Symbol:
G3bp2
Name:
G3BP stress granule assembly factor 2
RGD ID:
1309571
Description:
Predicted to enable mRNA binding activity and molecular condensate scaffold activity. Predicted to be involved in positive regulation of stress granule assembly; protein homooligomerization; and stress granule assembly. Predicted to be active in cytoplasmic stress granule and cytosol. Orthologous to human G3BP2 (G3BP stress granule assembly factor 2); INTERACTS WITH (+)-schisandrin B; 17alpha-ethynylestradiol; 2,3,7,8-tetrachlorodibenzodioxine.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
GTPase activating protein (SH3 domain) binding protein 2; LOC305240; ras GTPase-activating protein-binding protein 2; RGD1309571; similar to RNA-binding protein isoform G3BP-2a
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 14 16,216,684 - 16,304,828 (+) NCBI GRCr8 mRatBN7.2 14 15,932,403 - 16,020,555 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 14 15,987,417 - 16,020,548 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx PNT010002061.1 764 - 14,667 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 14 17,261,452 - 17,352,942 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 14 15,956,911 - 16,045,070 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 14 17,437,145 - 17,523,254 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 14 17,492,081 - 17,520,792 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 14 17,354,824 - 17,440,632 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 14 17,556,967 - 17,588,259 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 14 17,556,966 - 17,588,256 (+) NCBI Celera 14 15,382,373 - 15,410,837 (+) NCBI Celera Cytogenetic Map 14 p22 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
G3bp2 Rat (+)-schisandrin B multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of CFHR2 mRNA] CTD PMID:31150632 G3bp2 Rat 1,2-dimethylhydrazine multiple interactions ISO G3bp2 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of G3BP2 mRNA CTD PMID:22206623 G3bp2 Rat 1,2-dimethylhydrazine decreases expression ISO G3bp2 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of G3BP2 mRNA CTD PMID:22206623 G3bp2 Rat 17alpha-ethynylestradiol increases expression EXP 6480464 Ethinyl Estradiol results in increased expression of G3BP2 mRNA CTD PMID:29097150 G3bp2 Rat 17beta-estradiol affects expression ISO G3bp2 (Mus musculus) 6480464 Estradiol affects the expression of G3BP2 mRNA CTD PMID:15598610 G3bp2 Rat 17beta-hydroxy-5alpha-androstan-3-one increases expression ISO G3BP2 (Homo sapiens) 6480464 Dihydrotestosterone results in increased expression of G3BP2 mRNA CTD PMID:29581250 G3bp2 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO G3bp2 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of G3BP2 mRNA CTD PMID:21570461 G3bp2 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of G3BP2 mRNA CTD PMID:33387578 G3bp2 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of G3BP2 mRNA CTD PMID:32109520 G3bp2 Rat 4,4'-sulfonyldiphenol increases expression ISO G3BP2 (Homo sapiens) 6480464 bisphenol S results in increased expression of G3BP2 protein CTD PMID:34186270 G3bp2 Rat acetamide decreases expression EXP 6480464 acetamide results in decreased expression of G3BP2 mRNA CTD PMID:31881176 G3bp2 Rat actinomycin D multiple interactions ISO G3BP2 (Homo sapiens) 6480464 [Dactinomycin co-treated with nutlin 3] results in increased secretion of G3BP2 protein CTD PMID:38460933 G3bp2 Rat all-trans-retinoic acid decreases expression ISO G3bp2 (Mus musculus) 6480464 Tretinoin results in decreased expression of G3BP2 mRNA CTD PMID:16604517 G3bp2 Rat all-trans-retinoic acid increases expression ISO G3BP2 (Homo sapiens) 6480464 Tretinoin results in