Symbol:
Casp14
Name:
caspase 14
RGD ID:
1311781
Description:
Predicted to enable cysteine-type endopeptidase activity. Predicted to be involved in positive regulation of neuron apoptotic process. Located in keratin filament. Human ortholog(s) of this gene implicated in autosomal recessive congenital ichthyosis. Orthologous to human CASP14 (caspase 14); INTERACTS WITH 1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane; 2,3,7,8-tetrachlorodibenzodioxine; alpha-Zearalanol.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
caspase-14; LOC299587
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
CASP14 (caspase 14)
HGNC
Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Casp14 (caspase 14)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Casp14 (caspase 14)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
CASP14 (caspase 14)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
CASP14 (caspase 14)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Casp14 (caspase 14)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
CASP14 (caspase 14)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
CASP14 (caspase 14)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Casp14 (caspase 14)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
CASP14 (caspase 14)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Casp14 (caspase 14)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
csp-1
Alliance
DIOPT (Ensembl Compara|PANTHER|PhylomeDB)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 7 11,577,315 - 11,583,987 (+) NCBI GRCr8 mRatBN7.2 7 10,929,759 - 10,932,591 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 7 10,926,725 - 10,933,405 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 7 13,750,087 - 13,752,901 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 7 15,627,533 - 15,630,347 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 7 13,505,382 - 13,508,196 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 7 13,938,376 - 13,944,286 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 7 13,938,302 - 13,945,130 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 7 14,094,304 - 14,099,953 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 7 12,487,166 - 12,489,998 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 7 12,456,557 - 12,489,998 (+) NCBI Celera 7 9,047,174 - 9,050,006 (+) NCBI Celera Cytogenetic Map 7 q11 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Casp14 Rat (+)-dexrazoxane multiple interactions ISO Casp14 (Mus musculus) 6480464 [Doxorubicin co-treated with Dexrazoxane] results in decreased expression of CASP14 mRNA CTD PMID:26873546 Casp14 Rat (S)-nicotine increases expression ISO CASP14 (Homo sapiens) 6480464 Nicotine results in increased expression of CASP14 mRNA CTD PMID:23825647 Casp14 Rat 1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane decreases expression EXP 6480464 o and p'-DDT analog results in decreased expression of CASP14 mRNA CTD PMID:22937105 Casp14 Rat 1,2-dichloroethane increases expression ISO Casp14 (Mus musculus) 6480464 ethylene dichloride results in increased expression of CASP14 mRNA CTD PMID:28960355 Casp14 Rat 1,2-dimethylhydrazine decreases expression ISO Casp14 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of CASP14 mRNA CTD PMID:22206623 Casp14 Rat 17beta-estradiol increases expression ISO CASP14 (Homo sapiens) 6480464 Estradiol results in increased expression of CASP14 mRNA CTD PMID:23373633 Casp14 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of CASP14 mRNA CTD PMID:19520675 Casp14 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Casp14 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of CASP14 mRNA CTD PMID:21570461 Casp14 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Casp14 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of CASP14 mRNA CTD PMID:12167310 and PMID:17035482 Casp14 Rat 2,6-dimethoxyphenol multiple interactions ISO CASP14 (Homo sapiens) 6480464 [Sodium Chloride co-treated with pyrogallol 1 and 3-dimethyl ether] results in decreased expression