Advanced Search (OLGA)

Gene: Ttll3 (tubulin tyrosine ligase like 3) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Ttll3

Name:

tubulin tyrosine ligase like 3

RGD ID:

1311255

Description:

Predicted to enable protein-glycine ligase activity, initiating. Predicted to be involved in several processes, including axoneme assembly; flagellated sperm motility; and protein polyglycylation. Predicted to act upstream of or within cilium assembly. Predicted to be located in cilium. Predicted to be active in axoneme; microtubule cytoskeleton; and sperm flagellum. Orthologous to human TTLL3 (tubulin tyrosine ligase like 3); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 6-propyl-2-thiouracil; acetamide.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

LOC362415; tubulin monoglycylase TTLL3; tubulin tyrosine ligase-like family, member 3

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	TTLL3 (tubulin tyrosine ligase like 3)	HGNC	Ensembl, HomoloGene, Inparanoid, OMA, OrthoDB, Panther, Treefam
Mus musculus (house mouse):	Ttll3 (tubulin tyrosine ligase-like family, member 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Ttll3 (tubulin tyrosine ligase like 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	TTLL3 (tubulin tyrosine ligase like 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	TTLL3 (tubulin tyrosine ligase like 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	TTLL3 (tubulin tyrosine ligase like 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	TTLL3 (tubulin tyrosine ligase like 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	ARPC4-TTLL3 (ARPC4-TTLL3 readthrough)	HGNC	OrthoDB, Treefam
Homo sapiens (human):	CFAP263 (cilia and flagella associated protein 263)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	TTLL3 (tubulin tyrosine ligase like 3)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Ttll3 (tubulin tyrosine ligase-like family, member 3)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	ttll3 (tubulin tyrosine ligase-like family, member 3)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	TTLL3B	Alliance	DIOPT (OMA\|OrthoFinder\|PANTHER\|PhylomeDB)
Drosophila melanogaster (fruit fly):	TTLL3A	Alliance	DIOPT (Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	ttll3	Alliance	DIOPT (OrthoFinder\|OrthoInspector\|PANTHER)
Xenopus tropicalis (tropical clawed frog):	XB5950141 [provisional]	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	4	148,088,575 - 148,113,526 (+)	NCBI		GRCr8
mRatBN7.2	4	146,532,958 - 146,558,425 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	4	146,533,953 - 146,557,889 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	4	151,918,070 - 151,941,859 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	4	147,698,921 - 147,722,704 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	4	146,320,479 - 146,344,323 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	4	145,341,059 - 145,366,614 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	4	145,342,193 - 145,365,496 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	4	208,639,199 - 208,663,129 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	4	149,280,690 - 149,282,413 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	4	149,518,583 - 149,541,367 (+)	NCBI
Celera	4	135,091,168 - 135,114,283 (+)	NCBI		Celera
Cytogenetic Map	4	q42	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ttll3	Rat	Atrioventricular Septal Defect 2		ISO	TTLL3 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Atrioventricular septal defect more ...	ClinVar	PMID:28492532
Ttll3	Rat	long QT syndrome		ISO	TTLL3 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Long QT syndrome	ClinVar	PMID:28492532
Ttll3	Rat	myoclonic-atonic epilepsy		ISO	TTLL3 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Myoclonic-atonic epilepsy	ClinVar	PMID:25865495 more ...
Ttll3	Rat	Neurodevelopmental Disorders		ISO	TTLL3 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Neurodevelopmental disorder	ClinVar	PMID:25741868