increased expression of G3BP2 mRNA CTD PMID:23724009 G3bp2 Rat all-trans-retinoic acid multiple interactions ISO G3BP2 (Homo sapiens) 6480464 [Tretinoin co-treated with arsenic trioxide] results in decreased expression of G3BP2 protein CTD PMID:15894607 G3bp2 Rat all-trans-retinoic acid decreases expression ISO G3BP2 (Homo sapiens) 6480464 Tretinoin results in decreased expression of G3BP2 protein CTD PMID:15894607 G3bp2 Rat aristolochic acid A decreases expression ISO G3BP2 (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of G3BP2 mRNA CTD PMID:33212167 G3bp2 Rat Aroclor 1254 decreases expression ISO G3bp2 (Mus musculus) 6480464 Chlorodiphenyl (54% Chlorine) results in decreased expression of G3BP2 mRNA CTD PMID:23650126 G3bp2 Rat arsenite(3-) multiple interactions ISO G3BP2 (Homo sapiens) 6480464 arsenite promotes the reaction [G3BP1 protein binds to G3BP2 protein] CTD PMID:32406909 G3bp2 Rat arsenite(3-) affects localization ISO G3BP2 (Homo sapiens) 6480464 arsenite affects the localization of G3BP2 protein CTD PMID:23279204 G3bp2 Rat arsenous acid decreases expression ISO G3BP2 (Homo sapiens) 6480464 Arsenic Trioxide results in decreased expression of G3BP2 protein CTD PMID:15894607 G3bp2 Rat arsenous acid multiple interactions ISO G3BP2 (Homo sapiens) 6480464 [Tretinoin co-treated with Arsenic Trioxide] results in decreased expression of G3BP2 protein CTD PMID:15894607 G3bp2 Rat atrazine increases expression ISO G3bp2 (Mus musculus) 6480464 Atrazine results in increased expression of G3BP2 mRNA CTD PMID:26518232 G3bp2 Rat Benoxacor decreases expression ISO G3bp2 (Mus musculus) 6480464 benoxacor results in decreased expression of G3BP2 mRNA CTD PMID:34850242 G3bp2 Rat benzatropine multiple interactions ISO G3BP2 (Homo sapiens) 6480464 [Cuprizone co-treated with Benztropine] results in decreased expression of G3BP2 protein CTD PMID:34122009 G3bp2 Rat benzo[a]pyrene increases expression ISO G3BP2 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased expression of G3BP2 mRNA CTD PMID:20498004 G3bp2 Rat benzo[a]pyrene increases methylation ISO G3BP2 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of G3BP2 5' UTR CTD PMID:27901495 G3bp2 Rat benzo[a]pyrene decreases expression ISO G3bp2 (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of G3BP2 mRNA CTD PMID:22228805 G3bp2 Rat benzo[a]pyrene diol epoxide I increases expression ISO G3BP2 (Homo sapiens) 6480464 7 more ... CTD PMID:26238291 G3bp2 Rat bis(2-ethylhexyl) phthalate increases expression ISO G3bp2 (Mus musculus) 6480464 Diethylhexyl Phthalate results in increased expression of G3BP2 mRNA CTD PMID:19850644 G3bp2 Rat bis(2-ethylhexyl) phthalate decreases expression ISO G3bp2 (Mus musculus) 6480464 Diethylhexyl Phthalate results in decreased expression of G3BP2 mRNA CTD PMID:33754040 G3bp2 Rat bis(2-ethylhexyl) phthalate multiple interactions ISO G3bp2 (Mus musculus) 6480464 PPARA protein promotes the reaction [Diethylhexyl Phthalate results in increased expression of G3BP2 mRNA] CTD PMID:19850644 G3bp2 Rat bisphenol A increases expression ISO G3BP2 (Homo sapiens) 6480464 bisphenol A results in increased expression of G3BP2 mRNA CTD PMID:25047013 G3bp2 Rat bisphenol A decreases expression ISO G3BP2 (Homo sapiens) 6480464 bisphenol A results in decreased expression of G3BP2 protein CTD PMID:37567409 G3bp2 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of G3BP2 mRNA CTD PMID:29097150 G3bp2 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of G3BP2 mRNA CTD PMID:25181051 G3bp2 Rat bisphenol AF increases expression ISO G3BP2 (Homo sapiens) 6480464 bisphenol AF results in increased expression of G3BP2 protein CTD PMID:34186270 G3bp2 Rat bisphenol F increases expression ISO G3bp2 (Mus musculus) 6480464 