Symbol:
Sec24d
Name:
SEC24 homolog D, COPII coat complex component
RGD ID:
1311720
Description:
Predicted to enable SNARE binding activity and zinc ion binding activity. Predicted to be involved in COPII-coated vesicle cargo loading. Predicted to act upstream of or within in utero embryonic development. Predicted to be located in intracellular membrane-bounded organelle. Predicted to be part of COPII vesicle coat. Predicted to be active in endoplasmic reticulum exit site. Human ortholog(s) of this gene implicated in Cole-Carpenter syndrome. Orthologous to human SEC24D (SEC24 homolog D, COPII coat complex component); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,4-dinitrotoluene; amphetamine.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
LOC310843; protein transport protein Sec24D; SEC24 family member D; SEC24 family, member D; SEC24 family, member D (S. cerevisiae); SEC24 related gene family, member D; SEC24 related gene family, member D (S. cerevisiae)
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
SEC24D (SEC24 homolog D, COPII coat complex component) HGNC
Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther
Mus musculus (house mouse):
Sec24d (SEC24 homolog D, COPII coat complex component) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Sec24d (SEC24 homolog D, COPII coat complex component) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
SEC24D (SEC24 homolog D, COPII coat complex component) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
SEC24D (SEC24 homolog D, COPII coat complex component) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Sec24d (SEC24 homolog D, COPII coat complex component) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
SEC24D (SEC24 homolog D, COPII coat complex component) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
SEC24D (SEC24 homolog D, COPII coat complex component) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Sec24d (SEC24 homolog D, COPII coat complex component) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
SEC24D (SEC24 homolog D, COPII coat complex component)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Sec24d (SEC24 homolog D, COPII coat complex component)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
sec24d (SEC24 homolog D, COPII coat complex component)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
sec-24.1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
SFB3
Alliance
DIOPT (Ensembl Compara|Hieranoid|OMA|OrthoFinder|PANTHER|PhylomeDB)
Drosophila melanogaster (fruit fly):
Sec24CD
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
anxa2
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
sec24d
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 2 214,103,138 - 214,211,155 (+) NCBI GRCr8 mRatBN7.2 2 211,418,557 - 211,526,588 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 2 211,418,623 - 211,526,587 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 2 219,091,582 - 219,198,356 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 2 216,991,462 - 217,098,234 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 2 211,845,703 - 211,952,480 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 2 227,455,704 - 227,562,801 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 2 227,455,722 - 227,562,319 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 2 246,815,650 - 246,919,957 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 2 219,985,811 - 220,096,797 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 2 219,950,676 - 220,059,192 (+) NCBI Celera 2 203,833,456 - 203,940,242 (+) NCBI Celera Cytogenetic Map 2 q42 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Sec24d Rat 1,2-dimethylhydrazine multiple interactions ISO Sec24d (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of SEC24D mRNA CTD PMID:22206623 Sec24d Rat 1,2-dimethylhydrazine decreases expression ISO Sec24d (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of SEC24D mRNA CTD PMID:22206623 Sec24d Rat 17beta-estradiol multiple interactions ISO SEC24D (Homo sapiens) 6480464 [Estradiol co-treated with TGFB1 protein] results in increased expression of SEC24D mRNA CTD PMID:30165855 Sec24d Rat 17beta-estradiol increases expression ISO Sec24d (Mus musculus) 6480464 Estradiol results in increased expression of SEC24D mRNA CTD PMID:39298647 Sec24d Rat 17beta-hydroxy-5alpha-androstan-3-one increases expression ISO SEC24D (Homo sapiens) 6480464 Dihydrotestosterone results in increased expression of SEC24D mRNA CTD PMID:29581250 Sec24d Rat 2,2',4,4'-Tetrabromodiphenyl ether increases expression ISO SEC24D (Homo sapiens) 6480464 2 more ... CTD PMID:19095052 Sec24d Rat 2,2',4,4'-Tetrabromodiphenyl ether decreases expression ISO SEC24D (Homo sapiens) 6480464 2 more ... CTD PMID:31675489 Sec24d Rat 2,2',4,4'-Tetrabromodiphenyl ether affects expression ISO Sec24d (Mus musculus) 6480464 2 more ... CTD PMID:30294300 Sec24d Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of SEC24D mRNA CTD PMID:22298810 Sec24d Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Sec24d (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of SEC24D mRNA CTD PMID:21570461 Sec24d Rat 2,4,6-tribromophenol decreases expression ISO SEC24D (Homo sapiens) 6480464 2 more ... CTD PMID:31675489 Sec24d Rat 2,4-dinitrotoluene affects expression EXP 6480464 2 and 4-dinitrotoluene affects the expression of SEC24D mRNA CTD PMID:21346803 Sec24d Rat 2-bromohexadecanoic acid multiple interactions ISO SEC24D (Homo sapiens) 6480464 2-bromopalmitate inhibits the reaction [[Cadmium Chloride results in increased abundance of Cadmium] which results in increased palmitoylation of SEC24D protein] CTD PMID:38195004 Sec24d Rat 4,4'-sulfonyldiphenol increases expression ISO Sec24d (Mus musculus) 6480464 bisphenol S results in increased expression of SEC24D mRNA CTD PMID:30951980 and PMID:39298647 Sec24d Rat aflatoxin B1 decreases expression ISO SEC24D (Homo sapiens) 6480464 Aflatoxin B1 results in decreased expression of SEC24D mRNA CTD PMID:22100608 Sec24d Rat all-trans-retinoic acid multiple interactions ISO Sec24d (Mus musculus) 6480464 [bisphenol F co-treated with Tretinoin] results in decreased expression of SEC24D mRNA CTD PMID:30951980 Sec24d Rat all-trans-retinoic acid increases expression ISO SEC24D (Homo sapiens) 6480464 Tretinoin results in increased expression of SEC24D mRNA CTD PMID:33167477 Sec24d Rat amphetamine increases expression EXP 6480464 Amphetamine results in increased expression of SEC24D mRNA CTD PMID:30779732 Sec24d Rat aristolochic acid A decreases expression ISO SEC24D (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of SEC24D mRNA CTD PMID:33212167 Sec24d Rat arsenite(3-) multiple interactions ISO SEC24D (Homo sapiens) 6480464 arsenite inhibits the reaction [G3BP1 protein binds to SEC24D mRNA] CTD PMID:32406909 Sec24d Rat avobenzone increases expression ISO SEC24D (Homo sapiens) 6480464 avobenzone results in increased expression of SEC24D mRNA CTD PMID:31016361 Sec24d Rat Benoxacor decreases expression ISO Sec24d (Mus musculus) 6480464 benoxacor results in decreased expression of SEC24D mRNA CTD PMID:34850242 Sec24d Rat benzo[a]pyrene increases expression ISO Sec24d (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of SEC24D mRNA CTD PMID:22228805 Sec24d Rat benzo[a]pyrene decreases expression ISO SEC24D (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of SEC24D mRNA CTD PMID:21632981 and PMID:32234424 Sec24d Rat beta-lapachone increases expression ISO SEC24D (Homo sapiens) 6480464 beta-lapachone results in increased expression of SEC24D mRNA CTD PMID:38218311 Sec24d Rat bis(2-ethylhexyl) phthalate increases expression ISO SEC24D (Homo sapiens) 6480464 Diethylhexyl Phthalate results in increased expression of SEC24D mRNA CTD PMID:31163220 Sec24d Rat bis(2-ethylhexyl) phthalate decreases expression ISO Sec24d (Mus musculus) 6480464 Diethylhexyl Phthalate results in decreased expression of SEC24D mRNA CTD PMID:34319233 Sec24d Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of SEC24D mRNA CTD PMID:25181051 Sec24d Rat bisphenol A decreases expression ISO SEC24D (Homo sapiens) 6480464 bisphenol A results in decreased expression of SEC24D protein CTD PMID:31675489 Sec24d Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of SEC24D mRNA CTD PMID:34947998 Sec24d Rat bisphenol A affects expression ISO SEC24D (Homo sapiens) 6480464 bisphenol A affects the expression of SEC24D mRNA CTD PMID:30903817 Sec24d Rat bisphenol A increases expression ISO Sec24d (Mus musculus) 6480464 bisphenol A results in increased expression of SEC24D mRNA CTD PMID:30951980 Sec24d Rat bisphenol AF increases expression ISO SEC24D (Homo sapiens) 6480464 bisphenol AF results in increased expression of SEC24D protein CTD PMID:34186270 Sec24d Rat Bisphenol B increases expression ISO SEC24D (Homo sapiens) 6480464 bisphenol B results in increased expression of SEC24D protein CTD PMID:34186270 Sec24d Rat bisphenol F multiple interactions ISO Sec24d (Mus musculus) 6480464 [bisphenol F co-treated with Tretinoin] results in decreased expression of SEC24D mRNA CTD PMID:30951980 Sec24d Rat bisphenol F increases expression ISO SEC24D (Homo sapiens) 6480464 bisphenol F results in increased expression of SEC24D protein CTD PMID:34186270 Sec24d Rat bisphenol F increases expression ISO Sec24d (Mus musculus) 6480464 bisphenol F results in increased expression of SEC24D mRNA CTD PMID:30951980 and PMID:38685157 Sec24d Rat bupropion increases response to substance ISO SEC24D (Homo sapiens) 6480464 SEC24D protein results in increased susceptibility to Bupropion CTD PMID:27555326 Sec24d Rat cadmium atom multiple interactions ISO SEC24D (Homo sapiens) 6480464 2-bromopalmitate inhibits the reaction [[Cadmium Chloride results in increased abundance of