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ttll3	Rat	2,3,7,8-tetrachlorodibenzodioxine	increases expression	EXP		6480464	Tetrachlorodibenzodioxin results in increased expression of TTLL3 mRNA	CTD	PMID:32109520
Ttll3	Rat	3-isobutyl-1-methyl-7H-xanthine	multiple interactions	ISO	TTLL3 (Homo sapiens)	6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in decreased expression of TTLL3 mRNA and [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] results in decreased expression of TTLL3 mRNA	CTD	PMID:28628672
Ttll3	Rat	4,4'-sulfonyldiphenol	multiple interactions	ISO	TTLL3 (Homo sapiens)	6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] results in decreased expression of TTLL3 mRNA	CTD	PMID:28628672
Ttll3	Rat	4-hydroxyphenyl retinamide	increases expression	ISO	Ttll3 (Mus musculus)	6480464	Fenretinide results in increased expression of TTLL3 mRNA	CTD	PMID:28973697
Ttll3	Rat	6-propyl-2-thiouracil	decreases expression	EXP		6480464	Propylthiouracil results in decreased expression of TTLL3 mRNA	CTD	PMID:25825206 and PMID:30047161
Ttll3	Rat	acetamide	increases expression	EXP		6480464	acetamide results in increased expression of TTLL3 mRNA	CTD	PMID:31881176
Ttll3	Rat	all-trans-retinoic acid	multiple interactions	ISO	Ttll3 (Mus musculus)	6480464	[mono-(2-ethylhexyl)phthalate co-treated with Tretinoin] results in decreased expression of TTLL3 mRNA	CTD	PMID:36189433
Ttll3	Rat	all-trans-retinoic acid	increases expression	ISO	TTLL3 (Homo sapiens)	6480464	Tretinoin results in increased expression of TTLL3 mRNA	CTD	PMID:33167477
Ttll3	Rat	alpha-Zearalanol	multiple interactions	EXP		6480464	[Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of TTLL3 mRNA	CTD	PMID:35163327
Ttll3	Rat	amiodarone	increases expression	ISO	TTLL3 (Homo sapiens)	6480464	Amiodarone results in increased expression of TTLL3 mRNA	CTD	PMID:19774075
Ttll3	Rat	amitrole	decreases expression	EXP		6480464	Amitrole results in decreased expression of TTLL3 mRNA	CTD	PMID:30047161
Ttll3	Rat	antirheumatic drug	increases expression	ISO	TTLL3 (Homo sapiens)	6480464	Antirheumatic Agents results in increased expression of TTLL3 mRNA	CTD	PMID:24449571
Ttll3	Rat	aristolochic acid A	increases expression	ISO	TTLL3 (Homo sapiens)	6480464	aristolochic acid I results in increased expression of TTLL3 mRNA	CTD	PMID:33212167
Ttll3	Rat	benzo[a]pyrene	increases methylation	ISO	TTLL3 (Homo sapiens)	6480464	Benzo(a)pyrene results in increased methylation of TTLL3 promoter	CTD	PMID:27901495
Ttll3	Rat	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of TTLL3 mRNA	CTD	PMID:25181051 and PMID:32145629
Ttll3	Rat	bisphenol A	decreases expression	ISO	Ttll3 (Mus musculus)	6480464	bisphenol A results in decreased expression of TTLL3 mRNA	CTD	PMID:32156529
Ttll3	Rat	bisphenol A	increases expression	EXP		6480464	bisphenol A results in increased expression of TTLL3 mRNA	CTD	PMID:34947998
Ttll3	Rat	bisphenol A	increases methylation	ISO	Ttll3 (Mus musculus)	6480464	bisphenol A results in increased methylation of TTLL3 promoter	CTD	PMID:27312807
Ttll3	Rat	bisphenol F	multiple interactions	ISO	TTLL3 (Homo sapiens)	6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in decreased expression of TTLL3 mRNA	CTD	PMID:28628672
Ttll3	Rat	bisphenol F	decreases expression	ISO	Ttll3 (Mus musculus)	6480464	bisphenol F results in decreased expression of TTLL3 mRNA	CTD	PMID:38685157
Ttll3	Rat	Bisphenol Z	increases expression	ISO	TTLL3 (Homo sapiens)	6480464	bisphenol Z results in increased expression of TTLL3 mRNA	CTD	PMID:32387340
Ttll3	Rat	butanal	decreases expression	ISO	TTLL3 (Homo sapiens)	6480464	butyraldehyde results in decreased expression of TTLL3 mRNA	CTD	PMID:26079696
Ttll3	Rat	cadmium atom	multiple interactions	ISO	Ttll3 (Mus musculus)	6480464	[Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of TTLL3 mRNA	CTD	PMID:37325564
Ttll3	Rat	cadmium dichloride	multiple interactions	ISO	Ttll3 (Mus musculus)	6480464	[Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of TTLL3 mRNA	CTD	PMID:37325564
Ttll3	Rat	carbon nanotube	decreases expression	ISO	Ttll3 (Mus musculus)	6480464	Nanotubes more ...	CTD	PMID:25554681
Ttll3	Rat	choline	multiple interactions	ISO	Ttll3 (Mus musculus)	6480464	[Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of TTLL3 mRNA	CTD	PMID:20938992
Ttll3	Rat	copper atom	multiple interactions	ISO	TTLL3 (Homo sapiens)	6480464	[NSC 689534 binds to Copper] which results in increased expression of TTLL3 mRNA	CTD	PMID:20971185
Ttll3	Rat	copper(0)	multiple interactions	ISO	TTLL3 (Homo sapiens)	6480464	[NSC 689534 binds to Copper] which results in increased expression of TTLL3 mRNA	CTD	PMID:20971185
Ttll3	Rat	Cuprizon	increases expression	EXP		6480464	Cuprizone results in increased expression of TTLL3 mRNA	CTD	PMID:26577399
Ttll3	Rat	dexamethasone	multiple interactions	ISO	TTLL3 (Homo sapiens)	6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in decreased expression of TTLL3 mRNA and [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] results in decreased expression of TTLL3 mRNA	CTD	PMID:28628672
Ttll3	Rat	dibenz[a,h]anthracene	decreases expression	ISO	Ttll3 (Mus musculus)	6480464	1 more ...	CTD	PMID:26377693
Ttll3	Rat	dimethylarsinic acid	multiple interactions	ISO	Ttll3 (Mus musculus)	6480464	[sodium arsenate co-treated with sodium arsenite co-treated with monomethylarsonic acid co-treated with Cacodylic Acid] results in decreased expression of TTLL3 mRNA	CTD	PMID:34876320
Ttll3	Rat	doxorubicin	decreases expression	ISO	TTLL3 (Homo sapiens)	6480464	Doxorubicin results in decreased expression of TTLL3 mRNA	CTD	PMID:29803840
Ttll3	Rat	endosulfan	increases expression	EXP		6480464	Endosulfan results in increased expression of TTLL3 mRNA	CTD	PMID:29391264
Ttll3	Rat	folic acid	multiple interactions	ISO	Ttll3 (Mus musculus)	6480464	[Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of TTLL3 mRNA	CTD	PMID:20938992
Ttll3	Rat	hypochlorous acid	decreases expression	ISO	Ttll3 (Mus musculus)	6480464	Hypochlorous Acid results in decreased expression of TTLL3 mRNA	CTD	PMID:19376150
Ttll3	Rat	indometacin	multiple interactions	ISO	TTLL3 (Homo sapiens)	6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in decreased expression of TTLL3 mRNA and [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] results in decreased expression of TTLL3 mRNA	CTD	PMID:28628672
Ttll3	Rat	L-methionine	multiple interactions	ISO	Ttll3 (Mus musculus)	6480464	[Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of TTLL3 mRNA	CTD	PMID:20938992
Ttll3	Rat	methimazole	decreases expression	EXP		6480464	Methimazole results in decreased expression of TTLL3 mRNA	CTD	PMID:30047161
Ttll3	Rat	methylarsonic acid	multiple interactions	ISO	Ttll3 (Mus musculus)	6480464	[sodium arsenate co-treated with sodium arsenite co-treated with monomethylarsonic acid co-treated with Cacodylic Acid] results in decreased expression of TTLL3 mRNA	CTD	PMID:34876320
Ttll3	Rat	mono(2-ethylhexyl) phthalate	multiple interactions	ISO	Ttll3 (Mus musculus)	6480464	[mono-(2-ethylhexyl)phthalate co-treated with Tretinoin] results in decreased expression of TTLL3 mRNA	CTD	PMID:36189433
Ttll3	Rat	N-acetyl-beta-D-glucosamine	decreases expression	ISO	TTLL3 (Homo sapiens)	6480464	Acetylglucosamine results in decreased expression of TTLL3 mRNA	CTD	PMID:18047607
Ttll3	Rat	N-acetyl-D-glucosamine	decreases expression	ISO	TTLL3 (Homo sapiens)	6480464	Acetylglucosamine results in decreased expression of TTLL3 mRNA	CTD	PMID:18047607
Ttll3	Rat	N-methyl-4-phenylpyridinium	increases expression	EXP		6480464	1-Methyl-4-phenylpyridinium results in increased expression of TTLL3 mRNA	CTD	PMID:28801915
Ttll3	Rat	niclosamide	increases expression	ISO	TTLL3 (Homo sapiens)	6480464	Niclosamide results in increased expression of TTLL3 mRNA	CTD	PMID:36318118
Ttll3	Rat	paracetamol	increases expression	ISO	TTLL3 (Homo sapiens)	6480464	Acetaminophen results in increased expression of TTLL3 mRNA	CTD	PMID:22230336
Ttll3	Rat	paracetamol	increases expression	EXP		6480464	Acetaminophen results in increased expression of TTLL3 mRNA	CTD	PMID:33387578
Ttll3	Rat	perfluorohexanesulfonic acid	decreases expression	ISO	Ttll3 (Mus musculus)	6480464	perfluorohexanesulfonic acid results in decreased expression of TTLL3 mRNA	CTD	PMID:37995155
Ttll3	Rat	perfluorooctanoic acid	multiple interactions	EXP		6480464	[Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of TTLL3 mRNA	CTD	PMID:35163327
Ttll3	Rat	potassium dichromate	decreases expression	ISO	Ttll3 (Mus musculus)	6480464	Potassium Dichromate results in decreased expression of TTLL3 mRNA	CTD	PMID:23608068
Ttll3	Rat	quercetin	increases expression	ISO	TTLL3 (Homo sapiens)	6480464	Quercetin results in increased expression of TTLL3 mRNA	CTD	PMID:21632981
Ttll3	Rat	rotenone	affects expression	ISO	Ttll3 (Mus musculus)	6480464	Rotenone affects the expression of TTLL3 mRNA	CTD	PMID:21893155
Ttll3	Rat	rotenone	multiple interactions	ISO	Ttll3 (Mus musculus)	6480464	TRP53 affects the reaction [Rotenone affects the expression of TTLL3 mRNA]	CTD	PMID:21893155
Ttll3	Rat	silicon dioxide	increases expression	ISO	Ttll3 (Mus musculus)	6480464	Silicon Dioxide results in increased expression of TTLL3 mRNA	CTD	PMID:19073995
Ttll3	Rat	sodium arsenate	multiple interactions	ISO	Ttll3 (Mus musculus)	6480464	[sodium arsenate co-treated with sodium arsenite co-treated with monomethylarsonic acid co-treated with Cacodylic Acid] results in decreased expression of TTLL3 mRNA	CTD	PMID:34876320
Ttll3	Rat	sodium arsenite	increases expression	ISO	TTLL3 (Homo sapiens)	6480464	sodium arsenite results in increased expression of TTLL3 mRNA	CTD	PMID:38568856
Ttll3	Rat	sodium arsenite	multiple interactions	ISO	Ttll3 (Mus musculus)	6480464	[sodium arsenate co-treated with sodium arsenite co-treated with monomethylarsonic acid co-treated with Cacodylic Acid] results in decreased expression of TTLL3 mRNA	CTD	PMID:34876320
Ttll3	Rat	sulfadimethoxine	decreases expression	EXP		6480464	Sulfadimethoxine results in decreased expression of TTLL3 mRNA	CTD	PMID:30047161
Ttll3	Rat	sunitinib	increases expression	ISO	TTLL3 (Homo sapiens)	6480464	Sunitinib results in increased expression of TTLL3 mRNA	CTD	PMID:31533062
Ttll3	Rat	theophylline	affects binding	ISO	TTLL3 (Homo sapiens)	6480464	Theophylline binds to TTLL3 protein	CTD	PMID:18951874
Ttll3	Rat	thioacetamide	decreases expression	EXP		6480464	Thioacetamide results in decreased expression of TTLL3 mRNA	CTD	PMID:34492290
Ttll3	Rat	titanium dioxide	increases expression	ISO	Ttll3 (Mus musculus)	6480464	titanium dioxide results in increased expression of TTLL3 mRNA	CTD	PMID:29264374
Ttll3	Rat	trichloroethene	increases expression	EXP		6480464	Trichloroethylene results in increased expression of TTLL3 mRNA	CTD	PMID:33387578
Ttll3	Rat	triphenyl phosphate	affects expression	ISO	TTLL3 (Homo sapiens)	6480464	triphenyl phosphate affects the expression of TTLL3 mRNA	CTD	PMID:37042841
Ttll3	Rat	triptonide	increases expression	ISO	Ttll3 (Mus musculus)	6480464	triptonide results in increased expression of TTLL3 mRNA	CTD	PMID:33045310
Ttll3	Rat	trovafloxacin	increases expression	ISO	Ttll3 (Mus musculus)	6480464	trovafloxacin results in increased expression of TTLL3 mRNA	CTD	PMID:35537566