bisphenol F results in increased expression of G3BP2 mRNA CTD PMID:38685157 G3bp2 Rat cadmium dichloride increases methylation EXP 6480464 Cadmium Chloride results in increased methylation of G3BP2 promoter CTD PMID:22457795 G3bp2 Rat cadmium dichloride decreases expression ISO G3BP2 (Homo sapiens) 6480464 Cadmium Chloride results in decreased expression of G3BP2 mRNA CTD PMID:38568856 G3bp2 Rat caffeine increases phosphorylation ISO G3BP2 (Homo sapiens) 6480464 Caffeine results in increased phosphorylation of G3BP2 protein CTD PMID:35688186 G3bp2 Rat CGP 52608 multiple interactions ISO G3BP2 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to G3BP2 gene] CTD PMID:28238834 G3bp2 Rat chlorpyrifos decreases expression ISO G3bp2 (Mus musculus) 6480464 Chlorpyrifos results in decreased expression of G3BP2 mRNA CTD PMID:37019170 G3bp2 Rat copper atom increases expression ISO G3bp2 (Mus musculus) 6480464 Copper results in increased expression of G3BP2 mRNA CTD PMID:16629173 G3bp2 Rat copper(0) increases expression ISO G3bp2 (Mus musculus) 6480464 Copper results in increased expression of G3BP2 mRNA CTD PMID:16629173 G3bp2 Rat coumarin decreases phosphorylation ISO G3BP2 (Homo sapiens) 6480464 coumarin results in decreased phosphorylation of G3BP2 protein CTD PMID:35688186 G3bp2 Rat coumestrol multiple interactions ISO G3BP2 (Homo sapiens) 6480464 [Coumestrol co-treated with 2 and 3-bis(3'-hydroxybenzyl)butyrolactone] results in increased expression of G3BP2 mRNA CTD PMID:19167446 G3bp2 Rat crocidolite asbestos affects expression ISO G3BP2 (Homo sapiens) 6480464 Asbestos and Crocidolite affects the expression of G3BP2 mRNA CTD PMID:17331233 G3bp2 Rat Cuprizon multiple interactions ISO G3BP2 (Homo sapiens) 6480464 [Cuprizone co-treated with Benztropine] results in decreased expression of G3BP2 protein CTD PMID:34122009 G3bp2 Rat cyproconazole increases expression ISO G3bp2 (Mus musculus) 6480464 cyproconazole results in increased expression of G3BP2 mRNA CTD PMID:22334560 G3bp2 Rat deguelin decreases expression ISO G3BP2 (Homo sapiens) 6480464 deguelin results in decreased expression of G3BP2 mRNA CTD PMID:33512557 G3bp2 Rat deoxynivalenol decreases phosphorylation ISO G3bp2 (Mus musculus) 6480464 deoxynivalenol results in decreased phosphorylation of G3BP2 protein CTD PMID:23352502 G3bp2 Rat diarsenic trioxide decreases expression ISO G3BP2 (Homo sapiens) 6480464 Arsenic Trioxide results in decreased expression of G3BP2 protein CTD PMID:15894607 G3bp2 Rat diarsenic trioxide multiple interactions ISO G3BP2 (Homo sapiens) 6480464 [Tretinoin co-treated with Arsenic Trioxide] results in decreased expression of G3BP2 protein CTD PMID:15894607 G3bp2 Rat dibutyl phthalate increases expression ISO G3bp2 (Mus musculus) 6480464 Dibutyl Phthalate results in increased expression of G3BP2 mRNA CTD PMID:21266533 G3bp2 Rat dorsomorphin multiple interactions ISO G3BP2 (Homo sapiens) 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of G3BP2 mRNA CTD PMID:27188386 G3bp2 Rat Enterolactone multiple interactions ISO G3BP2 (Homo sapiens) 6480464 [Coumestrol co-treated with 2 and 3-bis(3'-hydroxybenzyl)butyrolactone] results in increased expression of G3BP2 mRNA CTD PMID:19167446 G3bp2 Rat epoxiconazole increases expression ISO G3bp2 (Mus musculus) 6480464 epoxiconazole results in increased expression of G3BP2 mRNA CTD PMID:22334560 G3bp2 Rat ethanol affects splicing ISO G3bp2 (Mus musculus) 6480464 Ethanol affects the splicing of G3BP2 mRNA CTD PMID:30319688 G3bp2 Rat folic acid multiple interactions ISO G3bp2 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of G3BP2 mRNA CTD PMID:22206623 G3bp2 Rat FR900359 increases phosphorylation ISO G3BP2 (Homo sapiens) 6480464 FR900359 results in increased