of CASP14 protein CTD PMID:38598786 Casp14 Rat 2-hydroxypropanoic acid decreases expression ISO CASP14 (Homo sapiens) 6480464 Lactic Acid results in decreased expression of CASP14 mRNA CTD PMID:30851411 Casp14 Rat 4,4'-sulfonyldiphenol increases expression ISO Casp14 (Mus musculus) 6480464 bisphenol S results in increased expression of CASP14 mRNA CTD PMID:38908815 Casp14 Rat 4,4'-sulfonyldiphenol increases expression ISO CASP14 (Homo sapiens) 6480464 bisphenol S results in increased expression of CASP14 mRNA CTD PMID:33312107 Casp14 Rat aflatoxin B1 increases expression ISO CASP14 (Homo sapiens) 6480464 Aflatoxin B1 results in increased expression of CASP14 mRNA CTD PMID:32234424 Casp14 Rat aldrin increases expression ISO Casp14 (Mus musculus) 6480464 Aldrin results in increased expression of CASP14 mRNA CTD PMID:18579281 Casp14 Rat alpha-Zearalanol multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of CASP14 mRNA CTD PMID:35163327 Casp14 Rat arsenite(3-) increases expression ISO CASP14 (Homo sapiens) 6480464 arsenite results in increased expression of CASP14 mRNA CTD PMID:23974009 Casp14 Rat benzo[a]pyrene affects methylation ISO CASP14 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of CASP14 promoter CTD PMID:27901495 Casp14 Rat beta-damascenone increases expression ISO Casp14 (Mus musculus) 6480464 beta-damascenone results in increased expression of CASP14 mRNA CTD PMID:22982537 Casp14 Rat beta-damascenone affects localization ISO Casp14 (Mus musculus) 6480464 beta-damascenone affects the localization of CASP14 protein CTD PMID:22982537 Casp14 Rat bis(2-ethylhexyl) phthalate multiple interactions ISO CASP14 (Homo sapiens) 6480464 [Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with butylbenzyl phthalate co-treated with lead nitrate co-treated with Mercury] results in decreased expression of CASP14 mRNA CTD PMID:32949613 Casp14 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of CASP14 mRNA CTD PMID:25181051 Casp14 Rat Butylbenzyl phthalate multiple interactions ISO CASP14 (Homo sapiens) 6480464 [Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with butylbenzyl phthalate co-treated with lead nitrate co-treated with Mercury] results in decreased expression of CASP14 mRNA CTD PMID:32949613 Casp14 Rat cadmium atom decreases expression ISO CASP14 (Homo sapiens) 6480464 Cadmium results in decreased expression of CASP14 mRNA CTD PMID:24376830 Casp14 Rat calcitriol increases expression ISO CASP14 (Homo sapiens) 6480464 Calcitriol results in increased expression of CASP14 mRNA CTD PMID:26485663 Casp14 Rat carnosic acid increases expression ISO Casp14 (Mus musculus) 6480464 salvin results in increased expression of CASP14 protein CTD PMID:35926579 Casp14 Rat CGP 52608 multiple interactions ISO CASP14 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to CASP14 gene] CTD PMID:28238834 Casp14 Rat chloroethene increases expression ISO Casp14 (Mus musculus) 6480464 Vinyl Chloride results in increased expression of CASP14 mRNA CTD PMID:18579281 Casp14 Rat chlorpyrifos increases expression ISO Casp14 (Mus musculus) 6480464 Chlorpyrifos results in increased expression of CASP14 mRNA CTD PMID:37019170 Casp14 Rat dibutyl phthalate decreases expression EXP 6480464 Dibutyl Phthalate results in decreased expression of CASP14 mRNA CTD PMID:24893172 Casp14 Rat diisononyl phthalate multiple interactions ISO CASP14 (Homo sapiens) 6480464 [Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with butylbenzyl phthalate co-treated with lead nitrate co-treated with Mercury] results in decreased expression of CASP14 mRNA CTD PMID:32949613 Casp14 Rat dimethylarsinous acid decreases expression ISO CASP14 (Homo sapiens) 6480464 dimethylarsinous acid results in decreased expression of CASP14 mRNA CTD PMID:23876855 Casp14 Rat doxorubicin multiple interactions ISO Casp14 (Mus musculus) 6480464 [Doxorubicin co-treated with Dexrazoxane] results in decreased expression of CASP14 mRNA CTD PMID:26873546 Casp14 Rat folic acid decreases expression ISO Casp14 (Mus musculus) 6480464 Folic Acid results