Cadmium] which results in increased palmitoylation of SEC24D protein] and [Cadmium Chloride results in increased abundance of Cadmium] which results in increased palmitoylation of SEC24D protein CTD PMID:38195004 Sec24d Rat cadmium dichloride multiple interactions ISO SEC24D (Homo sapiens) 6480464 2-bromopalmitate inhibits the reaction [[Cadmium Chloride results in increased abundance of Cadmium] which results in increased palmitoylation of SEC24D protein] and [Cadmium Chloride results in increased abundance of Cadmium] which results in increased palmitoylation of SEC24D protein CTD PMID:38195004 Sec24d Rat caffeine increases phosphorylation ISO SEC24D (Homo sapiens) 6480464 Caffeine results in increased phosphorylation of SEC24D protein CTD PMID:35688186 Sec24d Rat carbon nanotube increases expression ISO Sec24d (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 and PMID:25620056 Sec24d Rat cisplatin decreases expression ISO SEC24D (Homo sapiens) 6480464 Cisplatin results in decreased expression of SEC24D mRNA CTD PMID:27594783 Sec24d Rat cobalt dichloride increases expression ISO SEC24D (Homo sapiens) 6480464 cobaltous chloride results in increased expression of SEC24D mRNA CTD PMID:19376846 Sec24d Rat copper atom multiple interactions ISO SEC24D (Homo sapiens) 6480464 [NSC 689534 binds to Copper] which results in increased expression of SEC24D mRNA CTD PMID:20971185 Sec24d Rat copper(0) multiple interactions ISO SEC24D (Homo sapiens) 6480464 [NSC 689534 binds to Copper] which results in increased expression of SEC24D mRNA CTD PMID:20971185 Sec24d Rat copper(II) chloride increases expression ISO SEC24D (Homo sapiens) 6480464 cupric chloride results in increased expression of SEC24D mRNA CTD PMID:38568856 Sec24d Rat copper(II) sulfate decreases expression ISO SEC24D (Homo sapiens) 6480464 Copper Sulfate results in decreased expression of SEC24D mRNA CTD PMID:19549813 Sec24d Rat coumestrol decreases expression ISO SEC24D (Homo sapiens) 6480464 Coumestrol results in decreased expression of SEC24D mRNA CTD PMID:19167446 Sec24d Rat Cuprizon increases expression EXP 6480464 Cuprizone results in increased expression of SEC24D mRNA CTD PMID:26577399 Sec24d Rat cyclosporin A increases expression ISO SEC24D (Homo sapiens) 6480464 Cyclosporine results in increased expression of SEC24D mRNA CTD PMID:20106945 more ... Sec24d Rat cylindrospermopsin decreases expression ISO SEC24D (Homo sapiens) 6480464 cylindrospermopsin results in decreased expression of SEC24D mRNA CTD PMID:24921660 Sec24d Rat cyproconazole increases expression ISO Sec24d (Mus musculus) 6480464 cyproconazole results in increased expression of SEC24D mRNA CTD PMID:22334560 Sec24d Rat decabromodiphenyl ether decreases expression ISO SEC24D (Homo sapiens) 6480464 decabromobiphenyl ether results in decreased expression of SEC24D protein CTD PMID:31675489 Sec24d Rat Dibutyl phosphate affects expression ISO SEC24D (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of SEC24D mRNA CTD PMID:37042841 Sec24d Rat diuron increases expression EXP 6480464 Diuron results in increased expression of SEC24D mRNA CTD PMID:21551480 Sec24d Rat dorsomorphin multiple interactions ISO SEC24D (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Sec24d Rat doxorubicin decreases expression ISO SEC24D (Homo sapiens) 6480464 Doxorubicin results in decreased expression of SEC24D mRNA CTD PMID:29803840 Sec24d Rat endosulfan decreases expression EXP 6480464 Endosulfan results in decreased expression of SEC24D mRNA CTD PMID:29391264 Sec24d Rat entinostat increases expression ISO SEC24D (Homo sapiens) 6480464 entinostat results in increased expression of SEC24D mRNA CTD PMID:26272509 Sec24d Rat entinostat multiple interactions ISO SEC24D (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of SEC24D mRNA CTD PMID:27188386 Sec24d Rat enzyme inhibitor multiple interactions ISO SEC24D (Homo sapiens) 6480464 [Enzyme Inhibitors results in decreased activity of OGA protein] which results in increased O-linked glycosylation of SEC24D protein CTD PMID:23301498 Sec24d Rat epoxiconazole increases expression ISO Sec24d (Mus musculus) 6480464 epoxiconazole results in increased expression of SEC24D mRNA CTD PMID:22334560 and PMID:35436446 Sec24d Rat fenthion decreases expression ISO Sec24d (Mus musculus) 6480464 Fenthion results in decreased expression of SEC24D mRNA CTD PMID:34813904 Sec24d Rat flutamide increases expression EXP 6480464 Flutamide results in increased expression of SEC24D mRNA CTD PMID:24136188 Sec24d Rat folic acid multiple interactions ISO Sec24d (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of SEC24D mRNA CTD PMID:22206623 Sec24d Rat folic acid decreases expression ISO Sec24d (Mus musculus) 6480464 Folic Acid results in decreased expression of SEC24D mRNA CTD PMID:25629700 Sec24d Rat formaldehyde decreases expression ISO SEC24D (Homo sapiens) 6480464 Formaldehyde