phosphorylation of G3BP2 protein CTD PMID:37730182 G3bp2 Rat gentamycin decreases expression EXP 6480464 Gentamicins results in decreased expression of G3BP2 mRNA CTD PMID:33387578 G3bp2 Rat hydrogen peroxide affects expression ISO G3BP2 (Homo sapiens) 6480464 Hydrogen Peroxide affects the expression of G3BP2 mRNA CTD PMID:20044591 G3bp2 Rat isoprenaline increases expression EXP 6480464 Isoproterenol results in increased expression of G3BP2 mRNA and Isoproterenol results in increased expression of G3BP2 protein CTD PMID:28816235 G3bp2 Rat isoprenaline multiple interactions EXP 6480464 G3BP2 protein promotes the reaction [Isoproterenol results in increased expression of MYH7 mRNA] more ... CTD PMID:28816235 G3bp2 Rat ivermectin decreases expression ISO G3BP2 (Homo sapiens) 6480464 Ivermectin results in decreased expression of G3BP2 protein CTD PMID:32959892 G3bp2 Rat lead(0) affects splicing ISO G3BP2 (Homo sapiens) 6480464 Lead affects the splicing of G3BP2 mRNA CTD PMID:28903495 G3bp2 Rat methylmercury chloride increases expression ISO G3BP2 (Homo sapiens) 6480464 methylmercuric chloride results in increased expression of G3BP2 mRNA CTD PMID:26272509 G3bp2 Rat N-methyl-4-phenylpyridinium decreases expression ISO G3bp2 (Mus musculus) 6480464 1-Methyl-4-phenylpyridinium results in decreased expression of G3BP2 protein CTD PMID:26558463 G3bp2 Rat N-methyl-4-phenylpyridinium decreases expression ISO G3BP2 (Homo sapiens) 6480464 1-Methyl-4-phenylpyridinium results in decreased expression of G3BP2 mRNA CTD PMID:24810058 G3bp2 Rat nickel atom increases expression ISO G3BP2 (Homo sapiens) 6480464 Nickel results in increased expression of G3BP2 mRNA CTD PMID:24768652 and PMID:25583101 G3bp2 Rat Nutlin-3 multiple interactions ISO G3BP2 (Homo sapiens) 6480464 [Dactinomycin co-treated with nutlin 3] results in increased secretion of G3BP2 protein CTD PMID:38460933 G3bp2 Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of G3BP2 mRNA CTD PMID:33387578 G3bp2 Rat pentachlorophenol increases expression ISO G3bp2 (Mus musculus) 6480464 Pentachlorophenol results in increased expression of G3BP2 mRNA CTD PMID:23892564 G3bp2 Rat poly(I:C) multiple interactions EXP 6480464 [Poly I-C co-treated with HU 211] results in decreased expression of G3BP2 mRNA CTD PMID:26923065 G3bp2 Rat propiconazole increases expression ISO G3bp2 (Mus musculus) 6480464 propiconazole results in increased expression of G3BP2 mRNA CTD PMID:21278054 and PMID:22334560 G3bp2 Rat pyrrolidine dithiocarbamate multiple interactions EXP 6480464 pyrrolidine dithiocarbamic acid inhibits the reaction [G3BP2 protein results in increased expression of MYH7 mRNA] more ... CTD PMID:28816235 G3bp2 Rat SB 431542 multiple interactions ISO G3BP2 (Homo sapiens) 6480464 [LDN 193189 co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 and PMID:37664457 G3bp2 Rat sodium arsenite increases expression ISO G3BP2 (Homo sapiens) 6480464 sodium arsenite results in increased expression of G3BP2 mRNA CTD PMID:21457566 G3bp2 Rat sodium arsenite increases activity ISO G3BP2 (Homo sapiens) 6480464 sodium arsenite results in increased activity of G3BP2 protein CTD PMID:30528433 G3bp2 Rat sulforaphane decreases methylation ISO G3BP2 (Homo sapiens) 6480464 sulforaphane results in decreased methylation of G3BP2 gene CTD PMID:31838189 G3bp2 Rat temozolomide decreases expression ISO G3BP2 (Homo sapiens) 6480464 Temozolomide results in decreased expression of G3BP2 mRNA CTD PMID:31758290 G3bp2 Rat tetrachloromethane decreases expression EXP 6480464 Carbon Tetrachloride results in decreased expression of CFHR2 mRNA CTD PMID:31150632 G3bp2 Rat tetrachloromethane multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of CFHR2 mRNA] CTD PMID:31150632 G3bp2 Rat