in decreased expression of CASP14 mRNA CTD PMID:25629700 Casp14 Rat furfural multiple interactions ISO CASP14 (Homo sapiens) 6480464 [Sodium Chloride co-treated with Furaldehyde] results in increased expression of CASP14 protein CTD PMID:38598786 Casp14 Rat furosemide affects expression EXP 6480464 Furosemide affects the expression of CASP14 mRNA CTD PMID:17497460 Casp14 Rat isoflurane decreases expression EXP 6480464 Isoflurane results in decreased expression of CASP14 mRNA CTD PMID:16978161 Casp14 Rat lead nitrate multiple interactions ISO CASP14 (Homo sapiens) 6480464 [Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with butylbenzyl phthalate co-treated with lead nitrate co-treated with Mercury] results in decreased expression of CASP14 mRNA CTD PMID:32949613 Casp14 Rat lead(0) affects binding ISO CASP14 (Homo sapiens) 6480464 CASP14 protein binds to Lead CTD PMID:23896426 Casp14 Rat Licochalcone B decreases expression ISO CASP14 (Homo sapiens) 6480464 licochalcone B results in decreased expression of CASP14 mRNA CTD PMID:33647349 Casp14 Rat mercury atom multiple interactions ISO CASP14 (Homo sapiens) 6480464 [Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with butylbenzyl phthalate co-treated with lead nitrate co-treated with Mercury] results in decreased expression of CASP14 mRNA CTD PMID:32949613 Casp14 Rat mercury(0) multiple interactions ISO CASP14 (Homo sapiens) 6480464 [Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with butylbenzyl phthalate co-treated with lead nitrate co-treated with Mercury] results in decreased expression of CASP14 mRNA CTD PMID:32949613 Casp14 Rat metformin multiple interactions ISO CASP14 (Homo sapiens) 6480464 [Paclitaxel co-treated with Metformin] results in increased expression of CASP14 mRNA CTD PMID:29309887 Casp14 Rat methotrexate affects expression ISO Casp14 (Mus musculus) 6480464 Methotrexate affects the expression of CASP14 mRNA CTD PMID:18502557 Casp14 Rat N-acetyl-L-cysteine multiple interactions EXP 6480464 Acetylcysteine inhibits the reaction [Tobacco Smoke Pollution results in increased expression of CASP14 protein] CTD PMID:16137721 Casp14 Rat N-Nitrosopyrrolidine increases expression ISO CASP14 (Homo sapiens) 6480464 N-Nitrosopyrrolidine results in increased expression of CASP14 mRNA CTD PMID:32234424 Casp14 Rat nicotine increases expression ISO CASP14 (Homo sapiens) 6480464 Nicotine results in increased expression of CASP14 mRNA CTD PMID:23825647 Casp14 Rat p-menthan-3-ol increases expression ISO CASP14 (Homo sapiens) 6480464 Menthol results in increased expression of CASP14 mRNA CTD PMID:26760959 Casp14 Rat paclitaxel multiple interactions ISO CASP14 (Homo sapiens) 6480464 [Paclitaxel co-treated with Metformin] results in increased expression of CASP14 mRNA CTD PMID:29309887 Casp14 Rat paracetamol affects expression ISO Casp14 (Mus musculus) 6480464 Acetaminophen affects the expression of CASP14 mRNA CTD PMID:17562736 Casp14 Rat paracetamol decreases expression ISO CASP14 (Homo sapiens) 6480464 Acetaminophen results in decreased expression of CASP14 mRNA CTD PMID:29067470 Casp14 Rat pentobarbital decreases expression EXP 6480464 Pentobarbital results in decreased expression of CASP14 mRNA CTD PMID:16978161 Casp14 Rat perfluorononanoic acid decreases expression ISO CASP14 (Homo sapiens) 6480464 perfluoro-n-nonanoic acid results in decreased expression of CASP14 mRNA CTD PMID:32588087 Casp14 Rat perfluorooctane-1-sulfonic acid decreases expression ISO CASP14 (Homo sapiens) 6480464 perfluorooctane sulfonic acid results in decreased expression of CASP14 mRNA CTD PMID:32588087 and PMID:36864359 Casp14 Rat perfluorooctanoic acid multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of CASP14 mRNA CTD PMID:35163327 Casp14 Rat propiconazole increases expression ISO Casp14 (Mus musculus) 6480464 propiconazole results in increased expression of CASP14 mRNA CTD PMID:21278054 Casp14 Rat pyrethrins decreases expression ISO CASP14 (Homo sapiens) 6480464 Pyrethrins results in decreased expression of CASP14 mRNA CTD PMID:35321623 