results in decreased expression of SEC24D mRNA CTD PMID:23649840 Sec24d Rat genistein increases expression ISO SEC24D (Homo sapiens) 6480464 Genistein results in increased expression of SEC24D mRNA CTD PMID:15378649 Sec24d Rat glyphosate increases methylation EXP 6480464 Glyphosate results in increased methylation of SEC24D gene CTD PMID:31011160 Sec24d Rat hydroquinone increases expression ISO SEC24D (Homo sapiens) 6480464 hydroquinone results in increased expression of SEC24D mRNA CTD PMID:31256213 Sec24d Rat ibogaine increases response to substance ISO SEC24D (Homo sapiens) 6480464 SEC24D protein results in increased susceptibility to Ibogaine CTD PMID:27555326 Sec24d Rat iron dichloride increases expression ISO SEC24D (Homo sapiens) 6480464 ferrous chloride results in increased expression of SEC24D mRNA CTD PMID:35984750 Sec24d Rat ivermectin decreases expression ISO SEC24D (Homo sapiens) 6480464 Ivermectin results in decreased expression of SEC24D protein CTD PMID:32959892 Sec24d Rat lead diacetate increases expression ISO SEC24D (Homo sapiens) 6480464 lead acetate results in increased expression of SEC24D mRNA CTD PMID:38568856 Sec24d Rat methapyrilene decreases expression EXP 6480464 Methapyrilene results in decreased expression of SEC24D mRNA CTD PMID:30467583 Sec24d Rat methidathion decreases expression ISO Sec24d (Mus musculus) 6480464 methidathion results in decreased expression of SEC24D mRNA CTD PMID:34813904 Sec24d Rat methotrexate affects expression ISO Sec24d (Mus musculus) 6480464 Methotrexate affects the expression of SEC24D mRNA CTD PMID:18502557 Sec24d Rat methyl methanesulfonate increases expression ISO SEC24D (Homo sapiens) 6480464 Methyl Methanesulfonate results in increased expression of SEC24D mRNA CTD PMID:23649840 Sec24d Rat methylmercury chloride increases expression ISO SEC24D (Homo sapiens) 6480464 methylmercuric chloride results in increased expression of SEC24D mRNA CTD PMID:23179753 and PMID:28001369 Sec24d Rat methylseleninic acid affects expression ISO SEC24D (Homo sapiens) 6480464 methylselenic acid affects the expression of SEC24D mRNA CTD PMID:14617803 Sec24d Rat nefazodone increases expression EXP 6480464 nefazodone results in increased expression of SEC24D mRNA CTD PMID:24136188 Sec24d Rat nickel atom increases expression ISO SEC24D (Homo sapiens) 6480464 Nickel results in increased expression of SEC24D mRNA CTD PMID:24768652 and PMID:25583101 Sec24d Rat nickel subsulfide increases expression EXP 6480464 nickel subsulfide results in increased expression of SEC24D mRNA CTD PMID:21086188 Sec24d Rat orlistat increases expression ISO SEC24D (Homo sapiens) 6480464 orlistat results in increased expression of SEC24D mRNA CTD PMID:18796435 Sec24d Rat oxaliplatin multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of SEC24D mRNA CTD PMID:25729387 Sec24d Rat panobinostat multiple interactions ISO SEC24D (Homo sapiens) 6480464 [NOG protein co-treated with Panobinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of SEC24D mRNA CTD PMID:27188386 Sec24d Rat panobinostat increases expression ISO SEC24D (Homo sapiens) 6480464 panobinostat results in increased expression of SEC24D mRNA CTD PMID:26272509 Sec24d Rat paracetamol affects expression ISO Sec24d (Mus musculus) 6480464 Acetaminophen affects the expression of SEC24D mRNA CTD PMID:17562736 Sec24d Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of SEC24D mRNA CTD PMID:33387578 Sec24d Rat phenylmercury acetate increases expression ISO SEC24D (Homo sapiens) 6480464 Phenylmercuric Acetate results in increased expression of SEC24D mRNA CTD PMID:26272509 Sec24d Rat phenylmercury acetate multiple interactions ISO SEC24D (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of SEC24D mRNA CTD PMID:27188386 Sec24d Rat pirinixic acid multiple interactions ISO SEC24D (Homo sapiens) 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in increased expression of SEC24D mRNA CTD PMID:19710929 Sec24d Rat pirinixic acid decreases expression ISO Sec24d (Mus musculus) 6480464 pirinixic acid results in decreased expression of SEC24D mRNA CTD PMID:23811191 Sec24d Rat propiconazole increases expression ISO Sec24d (Mus musculus) 6480464 propiconazole results in increased expression of SEC24D mRNA CTD PMID:21278054 and PMID:22334560 Sec24d Rat quercetin decreases expression ISO SEC24D (Homo sapiens) 6480464 Quercetin results in decreased expression of SEC24D mRNA CTD PMID:21632981 Sec24d Rat SB 431542 multiple interactions ISO SEC24D (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Sec24d Rat sodium arsenite increases stability ISO SEC24D (Homo sapiens) 6480464 sodium arsenite results in increased stability of SEC24D mRNA CTD PMID:25493608 Sec24d Rat sodium arsenite decreases expression ISO SEC24D (Homo sapiens) 6480464 sodium arsenite results in decreased expression of SEC24D mRNA and sodium arsenite results in decreased