thioacetamide decreases expression EXP 6480464 Thioacetamide results in decreased expression of CFHR2 mRNA CTD PMID:34492290 G3bp2 Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of G3BP2 mRNA CTD PMID:34492290 G3bp2 Rat titanium dioxide increases methylation ISO G3bp2 (Mus musculus) 6480464 titanium dioxide results in increased methylation of G3BP2 promoter CTD PMID:35295148 G3bp2 Rat titanium dioxide decreases methylation ISO G3bp2 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of G3BP2 promoter CTD PMID:35295148 G3bp2 Rat trichostatin A decreases expression ISO G3BP2 (Homo sapiens) 6480464 trichostatin A results in decreased expression of G3BP2 mRNA CTD PMID:26272509 G3bp2 Rat trichostatin A multiple interactions ISO G3BP2 (Homo sapiens) 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of G3BP2 mRNA CTD PMID:27188386 G3bp2 Rat triphenyl phosphate affects expression ISO G3BP2 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of G3BP2 mRNA CTD PMID:37042841 G3bp2 Rat valproic acid decreases methylation ISO G3BP2 (Homo sapiens) 6480464 Valproic Acid results in decreased methylation of G3BP2 gene CTD PMID:29154799 G3bp2 Rat valproic acid increases expression ISO G3BP2 (Homo sapiens) 6480464 Valproic Acid results in increased expression of G3BP2 mRNA CTD PMID:23179753 G3bp2 Rat valproic acid decreases expression ISO G3BP2 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of G3BP2 mRNA CTD PMID:27188386
G3bp2 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 14 16,216,684 - 16,304,828 (+) NCBI GRCr8 mRatBN7.2 14 15,932,403 - 16,020,555 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 14 15,987,417 - 16,020,548 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx PNT010002061.1 764 - 14,667 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 14 17,261,452 - 17,352,942 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 14 15,956,911 - 16,045,070 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 14 17,437,145 - 17,523,254 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 14 17,492,081 - 17,520,792 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 14 17,354,824 - 17,440,632 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 14 17,556,967 - 17,588,259 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 14 17,556,966 - 17,588,256 (+) NCBI Celera 14 15,382,373 - 15,410,837 (+) NCBI Celera Cytogenetic Map 14 p22 NCBI
G3BP2 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 4 75,642,786 - 75,724,437 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 4 75,641,849 - 75,724,589 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 4 76,567,970 - 76,649,621 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 4 76,786,990 - 76,817,629 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 4 73,864,091 - 73,894,093 (-) NCBI Celera Cytogenetic Map 4 q21.1 NCBI HuRef 4 72,314,522 - 72,345,439 (-) NCBI HuRef CHM1_1 4 76,544,613 - 76,575,399 (-) NCBI CHM1_1 T2T-CHM13v2.0 4 78,982,913 - 79,064,565 (-) NCBI T2T-CHM13v2.0
G3bp2 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 5 92,200,004 - 92,285,584 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 5 92,200,005 - 92,231,578 (-) Ensembl GRCm39 Ensembl GRCm38 5 92,052,145 - 92,137,725 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 5 92,052,146 - 92,083,719 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 5 92,481,172 - 92,512,761 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 5 93,129,700 - 93,158,857 (-) NCBI MGSCv36 mm8 Celera 5 90,195,328 - 90,226,988 (-) NCBI Celera Cytogenetic Map 5 E2 NCBI cM Map 5 45.84 NCBI
G3bp2 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955474 1,562,163 - 1,632,449 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955474 1,565,048 - 1,632,427 (-) NCBI ChiLan1.0 ChiLan1.0