Casp14 Rat quercetin decreases expression EXP 6480464 Quercetin results in decreased expression of CASP14 mRNA CTD PMID:17103110 Casp14 Rat rac-lactic acid decreases expression ISO CASP14 (Homo sapiens) 6480464 Lactic Acid results in decreased expression of CASP14 mRNA CTD PMID:30851411 Casp14 Rat sodium arsenite affects expression ISO CASP14 (Homo sapiens) 6480464 sodium arsenite affects the expression of CASP14 mRNA CTD PMID:34032870 Casp14 Rat sodium chloride multiple interactions ISO CASP14 (Homo sapiens) 6480464 [Sodium Chloride co-treated with Furaldehyde] results in increased expression of CASP14 protein more ... CTD PMID:38598786 Casp14 Rat titanium dioxide increases expression ISO Casp14 (Mus musculus) 6480464 titanium dioxide results in increased expression of CASP14 mRNA CTD PMID:35295148 Casp14 Rat trichloroethene increases expression EXP 6480464 Trichloroethylene results in increased expression of CASP14 mRNA CTD PMID:33387578 Casp14 Rat zoledronic acid decreases expression ISO CASP14 (Homo sapiens) 6480464 zoledronic acid results in decreased expression of CASP14 mRNA CTD PMID:19036117
(+)-dexrazoxane (ISO) (S)-nicotine (ISO) 1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane (EXP) 1,2-dichloroethane (ISO) 1,2-dimethylhydrazine (ISO) 17beta-estradiol (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,6-dimethoxyphenol (ISO) 2-hydroxypropanoic acid (ISO) 4,4'-sulfonyldiphenol (ISO) aflatoxin B1 (ISO) aldrin (ISO) alpha-Zearalanol (EXP) arsenite(3-) (ISO) benzo[a]pyrene (ISO) beta-damascenone (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP) Butylbenzyl phthalate (ISO) cadmium atom (ISO) calcitriol (ISO) carnosic acid (ISO) CGP 52608 (ISO) chloroethene (ISO) chlorpyrifos (ISO) dibutyl phthalate (EXP) diisononyl phthalate (ISO) dimethylarsinous acid (ISO) doxorubicin (ISO) folic acid (ISO) furfural (ISO) furosemide (EXP) isoflurane (EXP) lead nitrate (ISO) lead(0) (ISO) Licochalcone B (ISO) mercury atom (ISO) mercury(0) (ISO) metformin (ISO) methotrexate (ISO) N-acetyl-L-cysteine (EXP) N-Nitrosopyrrolidine (ISO) nicotine (ISO) p-menthan-3-ol (ISO) paclitaxel (ISO) paracetamol (ISO) pentobarbital (EXP) perfluorononanoic acid (ISO) perfluorooctane-1-sulfonic acid (ISO) perfluorooctanoic acid (EXP) propiconazole (ISO) pyrethrins (ISO) quercetin (EXP) rac-lactic acid (ISO) sodium arsenite (ISO) sodium chloride (ISO) titanium dioxide (ISO) trichloroethene (EXP) zoledronic acid (ISO)
Casp14 (Rattus norvegicus - Norway rat)
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 7 11,577,315 - 11,583,987 (+) NCBI GRCr8 mRatBN7.2 7 10,929,759 - 10,932,591 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 7 10,926,725 - 10,933,405 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 7 13,750,087 - 13,752,901 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 7 15,627,533 - 15,630,347 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 7 13,505,382 - 13,508,196 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 7 13,938,376 - 13,944,286 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 7 13,938,302 - 13,945,130 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 7 14,094,304 - 14,099,953 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 7 12,487,166 - 12,489,998 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 7 12,456,557 - 12,489,998 (+) NCBI Celera 7 9,047,174 - 9,050,006 (+) NCBI Celera Cytogenetic Map 7 q11 NCBI
CASP14 (Homo sapiens - human)
Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 19 15,049,480 - 15,058,293 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 19 15,049,480 - 15,058,293 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 19 15,160,291 - 15,169,104 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 19 15,024,015 - 15,027,900 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 19 15,024,014 - 15,027,900 NCBI Celera 19 15,058,743 - 15,062,628 (+) NCBI Celera Cytogenetic Map 19 p13.12 NCBI HuRef 19 14,727,867 - 14,736,682 (+) NCBI HuRef CHM1_1 19 15,159,760 - 15,168,573 (+) NCBI CHM1_1 T2T-CHM13v2.0 19 15,174,417 - 15,183,232 (+) NCBI T2T-CHM13v2.0