expression of SEC24D protein CTD PMID:30528433 and PMID:34032870 Sec24d Rat sodium arsenite increases expression ISO SEC24D (Homo sapiens) 6480464 sodium arsenite results in increased expression of SEC24D mRNA CTD PMID:38568856 Sec24d Rat sodium arsenite increases expression ISO Sec24d (Mus musculus) 6480464 sodium arsenite results in increased expression of SEC24D mRNA CTD PMID:25270620 Sec24d Rat sunitinib increases expression ISO SEC24D (Homo sapiens) 6480464 Sunitinib results in increased expression of SEC24D mRNA CTD PMID:31533062 Sec24d Rat temozolomide decreases expression ISO SEC24D (Homo sapiens) 6480464 Temozolomide results in decreased expression of SEC24D mRNA CTD PMID:31758290 Sec24d Rat testosterone decreases expression ISO Sec24d (Mus musculus) 6480464 Testosterone deficiency results in decreased expression of SEC24D mRNA CTD PMID:33848595 Sec24d Rat tetrachloromethane increases expression ISO Sec24d (Mus musculus) 6480464 Carbon Tetrachloride results in increased expression of SEC24D mRNA CTD PMID:31919559 Sec24d Rat thiram increases expression ISO SEC24D (Homo sapiens) 6480464 Thiram results in increased expression of SEC24D mRNA CTD PMID:38568856 Sec24d Rat titanium dioxide decreases expression ISO Sec24d (Mus musculus) 6480464 titanium dioxide results in decreased expression of SEC24D mRNA CTD PMID:29264374 Sec24d Rat topotecan multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of SEC24D mRNA CTD PMID:25729387 Sec24d Rat trichostatin A increases expression ISO SEC24D (Homo sapiens) 6480464 trichostatin A results in increased expression of SEC24D mRNA CTD PMID:24935251 and PMID:26272509 Sec24d Rat trichostatin A multiple interactions ISO SEC24D (Homo sapiens) 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of SEC24D mRNA CTD PMID:27188386 Sec24d Rat trovafloxacin decreases expression EXP 6480464 trovafloxacin results in decreased expression of SEC24D mRNA CTD PMID:24136188 Sec24d Rat tunicamycin increases expression ISO SEC24D (Homo sapiens) 6480464 Tunicamycin results in increased expression of SEC24D mRNA and Tunicamycin results in increased expression of SEC24D protein CTD PMID:29453283 Sec24d Rat valproic acid affects expression ISO Sec24d (Mus musculus) 6480464 Valproic Acid affects the expression of SEC24D mRNA CTD PMID:17292431 Sec24d Rat valproic acid increases expression ISO Sec24d (Mus musculus) 6480464 Valproic Acid results in increased expression of SEC24D mRNA CTD PMID:19136453 and PMID:24896083 Sec24d Rat valproic acid increases expression ISO SEC24D (Homo sapiens) 6480464 Valproic Acid results in increased expression of SEC24D mRNA CTD PMID:23179753 more ... Sec24d Rat valproic acid multiple interactions ISO SEC24D (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of SEC24D mRNA CTD PMID:27188386
1,2-dimethylhydrazine (ISO) 17beta-estradiol (ISO) 17beta-hydroxy-5alpha-androstan-3-one (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4,6-tribromophenol (ISO) 2,4-dinitrotoluene (EXP) 2-bromohexadecanoic acid (ISO) 4,4'-sulfonyldiphenol (ISO) aflatoxin B1 (ISO) all-trans-retinoic acid (ISO) amphetamine (EXP) aristolochic acid A (ISO) arsenite(3-) (ISO) avobenzone (ISO) Benoxacor (ISO) benzo[a]pyrene (ISO) beta-lapachone (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol AF (ISO) Bisphenol B (ISO) bisphenol F (ISO) bupropion (ISO) cadmium atom (ISO) cadmium dichloride (ISO) caffeine (ISO) carbon nanotube (ISO) cisplatin (ISO) cobalt dichloride (ISO) copper atom (ISO) copper(0) (ISO) copper(II) chloride (ISO) copper(II) sulfate (ISO) coumestrol (ISO) Cuprizon (EXP) cyclosporin A (ISO) cylindrospermopsin (ISO) cyproconazole (ISO) decabromodiphenyl ether (ISO) Dibutyl phosphate (ISO) diuron (EXP) dorsomorphin (ISO) doxorubicin (ISO) endosulfan (EXP) entinostat (ISO) enzyme inhibitor (ISO) epoxiconazole (ISO) fenthion (ISO) flutamide (EXP) folic acid (ISO) formaldehyde (ISO) genistein (ISO) glyphosate (EXP) hydroquinone (ISO) ibogaine (ISO) iron dichloride (ISO) ivermectin (ISO) lead diacetate (ISO) methapyrilene (EXP) methidathion (ISO) methotrexate (ISO) methyl methanesulfonate (ISO) methylmercury chloride (ISO) methylseleninic acid (ISO) nefazodone (EXP) nickel atom (ISO) nickel subsulfide (EXP) orlistat (ISO) oxaliplatin (EXP) panobinostat (ISO) paracetamol (EXP,ISO) phenylmercury acetate (ISO) pirinixic acid (ISO) propiconazole (ISO) quercetin (ISO) SB 431542 (ISO) sodium arsenite (ISO) sunitinib (ISO) temozolomide (ISO) testosterone (ISO) tetrachloromethane (ISO) thiram (ISO) titanium dioxide (ISO) topotecan (EXP) trichostatin A (ISO) trovafloxacin (EXP) tunicamycin (ISO) valproic acid (ISO)