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ttll3	Rat	axoneme assembly	involved_in	IBA	FB:FBgn0031853 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Ttll3	Rat	cilium assembly	acts_upstream_of_or_within	ISO	Ttll3 (Mus musculus)	1624291	MGI:1922902 PMID:23897886	RGD	PMID:23897886
Ttll3	Rat	flagellated sperm motility	involved_in	IBA	MGI:1922902 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Ttll3	Rat	flagellated sperm motility	involved_in	ISO	Ttll3 (Mus musculus)	1624291	PMID:33414192	RGD	PMID:33414192
Ttll3	Rat	protein modification process	involved_in	IEA	InterPro:IPR004344	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Ttll3	Rat	protein polyglycylation	involved_in	ISO	Ttll3 (Mus musculus)	1624291	PMID:19524510 more ...	RGD	PMID:19524510 more ...
Ttll3	Rat	protein polyglycylation	NOT\|involved_in	ISO	TTLL3 (Homo sapiens)	1624291	PMID:19524510	RGD	PMID:19524510
Ttll3	Rat	spermatogenesis	involved_in	IBA	FB:FBgn0031853 and PANTHER:PTN000261126	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ttll3	Rat	axoneme	located_in	ISO	Ttll3 (Mus musculus)	1624291	PMID:19524510 and PMID:33414192	RGD	PMID:19524510 and PMID:33414192
Ttll3	Rat	axoneme	is_active_in	IBA	FB:FBgn0031853 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Ttll3	Rat	cilium	located_in	ISO	Ttll3 (Mus musculus)	1624291	PMID:19524510	RGD	PMID:19524510
Ttll3	Rat	microtubule cytoskeleton	is_active_in	IBA	FB:FBgn0031853 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Ttll3	Rat	microtubule cytoskeleton	located_in	ISO	Ttll3 (Mus musculus)	1624291	PMID:19524510	RGD	PMID:19524510
Ttll3	Rat	sperm flagellum	is_active_in	IBA	MGI:1922902 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Ttll3	Rat	sperm flagellum	located_in	ISO	Ttll3 (Mus musculus)	1624291	PMID:33414192	RGD	PMID:33414192

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ttll3	Rat	protein-glycine ligase activity	enables	ISO	TTLL3 (Homo sapiens)	1624291	PMID:19524510	RGD	PMID:19524510
Ttll3	Rat	protein-glycine ligase activity	enables	ISO	Ttll3 (Mus musculus)	1624291	PMID:19524510	RGD	PMID:19524510
Ttll3	Rat	protein-glycine ligase activity, initiating	enables	ISO	Ttll3 (Mus musculus)	1624291	PMID:19524510 and PMID:33414192	RGD	PMID:19524510 and PMID:33414192
Ttll3	Rat	protein-glycine ligase activity, initiating	enables	IBA	FB:FBgn0031853 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	GOA pipeline	RGD automated data pipeline
3.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

PMID:12477932	PMID:19524510	PMID:23897886

Ttll3
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	4	148,088,575 - 148,113,526 (+)	NCBI		GRCr8
mRatBN7.2	4	146,532,958 - 146,558,425 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	4	146,533,953 - 146,557,889 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	4	151,918,070 - 151,941,859 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	4	147,698,921 - 147,722,704 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	4	146,320,479 - 146,344,323 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	4	145,341,059 - 145,366,614 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	4	145,342,193 - 145,365,496 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	4	208,639,199 - 208,663,129 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	4	149,280,690 - 149,282,413 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	4	149,518,583 - 149,541,367 (+)	NCBI
Celera	4	135,091,168 - 135,114,283 (+)	NCBI		Celera
Cytogenetic Map	4	q42	NCBI

TTLL3
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	3	9,809,727 - 9,836,365 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	3	9,808,086 - 9,855,138 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	3	9,851,411 - 9,878,049 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	3	9,826,405 - 9,853,040 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	3	9,835,060 - 9,852,083	NCBI
Celera	3	9,786,607 - 9,813,341 (+)	NCBI		Celera
Cytogenetic Map	3	p25.3	NCBI
HuRef	3	9,787,987 - 9,814,322 (+)	NCBI		HuRef
CHM1_1	3	9,801,835 - 9,828,234 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	3	9,801,679 - 9,828,366 (+)	NCBI		T2T-CHM13v2.0