Casp14 (Mus musculus - house mouse)
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 10 78,547,829 - 78,554,181 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 10 78,547,825 - 78,554,128 (-) Ensembl GRCm39 Ensembl GRCm38 10 78,711,995 - 78,718,347 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 10 78,711,991 - 78,718,294 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 10 78,174,740 - 78,181,038 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 10 78,115,126 - 78,121,371 (-) NCBI MGSCv36 mm8 Celera 10 79,733,914 - 79,740,355 (-) NCBI Celera Cytogenetic Map 10 C1 NCBI cM Map 10 39.72 NCBI
Casp14 (Chinchilla lanigera - long-tailed chinchilla)
Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955495 8,213,763 - 8,221,616 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955495 8,214,512 - 8,221,124 (-) NCBI ChiLan1.0 ChiLan1.0
CASP14 (Pan paniscus - bonobo/pygmy chimpanzee)
Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 20 19,938,212 - 19,970,641 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 19 18,955,262 - 18,987,678 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 19 14,594,810 - 14,604,109 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 19 15,565,543 - 15,574,402 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 19 15,565,543 - 15,574,402 (+) Ensembl panpan1.1 panPan2
CASP14 (Canis lupus familiaris - dog)
Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 20 47,060,351 - 47,067,169 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 20 47,062,278 - 47,065,001 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 20 46,911,092 - 46,917,669 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 20 47,553,425 - 47,560,009 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 20 47,553,782 - 47,560,035 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 20 46,784,855 - 46,791,428 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 20 47,204,643 - 47,211,219 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 20 47,475,191 - 47,481,766 (-) NCBI UU_Cfam_GSD_1.0
Casp14 (Ictidomys tridecemlineatus - thirteen-lined ground squirrel)
Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405118 205,846,067 - 205,852,182 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936596 5,396,866 - 5,399,278 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936596 5,396,866 - 5,399,255 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
CASP14 (Sus scrofa - pig)
Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 2 62,524,183 - 62,531,642 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 2 62,522,294 - 62,531,594 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 2 62,076,316 - 62,089,874 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
CASP14 (Chlorocebus sabaeus - green monkey)
Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 6 13,649,993 - 13,654,309 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 6 13,648,598 - 13,652,821 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666074 5,899,601 - 5,914,400 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Casp14 (Heterocephalus glaber - naked mole-rat)
.
Predicted Target Of
Count of predictions: 112 Count of miRNA genes: 85 Interacting mature miRNAs: 89 Transcripts: ENSRNOT00000009643 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
61410 Bw19 Body weight QTL 19 6.2 0.001 body mass (VT:0001259) body weight (CMO:0000012) 7 1 44782185 Rat 1300176 Hrtrt10 Heart rate QTL 10 3.19 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 7 664270 26029351 Rat 9590102 Sffal5 Serum free fatty acids level QTL 5 8.62 0.001 blood free fatty acid amount (VT:0001553) plasma free fatty acids level (CMO:0000546) 7 5329019 50329019 Rat 1578652 Bmd15 Bone mineral density QTL 15 5.2 femur mineral mass (VT:0010011) trabecular volumetric bone mineral density (CMO:0001729) 7 9866467 60460686 Rat 1643004 Pain2 Pain QTL 2 1 mechanical nociception trait (VT:0002734) self mutilation severity score (CMO:0002145) 7 9462246 98011544 Rat 631503 