Sec24d Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 2 214,103,138 - 214,211,155 (+) NCBI GRCr8 mRatBN7.2 2 211,418,557 - 211,526,588 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 2 211,418,623 - 211,526,587 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 2 219,091,582 - 219,198,356 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 2 216,991,462 - 217,098,234 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 2 211,845,703 - 211,952,480 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 2 227,455,704 - 227,562,801 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 2 227,455,722 - 227,562,319 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 2 246,815,650 - 246,919,957 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 2 219,985,811 - 220,096,797 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 2 219,950,676 - 220,059,192 (+) NCBI Celera 2 203,833,456 - 203,940,242 (+) NCBI Celera Cytogenetic Map 2 q42 NCBI
SEC24D Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 4 118,722,823 - 118,836,126 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 4 118,722,823 - 118,838,683 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 4 119,643,978 - 119,757,281 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 4 119,863,427 - 119,976,702 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 4 120,001,581 - 120,114,857 NCBI Celera 4 117,004,529 - 117,117,866 (-) NCBI Celera Cytogenetic Map 4 q26 NCBI HuRef 4 115,365,531 - 115,479,569 (-) NCBI HuRef CHM1_1 4 119,619,921 - 119,733,840 (-) NCBI CHM1_1 T2T-CHM13v2.0 4 122,028,139 - 122,141,474 (-) NCBI T2T-CHM13v2.0
Sec24d Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 3 123,058,451 - 123,159,290 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 3 123,061,104 - 123,159,290 (+) Ensembl GRCm39 Ensembl GRCm38 3 123,264,801 - 123,365,641 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 3 123,267,455 - 123,365,641 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 3 122,970,414 - 123,068,554 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 3 123,259,518 - 123,357,658 (+) NCBI MGSCv36 mm8 Celera 3 129,677,953 - 129,787,733 (+) NCBI Celera Cytogenetic Map 3 G1 NCBI cM Map 3 53.82 NCBI
Sec24d Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955428 21,381,809 - 21,500,429 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955428 21,381,809 - 21,475,329 (+) NCBI ChiLan1.0 ChiLan1.0
SEC24D Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 3 116,505,263 - 116,622,112 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 4 116,802,002 - 116,918,966 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 4 110,916,508 - 111,033,298 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 4 121,468,914 - 121,584,647 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 4 121,468,914 - 121,582,156 (-) Ensembl panpan1.1 panPan2
SEC24D Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 32 37,690,158 - 37,795,762 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 32 37,690,399 - 37,924,252 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 32 4,279,402 - 4,383,982 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 32 37,911,481 - 38,017,151 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 32 37,911,481 - 38,014,944 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 32 37,933,932 - 38,039,567 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 32 37,657,914 - 37,762,852 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 32 2,038,782 - 2,143,773 (+) NCBI UU_Cfam_GSD_1.0
Sec24d
SEC24D Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 8 104,882,035 - 105,005,398 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 8 104,560,723 - 105,005,400 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 8 112,778,267 - 112,789,489 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
SEC24D Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 7 66,208,005 - 66,318,222 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 7 66,207,765 - 66,318,206 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666037 45,045,256 - 45,155,626 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Sec24d
.
Predicted Target Of
Count of predictions: 506 Count of miRNA genes: 232 Interacting mature miRNAs: 264 Transcripts: ENSRNOT00000064809 Prediction methods: Microtar, Miranda, Targetscan Result types: miRGate_prediction
1358356 Srcrt1 Stress Responsive Cort QTL1 3.66 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 2 163997722 225110681 Rat 1578648 Bss11 Bone structure and strength QTL 11 4.7 femur morphology trait (VT:0000559) femoral neck cortical cross-sectional area (CMO:0001702) 2 169358774 214358774 Rat 1331734 Bp204 Blood pressure QTL 204 3.61192 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 170656145 239614549 Rat 631563 Hcuc3 Hepatic copper content QTL 3 3.87 liver copper amount (VT:0003065) liver copper weight to liver dry weight ratio (CMO:0001512) 2 212145502 231732847 Rat 631566 Bp90 Blood pressure QTL 90 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 149957381 221199885 Rat 1354648 Bp239 Blood pressure QTL 239 0.001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 