Ttll3
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	6	113,366,221 - 113,391,553 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	6	113,366,221 - 113,391,548 (+)	Ensembl		GRCm39 Ensembl
GRCm38	6	113,389,260 - 113,414,592 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	6	113,389,260 - 113,414,587 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	6	113,339,254 - 113,364,577 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	6	113,363,535 - 113,380,341 (+)	NCBI		MGSCv36	mm8
Celera	6	115,216,098 - 115,241,496 (+)	NCBI		Celera
Cytogenetic Map	6	E3	NCBI
cM Map	6	52.76	NCBI

Ttll3
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0	NW_004955561	1,330,378 - 1,353,217 (+)	NCBI	ChiLan1.0	ChiLan1.0

TTLL3
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	2	9,818,264 - 9,860,776 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	3	9,823,029 - 9,853,120 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	3	9,759,871 - 9,786,690 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	3	9,999,039 - 10,023,520 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	3	9,999,144 - 10,035,633 (+)	Ensembl	panpan1.1		panPan2

TTLL3
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	20	8,414,289 - 8,439,071 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	20	8,415,723 - 8,439,056 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	20	8,448,436 - 8,473,969 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	20	8,444,532 - 8,470,192 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	20	8,444,532 - 8,468,370 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	20	8,166,994 - 8,192,655 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	20	8,511,679 - 8,537,126 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	20	8,485,119 - 8,510,785 (-)	NCBI		UU_Cfam_GSD_1.0

TTLL3
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	13	66,056,890 - 66,123,977 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	13	66,094,069 - 66,123,984 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	13	73,170,509 - 73,203,964 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

TTLL3
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	22	45,817,048 - 45,843,878 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666041	120,717,115 - 120,749,917 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Variants in Ttll3
184 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	41
Count of miRNA genes:	39
Interacting mature miRNAs:	41
Transcripts:	ENSRNOT00000012015
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1582232	Gluco25	Glucose level QTL 25	3.6	0.0023	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	4	85253748	148090731	Rat
1358352	Srcrt3	Stress Responsive Cort QTL 3	2.29		blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	4	38465774	146803430	Rat
1300116	Hrtrt5	Heart rate QTL 5	3.76		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	4	116179486	151161268	Rat
6478693	Anxrr32	Anxiety related response QTL 32		0.00092	locomotor behavior trait (VT:0001392)	measurement of voluntary locomotion into, out of or within a discrete space in an experimental apparatus (CMO:0000957)	4	144639524	182687754	Rat
10755501	Bp390	Blood pressure QTL 390	2.5		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	4	26775591	168368347	Rat
631683	Bp116	Blood pressure QTL 116		0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	4	124303370	169303370	Rat
61451	Ciaa4	CIA Autoantibody QTL 4	3.1		blood autoantibody amount (VT:0003725)	calculated serum anti-rat type 2 collagen autoantibody titer (CMO:0001281)	4	126395976	167139601	Rat
1331738	Bp209	Blood pressure QTL 209	2.979		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	4	138503169	179293946	Rat
6478700	Anxrr33	Anxiety related response QTL 33		0.00896	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	144639524	182687754	Rat
1549827	Scl46	Serum cholesterol level QTL 46	3.5		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	4	132396220	177396220	Rat
731165	Uae21	Urinary albumin excretion QTL 21	2.4	0.0001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	4	106649412	151649412	Rat
737821	Hcar9	Hepatocarcinoma resistance QTL 9	3.7		liver integrity trait (VT:0010547)	volume of individual liver tumorous lesion (CMO:0001078)	4	109866907	167139601	Rat
7411558	Bw133	Body weight QTL 133	13.84	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	4	125590636	170590636	Rat
10401796	Kidm48	Kidney mass QTL 48			kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	4	145568712	182687754	Rat
6478718	Anxrr34	Anxiety related response QTL 34		0.00896	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	144639524	182687754	Rat
1549832	Bss3	Bone structure and strength QTL 3	11		femur morphology trait (VT:0000559)	femur midshaft cortical cross-sectional area (CMO:0001663)	4	109827074	154827074	Rat
70177	Xhs1	X-ray hypersensitivity QTL 1	25.1		intestine integrity trait (VT:0010554)	post-insult time to onset of moribundity (CMO:0001896)	4	82798864	152731274	Rat
2303623	Vencon2	Ventilatory control QTL 2	3.8		respiration trait (VT:0001943)	minute ventilation (CMO:0000132)	4	135204660	180204660	Rat
1578674	Bmd12	Bone mineral density QTL 12	3.8		femur mineral mass (VT:0010011)	compact volumetric bone mineral density (CMO:0001730)	4	135699135	180699135	Rat
1354660	Salc1	Saline consumption QTL 1	11.26		drinking behavior trait (VT:0001422)	saline drink intake rate (CMO:0001627)	4	44463908	148090542	Rat
1298082	Stresp4	Stress response QTL 4			blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	4	50119848	146803430	Rat
737978	Pia23	Pristane induced arthritis QTL 23	5.3		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	131730738	167139601	Rat
61362	Oia2	Oil induced arthritis QTL 2		0.001	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	138503169	173369699	Rat
70201	Gcr1	Gastric cancer resistance QTL 1	2.7		stomach morphology trait (VT:0000470)	stomach tumor susceptibility score (CMO:0002043)	4	120260281	147278687	Rat
70200	Alc18	Alcohol consumption QTL 18	9.2		drinking behavior trait (VT:0001422)	ethanol intake volume to total fluid intake volume ratio (CMO:0001591)	4	56647873	149491524	Rat
2293659	Bmd35	Bone mineral density QTL 35	4.5	0.0001	femur strength trait (VT:0010010)	femoral neck ultimate force (CMO:0001703)	4	137755016	181392681	Rat
1331759	Hrtrt13	Heart rate QTL 13	3.54628		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	4	110275411	168266883	Rat
724535	Cm18	Cardiac mass QTL 18	2.6		heart mass (VT:0007028)	calculated heart weight (CMO:0000073)	4	118856416	163856416	Rat
2316958	Gluco58	Glucose level QTL 58	10		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	4	11320076	180699135	Rat
6478754	Anxrr43	Anxiety related response QTL 43		0.14035	locomotor behavior trait (VT:0001392)	distance moved per unit of time into, out of or within a discrete space in an experimental apparatus (CMO:0001493)	4	144639524	182687754	Rat
2302049	Pia32	Pristane induced arthritis QTL 32	5.1	0.001	blood autoantibody amount (VT:0003725)	serum immunoglobulin G-type rheumatoid factor level relative to an arbitrary reference serum (CMO:0002112)	4	105789505	150789505	Rat
724558	Plsm2	Polydactyly-luxate syndrome (PLS) morphotypes QTL 2		0.0003	hindlimb integrity trait (VT:0010563)	hind foot phalanges count (CMO:0001949)	4	132422778	177422778	Rat
6478763	Anxrr46	Anxiety related response QTL 46		0.07428	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	110870972	155870972	Rat
6478760	Anxrr45	Anxiety related response QTL 45		0.06717	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	110870972	155870972	Rat
1331802	Srn5	Serum renin concentration QTL 5	3.045		renin activity (VT:0005581)	plasma renin activity level (CMO:0000116)	4	119428175	157578333	Rat
1298524	Oia8	Oil induced arthritis QTL 8			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	138503169	173369699	Rat
738009	Sach4	Saccharine consumption QTL 4	4.9	0.000016	consumption behavior trait (VT:0002069)	saccharin intake volume to total fluid intake volume ratio (CMO:0001601)	4	59948935	154902892	Rat
2312567	Glom19	Glomerulus QTL 19	1.9	0.006	kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	4	45456990	146803430	Rat
7207480	Bss105	Bone structure and strength QTL 105	8.1		femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	4	109827074	154827074	Rat
634335	Anxrr16	Anxiety related response QTL 16	7.22		locomotor behavior trait (VT:0001392)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	4	93308457	167139447	Rat
6478778	Anxrr51	Anxiety related response QTL 51		0.25384	locomotor behavior trait (VT:0001392)	measurement of voluntary locomotion into, out of or within a discrete space in an experimental apparatus (CMO:0000957)	4	124778595	169778595	Rat
61406	Scwia1	Streptococcal cell wall induced arthritis QTL 1	2.3		joint integrity trait (VT:0010548)	experimental arthritis severity measurement (CMO:0001459)	4	106805662	151805662	Rat
631511	Pia7	Pristane induced arthritis QTL 7	4.3		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	131730738	167139601	Rat
1354612	Foco1	Food consumption QTL 1	8.87		eating behavior trait (VT:0001431)	food intake rate (CMO:0000427)	4	44463908	148090542	Rat
634347	Hcar8	Hepatocarcinoma resistance QTL 8	5.8		liver integrity trait (VT:0010547)	liver tumorous lesion area to total liver area ratio (CMO:0001075)	4	123143783	168143783	Rat
738031	Alc14	Alcohol consumption QTL 14	7.6	0.00003	consumption behavior trait (VT:0002069)	ethanol drink intake rate to body weight ratio (CMO:0001616)	4	59948935	154902892	Rat
1576316	Ept5	Estrogen-induced pituitary tumorigenesis QTL 5	3.8		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	4	83428419	177635233	Rat
1576305	Emca6	Estrogen-induced mammary cancer QTL 6	5.8		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	4	44463720	155883716	Rat
738016	Alc16	Alcohol consumption QTL 16	3.6	0.00015	consumption behavior trait (VT:0002069)	ethanol drink intake rate to body weight ratio (CMO:0001616)	4	59948935	154902892	Rat
1358202	Gluco11	Glucose level QTL 11	2.4	0.02	adipocyte glucose uptake trait (VT:0004185)	absolute change in adipocyte glucose uptake (CMO:0000873)	4	85379421	167139601	Rat
61422	Cia13	Collagen induced arthritis QTL 13	4.5		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	132642577	167139601	Rat
631674	Iddm14	Insulin dependent diabetes mellitus QTL 14			blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	4	64528739	157573521	Rat
2293840	Kiddil9	Kidney dilation QTL 9	2.9		kidney pelvis morphology trait (VT:0004194)	hydronephrosis severity score (CMO:0001208)	4	120926564	148090731	Rat
12798519	Anxrr54	Anxiety related response QTL 54	2.54	0.05	locomotor behavior trait (VT:0001392)	distance moved per unit of time into, out of or within a discrete space in an experimental apparatus (CMO:0001493)	4	114627026	159627026	Rat
12798523	Anxrr56	Anxiety related response QTL 56	2.83	0.05	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	85253748	150276390	Rat
61434	Cia3	Collagen induced arthritis QTL 3	4.8		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	103194656	148194656	Rat
12798527	Anxrr58	Anxiety related response QTL 58	4.11	0.05	locomotor behavior trait (VT:0001392)	distance moved per unit of time into, out of or within a discrete space in an experimental apparatus (CMO:0001493)	4	119463257	147278687	Rat
6478748	Anxrr42	Anxiety related response QTL 42		0.28008	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	144639524	182687754	Rat