Bp102 Blood pressure QTL 102 1.9 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 7 1 44822433 Rat 634336 Anxrr17 Anxiety related response QTL 17 3.66 locomotor behavior trait (VT:0001392) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 7 924703 115097879 Rat 10755438 Coatc9 Coat color QTL 9 0 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 7 3529280 48529280 Rat 9590142 Scort5 Serum corticosterone level QTL 5 24.4 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 7 1 31962314 Rat 2298547 Neuinf5 Neuroinflammation QTL 5 3.7 nervous system integrity trait (VT:0010566) spinal cord Cd74 protein level (CMO:0002131) 7 9462246 58265113 Rat 10059592 Kidm45 Kidney mass QTL 45 3.95 0.025 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 7 7573985 52573985 Rat 2317047 Wbc4 White blood cell count QTL 4 0.01 leukocyte quantity (VT:0000217) white blood cell count (CMO:0000027) 7 1 35342956 Rat 10755440 Coatc10 Coat color QTL 10 0 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 7 7496499 52496499 Rat 2298550 Neuinf6 Neuroinflammation QTL 6 3.3 nervous system integrity trait (VT:0010566) spinal cord RT1-B protein level (CMO:0002132) 7 1 27829089 Rat 724560 Plsm3 Polydactyly-luxate syndrome (PLS) morphotypes QTL 3 0.0003 tibia length (VT:0004357) tibia length (CMO:0000450) 7 1 34000259 Rat 7411566 Bw136 Body weight QTL 136 10.4 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 7 1 31962314 Rat
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
7
10
9
14
20
2
8
2
6
30
18
3
3
26
18
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000009643 ⟹ ENSRNOP00000009643
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 10,926,725 - 10,933,405 (+) Ensembl Rnor_6.0 Ensembl 7 13,938,302 - 13,945,130 (+) Ensembl
RefSeq Acc Id:
NM_001191776 ⟹ NP_001178705
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 11,580,339 - 11,583,171 (+) NCBI mRatBN7.2 7 10,929,759 - 10,932,591 (+) NCBI Rnor_6.0 7 13,940,638 - 13,943,470 (+) NCBI Rnor_5.0 7 14,094,304 - 14,099,953 (+) NCBI Celera 7 9,047,174 - 9,050,006 (+) NCBI
Sequence:
ATGGACTCAGAGACGATTAATCCCCAGCCCTTGCAGGAGGAGAGATACGATATGTCGGGTGCCCGCCTGGCCCTGACGCTGTGTGTCACCAAAGCCCGGGAGGGTTCTGAGGTAGATATGGATGCCCT AGAACGCATGTTCCAGTACCTAAAATTTGAAAGCACCATGAAGAGGGATCCTACTGCTCAGCAATTTCTGGATGATATGGATGAATTTCAGCAGACCATAGAGAATTGGAAAGAGCCTGTCAGCTGTG CCTTCGTGGTACTCATGGCACACGGCGAGGAAGGCTTCCTCAAGGGAGAAGACGGGAATATGGTCAGACTGGAAGACCTTTTTGAGGTCTTGAACAACAAGAACTGCAAGGCCCTGAGAGGCAAGCCA AAAGTGTATATCATCCAGGCCTGCAGAGGAGAGCACAGAGACCCCGGTGAGGAACTACCTGGAGATGAACTTGCTGTGATCAAGAAGAAAAACCCCCCAACTATCCCAACATATACGGATATGATCCA TATCTACTCCACGGTAGAGGGGTTCCTCTCCTATAGACATGACCAGAAAGGCTCTGGCTTCATCCAGACCCTGACGGATGTGTTCATTCATAAAAAAGGATCCATCACAGAGCTGTTAGAAGAGATCA CCCGACTTATGGCAAACACAGAGGTGATGCAGGAGGGAAAACCAAGGAAAGTGAACCCCGAAATCCAAAGCACCCTCCGGAAGAAGCTCTATCTGCAATAA
hide sequence
RefSeq Acc Id:
XM_063263160 ⟹ XP_063119230
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 11,577,315 - 11,583,987 (+) NCBI
RefSeq Acc Id:
NP_001178705 ⟸ NM_001191776
- UniProtKB:
D3ZZ65 (UniProtKB/TrEMBL)
- Sequence:
MDSETINPQPLQEERYDMSGARLALTLCVTKAREGSEVDMDALERMFQYLKFESTMKRDPTAQQFLDDMDEFQQTIENWKEPVSCAFVVLMAHGEEGFLKGEDGNMVRLEDLFEVLNNKNCKALRGKP KVYIIQACRGEHRDPGEELPGDELAVIKKKNPPTIPTYTDMIHIYSTVEGFLSYRHDQKGSGFIQTLTDVFIHKKGSITELLEEITRLMANTEVMQEGKPRKVNPEIQSTLRKKLYLQ
hide sequence
Ensembl Acc Id:
ENSRNOP00000009643 ⟸ ENSRNOT00000009643
RefSeq Acc Id:
XP_063119230 ⟸ XM_063263160
- Peptide Label:
isoform X1
- UniProtKB:
D3ZZ65 (UniProtKB/TrEMBL)
RGD ID: 13695063
Promoter ID: EPDNEW_R5588
Type: multiple initiation site
Name: Casp14_1
Description: caspase 14
SO ACC ID: SO:0000170
Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ )
Experiment Methods: Single-end sequencing.
Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 7 13,938,395 - 13,938,455 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2008-04-30
Casp14
caspase 14
Casp14_predicted
caspase 14 (predicted)
'predicted' is removed
2292626
APPROVED
2005-01-12
Casp14_predicted
caspase 14 (predicted)
Symbol and Name status set to approved
70820
APPROVED