67845370 229470703 Rat 1354649 Kidm17 Kidney mass QTL 17 2.9 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 2 83465462 229820014 Rat 1300126 Bp175 Blood pressure QTL 175 3.46 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 204795005 249795005 Rat 1581576 Pur7 Proteinuria QTL 7 0.0001 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 2 80396178 220931218 Rat 1581578 Cm49 Cardiac mass QTL 49 4.9 0.01 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 2 145807215 220931416 Rat 61458 Bp10 Blood pressure QTL 10 3.42 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 191709311 217961898 Rat 1302789 Stl26 Serum triglyceride level QTL 26 3.1 0.0035 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 2 206613059 226891081 Rat 1554319 Bmd2 Bone mineral density QTL 2 13.4 0.0001 lumbar vertebra area (VT:0010570) lumbar vertebra cross-sectional area (CMO:0001689) 2 122597372 215234002 Rat 1581569 Uae32 Urinary albumin excretion QTL 32 0.0001 urine protein amount (VT:0005160) urine albumin excretion rate (CMO:0000757) 2 80396178 220931218 Rat 2317752 Glom23 Glomerulus QTL 23 3.6 urine protein amount (VT:0005160) urine protein level (CMO:0000591) 2 196140964 251540988 Rat 61467 Bp14 Blood pressure QTL 14 2.2 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 205135267 250135267 Rat 1549833 Bp257 Blood pressure QTL 257 0.003 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 170652929 215652929 Rat 70175 BpQTLCluster3 Blood pressure QTL cluster 3 4.128 arterial blood pressure trait (VT:2000000) absolute change in systolic blood pressure (CMO:0000607) 2 205135267 250135267 Rat 1358900 Bw48 Body weight QTL 48 4.88 body mass (VT:0001259) body weight (CMO:0000012) 2 159440891 220931218 Rat 1359031 Bp275 Blood pressure QTL 275 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 2 188565047 233565047 Rat 1581499 Esta2 Estrogen-induced thymic atrophy QTL 2 thymus mass (VT:0004954) thymus wet weight (CMO:0000855) 2 192287802 229609668 Rat 9589044 Scfw1 Subcutaneous fat weight QTL 1 5.8 0.001 subcutaneous adipose mass (VT:1000472) abdominal subcutaneous fat pad weight (CMO:0002069) 2 184856304 229856304 Rat 8694435 Bw166 Body weight QTL 166 14.08 0.001 retroperitoneal fat pad mass (VT:0010430) retroperitoneal fat pad weight to body weight ratio (CMO:0000635) 2 184856304 229856304 Rat 631203 Gluco14 Glucose level QTL 14 0.0001 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 2 209350500 221678003 Rat 1298083 Bp158 Blood pressure QTL 158 2.62 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 191709311 217961898 Rat 1357991 Ael2 Aortic elastin QTL 2 4.2 0.000071 aorta elastin amount (VT:0003905) aortic elastin 2 169227906 214227906 Rat 8662832 Vetf7 Vascular elastic tissue fragility QTL 7 3.5 aorta elastin amount (VT:0003905) aorta wall extracellular elastin dry weight to aorta wall dry weight ratio (CMO:0002002) 2 83400752 223709938 Rat 1331745 Bp203 Blood pressure QTL 203 4.377 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 192287802 221089121 Rat 8694194 Abfw1 Abdominal fat weight QTL 1 11.7 0.001 visceral adipose mass (VT:0010063) abdominal fat pad weight to body weight ratio (CMO:0000095) 2 184856304 229856304 Rat 61366 Iddm3 Insulin dependent diabetes mellitus QTL 3 4.7 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 2 192287802 237287802 Rat 1578671 Bmd10 Bone mineral density QTL 10 5.4 femur mineral mass (VT:0010011) compact volumetric bone mineral density (CMO:0001730) 2 175931416 220931416 Rat 1641891 Alcrsp17 Alcohol response QTL 17 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 2 151869660 251712708 Rat 724534 Uae6 Urinary albumin excretion QTL 6 10 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 2 80396034 220931416 Rat 2300189 Bmd48 Bone mineral density QTL 48 5.8 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 2 182024327 227024327 Rat 8662843 Vetf9 Vascular elastic tissue fragility QTL 9 2.05 thoracic aorta molecular composition trait (VT:0010568) aorta wall extracellular elastin dry weight to aorta wall extracellular collagen weight ratio (CMO:0002003) 2 159440760 228950743 Rat 2301408 Kidm36 Kidney mass QTL 36 0.002 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 2 184482291 229482291 Rat 631501 Bp101 Blood pressure QTL 101 2.4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 205135267 250135267 Rat 1598813 Memor9 Memory QTL 9 2.7 exploratory behavior trait (VT:0010471) average horizontal distance between subject and target during voluntary locomotion in an experimental apparatus (CMO:0002674) 2 202029709 236904960 Rat 2307174 Activ3 Activity QTL 3 4.83 0.000058 locomotor behavior trait (VT:0001392) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 2 210956252 251712708 Rat 1331794 Bp202 Blood pressure QTL 202 3.66819 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 143344967 251712708 Rat 1331805 