AI327076

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	4	146,532,071 - 146,532,152 (+)	MAPPER	mRatBN7.2
Rnor_6.0	4	145,340,273 - 145,340,353	NCBI	Rnor6.0
Rnor_5.0	4	208,637,318 - 208,637,398	UniSTS	Rnor5.0
RGSC_v3.4	4	149,269,912 - 149,269,992	UniSTS	RGSC3.4
Celera	4	135,089,287 - 135,089,367	UniSTS
Cytogenetic Map	4	q42	UniSTS

RH137987

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	4	146,557,668 - 146,557,839 (+)	MAPPER	mRatBN7.2
Rnor_6.0	4	145,365,867 - 145,366,037	NCBI	Rnor6.0
Rnor_5.0	4	208,662,913 - 208,663,083	UniSTS	Rnor5.0
RGSC_v3.4	4	149,296,366 - 149,296,536	UniSTS	RGSC3.4
Celera	4	135,114,067 - 135,114,237	UniSTS
RH 3.4 Map	4	936.6	UniSTS
Cytogenetic Map	4	q42	UniSTS

RH138825

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	4	146,532,510 - 146,532,730 (+)	MAPPER	mRatBN7.2
Rnor_6.0	4	145,340,712 - 145,340,931	NCBI	Rnor6.0
Rnor_5.0	4	208,637,757 - 208,637,976	UniSTS	Rnor5.0
RGSC_v3.4	4	149,270,351 - 149,270,570	UniSTS	RGSC3.4
Celera	4	135,089,726 - 135,089,945	UniSTS
RH 3.4 Map	4	936.6	UniSTS
RH 3.4 Map	4	937.7	UniSTS
Cytogenetic Map	4	q42	UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31


RefSeq Transcripts	NM_001108640	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_001429192	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_001429194	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_001429195	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_001429197	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_001429199	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_001429200	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_001429203	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_001429204	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_001429205	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_001429206	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_001429207	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017592689	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017592690	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017592691	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017592692	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017592693	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017592694	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017592695	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017592696	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017592697	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017592698	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017592699	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039107834	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039107835	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039107836	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039107837	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039107838	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039107839	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039107840	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039107841	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039107842	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039107843	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039107844	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039107845	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039107847	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039107848	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039107850	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039107851	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039107852	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039107853	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039107854	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039107855	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063286293	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063286294	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063286295	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063286296	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063286297	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063286298	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063286299	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063286300	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063286301	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063286302	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XR_005503258	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XR_005503259	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XR_010065676	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC183952	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC168907	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473957	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CV126544	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000004	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000012015 ⟹ ENSRNOP00000012015

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	4	146,533,953 - 146,557,889 (+)	Ensembl
Rnor_6.0 Ensembl	4	145,342,193 - 145,365,496 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000102169 ⟹ ENSRNOP00000076428

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	4	146,535,808 - 146,557,889 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000107721 ⟹ ENSRNOP00000088967

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	4	146,535,808 - 146,557,889 (+)	Ensembl

RefSeq Acc Id:

