005540 ⟹ NP_001005540
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 194,967,214 - 194,972,228 (+) NCBI mRatBN7.2 2 192,278,869 - 192,283,883 (+) NCBI Rnor_6.0 2 207,263,587 - 207,268,601 (+) NCBI Rnor_5.0 2 226,682,751 - 226,687,765 (+) NCBI RGSC_v3.4 2 200,039,684 - 200,044,698 (+) RGD Celera 2 184,745,409 - 184,750,423 (+) RGD
Sequence:
CAGCATGCTAAACCGGGTGCGCTCGGCCGTGGCGCACCTGGTGAGCTCCAGTGGCACTTCTTCCCAGCGCTCCAAGTCTCCAGATCTGCCCAAAGCTATCTCACCGCCTCCGGGAGCCCTAGAGACAC
hide sequence
RefSeq Acc Id:
XM_008761380 ⟹ XP_008759602
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 194,966,899 - 194,972,228 (+) NCBI mRatBN7.2 2 192,278,597 - 192,283,883 (+) NCBI Rnor_6.0 2 207,263,308 - 207,268,601 (+) NCBI
Sequence:
AAATTCTAGCGGATTAAATCCAGCGGATGTCTAACCTACAGCACGACTTAAATGCTTCCTTTGT
hide sequence
RefSeq Acc Id:
XM_008761381 ⟹ XP_008759603
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 194,966,871 - 194,972,228 (+) NCBI mRatBN7.2 2 192,278,597 - 192,283,883 (+) NCBI Rnor_6.0 2 207,263,307 - 207,268,601 (+) NCBI
Sequence:
CAAATTCTAGCGGATTAAATCCAGCGGATGTCTAACCTACAGCACGACTTAAATGCTTCCTTTG
hide sequence
RefSeq Acc Id:
XM_063281640 ⟹ XP_063137710
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 194,967,122 - 194,972,228 (+) NCBI
RefSeq Acc Id:
XM_063281641 ⟹ XP_063137711
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 194,966,854 - 194,970,613 (+) NCBI
RefSeq Acc Id:
XM_063281642 ⟹ XP_063137712
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 194,967,120 - 194,970,613 (+) NCBI
RefSeq Acc Id:
XR_005500269
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 194,966,862 - 194,971,483 (+) NCBI mRatBN7.2 2 192,278,597 - 192,283,145 (+) NCBI
RefSeq Acc Id:
XR_005500270
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 194,966,862 - 194,971,241 (+) NCBI mRatBN7.2 2 192,278,597 - 192,282,884 (+) NCBI
RefSeq Acc Id:
NP_001005540 ⟸ NM_001005540
- UniProtKB:
Q641Y6 (UniProtKB/Swiss-Prot), A6K3P4 (UniProtKB/TrEMBL), A0A8I5ZXT1 (UniProtKB/TrEMBL)
- Sequence:
MLNRVRSAVAHLVSSSGTSSQRSKSPDLPKAISPPPGALETPKSPGTKSGNEIPAPQKTAETPVSFSRPTFLQLSPGGLRRADDHVGRAVQSPPDTGRRLPWSTGYAEVINAGKSRHNEDQACCEVVY
hide sequence
RefSeq Acc Id:
XP_008759602 ⟸ XM_008761380
- Peptide Label:
isoform X1
- UniProtKB:
A0A0H2UHJ9 (UniProtKB/TrEMBL), A0A8I5ZXT1 (UniProtKB/TrEMBL)
- Sequence:
MSNLQHDLNASFVPLPSYKRPFPSDTLAGQSRDAEKRQRRSKSPDLPKAISPPPGALETPKSPGTKSGNEIPAPQKTAETPVSFSRPTFLQLSPGGLRRADDHVGRAVQSPPDTGRRLPWSTGYAEVI
hide sequence
RefSeq Acc Id:
XP_008759603 ⟸ XM_008761381
- Peptide Label:
isoform X2
- UniProtKB:
A0A8I5ZXT1 (UniProtKB/TrEMBL)
- Sequence:
MSNLQHDLNASFVPLPSYKRPFPSDTLAGQSRDAEKRQRRSKSPDLPKAISPPPGALETPKSPG
hide sequence
Ensembl Acc Id:
ENSRNOP00000016833 ⟸ ENSRNOT00000016833
Ensembl Acc Id:
ENSRNOP00000082364 ⟸ ENSRNOT00000118224
Ensembl Acc Id:
ENSRNOP00000079348 ⟸ ENSRNOT00000110381
RefSeq Acc Id:
XP_063137711 ⟸ XM_063281641
- Peptide Label:
isoform X4
RefSeq Acc Id:
XP_063137712 ⟸ XM_063281642
- Peptide Label:
isoform X5
RefSeq Acc Id:
XP_063137710 ⟸ XM_063281640
- Peptide Label:
isoform X3
- UniProtKB:
A0A8I5ZMI9 (UniProtKB/TrEMBL), A0A8I5ZXT1 (UniProtKB/TrEMBL)
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2012-05-03
Ppm1j
protein phosphatase, Mg2+/Mn2+ dependent, 1J
Ppm1j
protein phosphatase 1J
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2005-11-17
Ppm1j
protein phosphatase 1J
Symbol and Name updated
1299863 APPROVED
2005-07-29
MGC95205
protein phosphatase 2C zeta
Symbol and Name status set to provisional
70820 PROVISIONAL
Note Type
Note
Reference
gene_expression
mouse homolog is expressed in testicular germ cells in the adult mouse
1359743
gene_physical_interaction
mouse homolog binds the ubiquitin-conjugating enzyme Ube2i/UBC9; association enhanced by the small ubiquitin-related modifier Sumo1
1359743