Cm29 Cardiac mass QTL 29 3.50746 heart mass (VT:0007028) heart wet weight (CMO:0000069) 2 143344967 251712708 Rat 2298479 Eau5 Experimental allergic uveoretinitis QTL 5 0.0021 uvea integrity trait (VT:0010551) experimental autoimmune uveitis score (CMO:0001504) 2 205135267 225627153 Rat 634308 Sach6 Saccharin preference QTL 6 4.9 taste sensitivity trait (VT:0001986) saccharin intake volume to total fluid intake volume ratio (CMO:0001601) 2 114384617 215381366 Rat 738013 Alc15 Alcohol consumption QTL 15 4.1 0.00022 consumption behavior trait (VT:0002069) ethanol drink intake rate to body weight ratio (CMO:0001616) 2 186850607 231850607 Rat 61398 Bp50 Blood pressure QTL 50 4.4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 192287802 237287802 Rat 631507 Bp105 Blood pressure QTL 105 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 114384617 215381366 Rat 1641925 Alcrsp2 Alcohol response QTL 2 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 2 151869660 223841096 Rat 61417 Cia10 Collagen induced arthritis QTL 10 3.4 joint integrity trait (VT:0010548) experimental arthritis severity measurement (CMO:0001459) 2 182635347 227635347 Rat 1354622 Kidm16 Kidney mass QTL 16 3 kidney mass (VT:0002707) left kidney wet weight (CMO:0000083) 2 83465462 225110681 Rat 631522 Bp74 Blood pressure QTL 74 0.05 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 175008837 220008837 Rat 8694383 Bw158 Body weight QTL 158 7.69 0.001 body lean mass (VT:0010483) lean tissue morphological measurement (CMO:0002184) 2 184856304 229856304 Rat 1598835 Anxrr18 Anxiety related response QTL 18 2.98 body movement coordination trait (VT:0005424) number of rearing movements in an experimental apparatus (CMO:0001752) 2 203664411 248664411 Rat 2306901 Bp337 Blood pressure QTL 337 0.01 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 166372086 229820014 Rat
UniSTS:234818
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 2 211,510,769 - 211,510,858 (+) MAPPER mRatBN7.2 Rnor_6.0 2 227,545,448 - 227,545,536 NCBI Rnor6.0 Rnor_5.0 2 246,904,396 - 246,904,484 UniSTS Rnor5.0 RGSC_v3.4 2 220,081,023 - 220,081,111 UniSTS RGSC3.4 Celera 2 203,924,201 - 203,924,289 UniSTS Cytogenetic Map 2 q42 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000064809 ⟹ ENSRNOP00000059031
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 2 211,418,623 - 211,526,587 (+) Ensembl Rnor_6.0 Ensembl 2 227,455,722 - 227,562,319 (+) Ensembl
RefSeq Acc Id:
NM_001309453 ⟹ NP_001296382
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 214,103,200 - 214,211,155 (+) NCBI mRatBN7.2 2 211,418,623 - 211,526,588 (+) NCBI Rnor_6.0 2 227,455,723 - 227,562,801 (+) NCBI Celera 2 203,833,456 - 203,940,242 (+) NCBI
Sequence:
ACTCGCAGCCCAGAGCGACTCGGCGGCGGCGGCGGTGGCGCGGGGCGCGGAGCGTGCAGAGCAGGATTCTTCTGCAGTAGCTCTCCTTTGGAATGATATTTTCATAATGAGCCAACAAGGTTACGTGG
hide sequence
RefSeq Acc Id:
XM_006233272 ⟹ XP_006233334
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 214,103,138 - 214,211,145 (+) NCBI mRatBN7.2 2 211,418,557 - 211,526,588 (+) NCBI Rnor_6.0 2 227,455,704 - 227,562,801 (+) NCBI Rnor_5.0 2 246,815,650 - 246,919,957 (+) NCBI
Sequence:
GCCGGGCGCCTGACGTGGCACTCGCAGCCCAGAGCGACTCGGCGGCGGCGGCGGTGGCGCGGGGCGCGGAGCGTGCAGAGCAGGATTCTTCTGCAGTAGCTCTCCTTTGGAATGATATTTTCATAATG
hide sequence
RefSeq Acc Id:
XP_006233334 ⟸ XM_006233272
- Peptide Label:
isoform X1
- UniProtKB:
G3V9S9 (UniProtKB/TrEMBL)
- Sequence:
MSQQGYVATPPYSQSQPGMGISPPHYGHYGDPSHVSSPPGMMKPPGPTGATAPSGLLPPGPLPPGPPQFGPNGAHAAGHPPQRFPGHPPVNNAAPPYASGQPLPQSSYPGPGSTSSVTQLGSQFGSMQ
hide sequence
RefSeq Acc Id:
NP_001296382 ⟸ NM_001309453
- UniProtKB:
B5DF68 (UniProtKB/TrEMBL), G3V9S9 (UniProtKB/TrEMBL), A6HVI6 (UniProtKB/TrEMBL)
- Sequence:
MSQQGYVATPPYSQSQPGMGISPPHYGHYGDPSHVSSPPGMMKPPGPTGATAPSGLLPPGPLPP
hide sequence
Ensembl Acc Id:
ENSRNOP00000059031 ⟸ ENSRNOT00000064809
RGD ID: 13691737 Promoter ID: EPDNEW_R2258 Type: initiation region Name: Sec24d_1 Description: SEC24 homolog D, COPII coat complex component SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 2 227,455,723 - 227,455,783 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2015-08-13
Sec24d
SEC24 homolog D, COPII coat complex component
Sec24d
SEC24 family member D
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2013-11-11
Sec24d
SEC24 family member D
Sec24d
SEC24 family, member D (S. cerevisiae)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-11-20
Sec24d
SEC24 family, member D (S. cerevisiae)
Sec24d
SEC24 related gene family, member D (S. cerevisiae)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-04-30
Sec24d
SEC24 related gene family, member D (S. cerevisiae)
Sec24d_predicted
SEC24 related gene family, member D (S. cerevisiae) (predicted)
'predicted' is removed
2292626 APPROVED
2005-01-12
Sec24d_predicted
SEC24 related gene family, member D (S. cerevisiae) (predicted)
Symbol and Name status set to approved
70820 APPROVED