NM_001108640 ⟹ NP_001102110

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	148,089,596 - 148,113,525 (+)	NCBI
mRatBN7.2	4	146,533,953 - 146,557,885 (+)	NCBI
Rnor_6.0	4	145,342,154 - 145,366,083 (+)	NCBI
Rnor_5.0	4	208,639,199 - 208,663,129 (+)	NCBI
RGSC_v3.4	4	149,280,690 - 149,282,413 (+)	RGD
Celera	4	135,091,168 - 135,114,283 (+)	NCBI

Sequence:

show sequence

TTAGAGGTACTCCTCGTGAAGGTGGGAGATCAGAAGGAAATGGCAGCTGGTCACTCAACCCTCAAAAGACATCCTTATTCCGATTCCCTACTCCTCTGGCGAGGATTCACCAAGGGAACTCCTCACCA
TATGGGCCGACTCAGAAACGCCAAAATCCACGTAGAGAGAGCCGTCAAGCAGAAGAAGATCTTTATGATTCATGGACGATACCCAGTGATCCGGTGTCTCTTGCGCCAGAGAGGCTGGGTAGAGAAGA
AGATGGTGCATCCCCCAGGCACGATCCTGCCACCACCTTCGAAGGATCTAGACAGCTCCATGCTGGGTGACAGCGATGCCACAGAGGATGAGGACGAAGAAGAGAGTGAGATGTTTCGGGAGTCGCAG
CTGTTGGACTTGGATGGTTTCTTGGAATTCGACGACCTAGATGGGATACATGCTTTGATGTCCCGCATGGTTCGAAACGAGACCCCTTACCTGATCTGGACCACTCGGCGAGACGTGCTAGATTGTCG
CTTCCTTTCCAAGGATCAGATGATAAACCATTATGCCCGTGCCGGCTCCTTCACTACAAAGGTGGGCCTTTGTCTCAACCTCCGGAATCTGCCATGGTTTGATGAGGCTGATGCTGACTCCTTCTTCC
CACGATGCTACCGACTGGGGGCAGAGGATGACAAGAAAGCCTTCATAGAGGACTTCTGGCTGACAGCTGCCCGCAACGTTCTCAAGCTGGTGGTGAAGTTGGAAGGGAGGTCACAGTCTATCCCCATC
CAGGCAAGAGAGGAAGAGGCCCTAGAAGATACACAGCCCAAGAAACAGGAGAAGAAGCCAGTGACGGTGTCTTCAGACTTTGTGGATGAGGCTCTGAGTGCATGCGAGGAACATCTCAGCAACATAGC
CCACAAAGACATCGACAAGGACCCCAACGCCCCACTGTACCTCAGCCCTGACGACTGGTCCCTCTTCCTTCAGCGCTACTACCAAATAGTGCATCAAGGGGCAGAACTCAGATACCTGGAGGTCCAAG
TCCAGCGCTGTGAAGACATCCTACAGCAGCTTCGGGCCGTGGTACCCCAGATAGACATGGAGGGGGATCGGAACATCTGGATCGTGAAGCCCGGAGCCAAGTCCCGAGGCCGAGGGATTACATGCATG
GACCACCTGGATGAGATGCTGAAGCTGGTGGACTGCAACCCCATGCTGATGAAGGATGGCAAGTGGATTGTGCAGAAGTACATTGAGCGGCCCCTGCTGATCTTCGGCACCAAGTTTGACCTGAGGCA
GTGGTTCCTGGTGACCGACTGGAACCCACTCACTGTGTGGTTCTACCGGGACAGCTACATCCGCTTCTCCACACAGCCTTTCTCCTTGAAGAACCTGGACAACTCTGTGCACCTGTGTAACAACTCCA
TCCAGAGACACTTGGAGGCTTCCTGTCACCGACACCCAATGCTGCCTCCGGATAACATGTGGTCCAGCCAGAGGTTTCAGGCCCACTTGCAGGAGGTAGATGCCCCAAAGGCGTGGTCCACTGTCATT
GTGCCTGGCATGAAGGCTGCCGTGATCCATGCCCTGCAGACCTCCCAGGACAACGTGCAGTGTCGGAAGGCCAGCTTTGAACTCTATGGGGCTGACTTTGTGTTTGGGGAAGACTTCCAGCCCTGGCT
GATTGAAATCAATGCCAGCCCCACCATGGCACCTTCCACAGCTGTCACTGCCCGCCTCTGTGCTGGTGTGCAAGCAGATACCCTGCGTGTGGTCATCGACCGGCGAATGGACCGCAGCTGCGATACAG
GAGCCTTTGAGCTCATCTATAAGCAGCCTGCTGTGGAGGTGCCCCAGTACGTGGGTATCCGGCTCGTAGTAGAGGGCTCTACCATCAAGAAGCCCATGGCAGTGGGACATCGGCGGACAGGGGTCCTC
TGCTCATCACTCCCTCATCTGCTGACCCAGCAAGGCTCTGGGGAAAGCAAGGGCTCAGGCTCCCCTACCCACAGGTCAGCTTTTAGGAAAAATGCTAGGGTCGAGAGCCTGGGACACACCACCGCCGC
CGAGAAGCCAGAAACTACTGCCACCACACCGGTCCCTGGAAAGGGGAAGAAAGCCGAGGTAGCAGGAAGTTTAAGGACGTTGCCCGAGGTTGCACAGCTCAGAAGGGGCAGAGCTGGGATGCAGACCC
AGACCCTTTCCACTTCCCTAGTCTCCACATCAAGGCCTGGCTGCCTTCTCCCCGTGTGCACCGACCCCAGAGCCGGGTCCACAGACTCCAGCACAGCCAGCTGGTGGGCTCTAAGGCTCTGTCAACCA
CAGGCAAGGCCTTGATGACTCTACCTACTGCCAAGGTTCCGATGTCCTTCCCACCTCACCCTGACCTCGAACTGGCACCTAGCATGCTGAAGCCCAGAAAGGTGGGCTTTGAGCTAAGCTGCACACCC
TAGTGGGTAGTGCTGAGCAGAGGGATTGGGGCAGAAGGGCACAGGCAGAGGGCAGCACCAAGACCAAGCAGCGCACCAGGGAAGGGCTTGTCTTCCACAGAACCCTGTTCCAAGACAGAGGCCTGATC
ATCTCTCTCTTCCTCCCCTCCTTTACACCGAGGCTGCTATTCCCCTGCACCTTCGAGGCCCCCACTTTGGAAGTGCCTCTTGGCCTCTGACCTTTGAAGCCGGACTTCTTCCTAGCACCCACAGGAAA
GTCAAGTCCAAAGGCAAGTTCAAGGCCAGACTCGGCAACAGACCCAGGGCTGAGGCATACCCCACGAAGAGGCTAAGTCTCCCCAGCCCCTTAACCCTTATTTTGGTGTCCCAAAGTCTGGGGCCTGT
AGGGGCCACGAGGCTAAAGAAACCCCTGCTCTGAACTTCACTGCCCCATCCTGGATCCAGCATCAAATAAAAAAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_039107834 ⟹ XP_038963762

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	148,091,023 - 148,113,526 (+)	NCBI
mRatBN7.2	4	146,535,866 - 146,557,886 (+)	NCBI

RefSeq Acc Id:

XM_039107835 ⟹ XP_038963763

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	148,091,023 - 148,113,526 (+)	NCBI
mRatBN7.2	4	146,535,866 - 146,557,886 (+)	NCBI

RefSeq Acc Id:

XM_039107836 ⟹ XP_038963764

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	148,091,023 - 148,113,526 (+)	NCBI
mRatBN7.2	4	146,535,866 - 146,557,886 (+)	NCBI

RefSeq Acc Id:

XM_039107837 ⟹ XP_038963765

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	148,091,023 - 148,113,526 (+)	NCBI
mRatBN7.2	4	146,535,866 - 146,557,886 (+)	NCBI

RefSeq Acc Id:

XM_039107838 ⟹ XP_038963766

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	148,091,023 - 148,113,526 (+)	NCBI
mRatBN7.2	4	146,535,866 - 146,557,886 (+)	NCBI

RefSeq Acc Id:

XM_039107839 ⟹ XP_038963767

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	148,091,023 - 148,113,526 (+)	NCBI
mRatBN7.2	4	146,535,866 - 146,557,886 (+)	NCBI

RefSeq Acc Id:

XM_039107840 ⟹ XP_038963768

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	148,091,023 - 148,113,526 (+)	NCBI
mRatBN7.2	4	146,535,866 - 146,557,886 (+)	NCBI

RefSeq Acc Id:

XM_039107841 ⟹ XP_038963769

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	148,091,023 - 148,113,526 (+)	NCBI
mRatBN7.2	4	146,535,866 - 146,557,886 (+)	NCBI

RefSeq Acc Id:

XM_039107842 ⟹ XP_038963770

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	148,091,023 - 148,113,526 (+)	NCBI
mRatBN7.2	4	146,535,866 - 146,558,425 (+)	NCBI

RefSeq Acc Id:

XM_039107843 ⟹ XP_038963771

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	148,091,023 - 148,113,526 (+)	NCBI
mRatBN7.2	4	146,535,866 - 146,558,425 (+)	NCBI

RefSeq Acc Id:

XM_039107844 ⟹ XP_038963772

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	148,091,023 - 148,113,526 (+)	NCBI
mRatBN7.2	4	146,535,866 - 146,557,885 (+)	NCBI

RefSeq Acc Id:

XM_039107845 ⟹ XP_038963773

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	148,088,575 - 148,113,526 (+)	NCBI
mRatBN7.2	4	146,532,959 - 146,557,886 (+)	NCBI

RefSeq Acc Id:

XM_039107847 ⟹ XP_038963775

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	148,088,575 - 148,113,526 (+)	NCBI
mRatBN7.2	4	146,532,958 - 146,557,886 (+)	NCBI

RefSeq Acc Id:

XM_039107848 ⟹ XP_038963776

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	148,091,970 - 148,113,526 (+)	NCBI
mRatBN7.2	4	146,536,222 - 146,557,886 (+)	NCBI

RefSeq Acc Id:

XM_039107850 ⟹ XP_038963778

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	148,092,148 - 148,113,526 (+)	NCBI
mRatBN7.2	4	146,532,959 - 146,557,886 (+)	NCBI

RefSeq Acc Id:

XM_039107851 ⟹ XP_038963779

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	148,091,023 - 148,113,526 (+)	NCBI
mRatBN7.2	4	146,535,866 - 146,558,425 (+)	NCBI

RefSeq Acc Id:

XM_039107852 ⟹ XP_038963780

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	148,091,023 - 148,113,526 (+)	NCBI
mRatBN7.2	4	146,535,866 - 146,558,425 (+)	NCBI

RefSeq Acc Id:

XM_039107853 ⟹ XP_038963781

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	148,091,023 - 148,113,526 (+)	NCBI
mRatBN7.2	4	146,535,866 - 146,558,425 (+)	NCBI

RefSeq Acc Id:

XM_039107854 ⟹ XP_038963782

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	148,099,395 - 148,113,526 (+)	NCBI
mRatBN7.2	4	146,543,754 - 146,557,886 (+)	NCBI

RefSeq Acc Id:

XM_039107855 ⟹ XP_038963783

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	148,091,023 - 148,113,526 (+)	NCBI
mRatBN7.2	4	146,535,866 - 146,558,425 (+)	NCBI

RefSeq Acc Id:

XM_063286293 ⟹ XP_063142363

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	148,091,023 - 148,113,526 (+)	NCBI

RefSeq Acc Id:

XM_063286294 ⟹ XP_063142364

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	148,091,023 - 148,113,526 (+)	NCBI

RefSeq Acc Id:

XM_063286295 ⟹ XP_063142365

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	148,091,023 - 148,113,526 (+)	NCBI

RefSeq Acc Id:

XM_063286296 ⟹ XP_063142366

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	148,091,023 - 148,113,526 (+)	NCBI

RefSeq Acc Id:

XM_063286297 ⟹ XP_063142367

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	148,091,023 - 148,113,526 (+)	NCBI

RefSeq Acc Id:

XM_063286298 ⟹ XP_063142368

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	148,088,575 - 148,113,526 (+)	NCBI

RefSeq Acc Id:

XM_063286299 ⟹ XP_063142369

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	148,088,575 - 148,113,526 (+)	NCBI

RefSeq Acc Id:

XM_063286300 ⟹ XP_063142370

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	148,091,023 - 148,113,526 (+)	NCBI

RefSeq Acc Id:

XM_063286301 ⟹ XP_063142371

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	148,088,575 - 148,113,526 (+)	NCBI

RefSeq Acc Id:

XM_063286302 ⟹ XP_063142372

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	148,088,575 - 148,113,526 (+)	NCBI

RefSeq Acc Id:

XR_005503258

Type:

NON-CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	148,091,023 - 148,113,348 (+)	NCBI
mRatBN7.2	4	146,535,866 - 146,557,713 (+)	NCBI

RefSeq Acc Id:

XR_005503259

Type:

NON-CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	148,091,023 - 148,113,284 (+)	NCBI
mRatBN7.2	4	146,535,866 - 146,557,651 (+)	NCBI

RefSeq Acc Id:

XR_010065676

Type:

NON-CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	148,091,023 - 148,106,243 (+)	NCBI


Protein RefSeqs	NP_001102110	(Get FASTA)	NCBI Sequence Viewer
	NP_001416121	(Get FASTA)	NCBI Sequence Viewer
	NP_001416123	(Get FASTA)	NCBI Sequence Viewer
	NP_001416124	(Get FASTA)	NCBI Sequence Viewer
	NP_001416126	(Get FASTA)	NCBI Sequence Viewer
	NP_001416128	(Get FASTA)	NCBI Sequence Viewer
	NP_001416129	(Get FASTA)	NCBI Sequence Viewer
	NP_001416132	(Get FASTA)	NCBI Sequence Viewer
	NP_001416133	(Get FASTA)	NCBI Sequence Viewer
	NP_001416134	(Get FASTA)	NCBI Sequence Viewer
	NP_001416135	(Get FASTA)	NCBI Sequence Viewer
	NP_001416136	(Get FASTA)	NCBI Sequence Viewer
	XP_038963762	(Get FASTA)	NCBI Sequence Viewer
	XP_038963763	(Get FASTA)	NCBI Sequence Viewer
	XP_038963764	(Get FASTA)	NCBI Sequence Viewer
	XP_038963765	(Get FASTA)	NCBI Sequence Viewer
	XP_038963766	(Get FASTA)	NCBI Sequence Viewer
	XP_038963767	(Get FASTA)	NCBI Sequence Viewer
	XP_038963768	(Get FASTA)	NCBI Sequence Viewer
	XP_038963769	(Get FASTA)	NCBI Sequence Viewer
	XP_038963770	(Get FASTA)	NCBI Sequence Viewer
	XP_038963771	(Get FASTA)	NCBI Sequence Viewer
	XP_038963772	(Get FASTA)	NCBI Sequence Viewer
	XP_038963773	(Get FASTA)	NCBI Sequence Viewer
	XP_038963775	(Get FASTA)	NCBI Sequence Viewer
	XP_038963776	(Get FASTA)	NCBI Sequence Viewer
	XP_038963778	(Get FASTA)	NCBI Sequence Viewer
	XP_038963779	(Get FASTA)	NCBI Sequence Viewer
	XP_038963780	(Get FASTA)	NCBI Sequence Viewer
	XP_038963781	(Get FASTA)	NCBI Sequence Viewer
	XP_038963782	(Get FASTA)	NCBI Sequence Viewer
	XP_038963783	(Get FASTA)	NCBI Sequence Viewer
	XP_063142363	(Get FASTA)	NCBI Sequence Viewer
	XP_063142364	(Get FASTA)	NCBI Sequence Viewer
	XP_063142365	(Get FASTA)	NCBI Sequence Viewer
	XP_063142366	(Get FASTA)	NCBI Sequence Viewer
	XP_063142367	(Get FASTA)	NCBI Sequence Viewer
	XP_063142368	(Get FASTA)	NCBI Sequence Viewer
	XP_063142369	(Get FASTA)	NCBI Sequence Viewer
	XP_063142370	(Get FASTA)	NCBI Sequence Viewer
	XP_063142371	(Get FASTA)	NCBI Sequence Viewer
	XP_063142372	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAI68907	(Get FASTA)	NCBI Sequence Viewer
	EDL91530	(Get FASTA)	NCBI Sequence Viewer
	EDL91531	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000012015.6
	ENSRNOP00000076428.1
	ENSRNOP00000088967.1

RefSeq Acc Id:

NP_001102110 ⟸ NM_001108640

- UniProtKB:

B5DF33 (UniProtKB/TrEMBL), D3ZE22 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MAAGHSTLKRHPYSDSLLLWRGFTKGTPHHMGRLRNAKIHVERAVKQKKIFMIHGRYPVIRCLLRQRGWVEKKMVHPPGTILPPPSKDLDSSMLGDSDATEDEDEEESEMFRESQLLDLDGFLEFDDL
DGIHALMSRMVRNETPYLIWTTRRDVLDCRFLSKDQMINHYARAGSFTTKVGLCLNLRNLPWFDEADADSFFPRCYRLGAEDDKKAFIEDFWLTAARNVLKLVVKLEGRSQSIPIQAREEEALEDTQP
KKQEKKPVTVSSDFVDEALSACEEHLSNIAHKDIDKDPNAPLYLSPDDWSLFLQRYYQIVHQGAELRYLEVQVQRCEDILQQLRAVVPQIDMEGDRNIWIVKPGAKSRGRGITCMDHLDEMLKLVDCN
PMLMKDGKWIVQKYIERPLLIFGTKFDLRQWFLVTDWNPLTVWFYRDSYIRFSTQPFSLKNLDNSVHLCNNSIQRHLEASCHRHPMLPPDNMWSSQRFQAHLQEVDAPKAWSTVIVPGMKAAVIHALQ
TSQDNVQCRKASFELYGADFVFGEDFQPWLIEINASPTMAPSTAVTARLCAGVQADTLRVVIDRRMDRSCDTGAFELIYKQPAVEVPQYVGIRLVVEGSTIKKPMAVGHRRTGVLCSSLPHLLTQQGS
GESKGSGSPTHRSAFRKNARVESLGHTTAAEKPETTATTPVPGKGKKAEVAGSLRTLPEVAQLRRGRAGMQTQTLSTSLVSTSRPGCLLPVCTDPRAGSTDSSTASWWALRLCQPQARP

hide sequence

Ensembl Acc Id:

ENSRNOP00000012015 ⟸ ENSRNOT00000012015

RefSeq Acc Id:	XP_038963775 ⟸ XM_039107847
- Peptide Label:	isoform X17

RefSeq Acc Id:	XP_038963778 ⟸ XM_039107850
- Peptide Label:	isoform X23

RefSeq Acc Id:	XP_038963773 ⟸ XM_039107845
- Peptide Label:	isoform X16

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D3ZE22-F1-model_v2	AlphaFold	D3ZE22	1-760	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-43387	BioCyc
Ensembl Genes	ENSRNOG00000009032	Ensembl, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000012015.8	UniProtKB/TrEMBL
	ENSRNOT00000102169.1	UniProtKB/TrEMBL
	ENSRNOT00000107721.1	UniProtKB/TrEMBL
Gene3D-CATH	ATP-grasp fold, B domain	UniProtKB/TrEMBL
InterPro	TTLL_monoglycylase	UniProtKB/TrEMBL
	Tub_tyr_ligase	UniProtKB/TrEMBL
KEGG Report	rno:362415	UniProtKB/TrEMBL
NCBI Gene	362415	ENTREZGENE
PANTHER	PTHR45870:SF1	UniProtKB/TrEMBL
	TUBULIN MONOGLYCYLASE TTLL3	UniProtKB/TrEMBL
Pfam	TTL	UniProtKB/TrEMBL
PhenoGen	Ttll3	PhenoGen
PROSITE	TTL	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000009032	RatGTEx
Superfamily-SCOP	Glutathione synthetase ATP-binding domain-like	UniProtKB/TrEMBL
UniProt	A0A8I5Y527	ENTREZGENE, UniProtKB/TrEMBL
	A0A8I6ABR5	ENTREZGENE, UniProtKB/TrEMBL
	B5DF33	ENTREZGENE, UniProtKB/TrEMBL
	D3ZE22	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2015-11-25	Ttll3	tubulin tyrosine ligase like 3	Ttll3	tubulin tyrosine ligase-like family, member 3	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-04-30	Ttll3	tubulin tyrosine ligase-like family, member 3	Ttll3_predicted	tubulin tyrosine ligase-like family, member 3 (predicted)	'predicted' is removed	2292626	APPROVED
2008-01-09	Ttll3_predicted	tubulin tyrosine ligase-like family, member 3 (predicted)	LOC687148	similar to tubulin tyrosine ligase-like family, member 3	Data merged from RGD:1588938	1643240	APPROVED
2006-11-19	LOC687148	similar to tubulin tyrosine ligase-like family, member 3			Symbol and Name status set to provisional	70820	PROVISIONAL
2005-01-12	Ttll3_predicted	tubulin tyrosine ligase-like family, member 3 (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Send us a Message

Imported Disease Annotations - ClinVar