G3BP2 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 3 54,348,316 - 54,430,945 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 4 54,538,058 - 54,620,695 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 4 48,481,019 - 48,563,664 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 4 54,368,332 - 54,399,374 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 4 54,317,504 - 54,399,374 (+) Ensembl panpan1.1 panPan2
G3BP2 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 32 218,783 - 305,734 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 32 220,439 - 252,593 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 32 41,628,351 - 41,662,321 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 32 243,197 - 277,215 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 32 218,539 - 330,366 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 32 240,015 - 273,921 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 32 196,041 - 229,980 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 32 39,940,407 - 39,974,408 (+) NCBI UU_Cfam_GSD_1.0
G3bp2
G3BP2 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 8 71,273,126 - 71,363,410 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 8 71,273,125 - 71,363,474 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 8 75,411,009 - 75,499,390 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
G3BP2 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 7 24,149,920 - 24,236,502 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 7 24,148,750 - 24,180,210 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666037 2,477,228 - 2,507,624 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
G3bp2
.
Predicted Target Of
Count of predictions: 24 Count of miRNA genes: 18 Interacting mature miRNAs: 22 Transcripts: ENSRNOT00000003346 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1300114 Srn2 Serum renin concentration QTL 2 3.27 blood renin amount (VT:0003349) plasma renin activity level (CMO:0000116) 14 3813074 21217635 Rat 2293089 Iddm31 Insulin dependent diabetes mellitus QTL 31 4.7 blood glucose amount (VT:0000188) age at onset/diagnosis of type 1 diabetes mellitus (CMO:0001140) 14 3813074 18274691 Rat 1581500 Renag1 Renal agenesis QTL 1 kidney development trait (VT:0000527) percentage of study population developing unilateral renal agenesis during a period of time (CMO:0000940) 14 8170668 68298175 Rat 731183 Pia20 Pristane induced arthritis QTL 20 3.55 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 14 9088978 39057237 Rat 631212 Bw5 Body weight QTL5 5.43 retroperitoneal fat pad mass (VT:0010430) retroperitoneal fat pad weight to body weight ratio (CMO:0000635) 14 11030812 30320092 Rat 2302277 Gluco38 Glucose level QTL 38 5.8 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 14 11030622 28035204 Rat 1331740 Bw26 Body weight QTL 26 3.028 body mass (VT:0001259) body weight (CMO:0000012) 14 3813074 30767156 Rat 619619 Rf4 Renal disease susceptibility QTL 4 4.1 0.002 urine total protein amount (VT:0000032) urine protein excretion rate to body weight ratio (CMO:0001099) 14 1 32754612 Rat 1358296 Ael3 Aortic elastin QTL 3 3.7 0.00051 aorta elastin amount (VT:0003905) aortic elastin 14 8267090 53267090 Rat 70195 Mcs8 Mammary carcinoma susceptibility QTL 8 4.28 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 14 3813074 24531477 Rat 2300183 Bmd60 Bone mineral density QTL 60 5.7 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 14 1 26541967 Rat 631839 Niddm37 Non-insulin dependent diabetes mellitus QTL 37 3.37 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 14 11030622 95876975 Rat 634352 Apr6 Acute phase response QTL 6 3.7 blood interleukin-6 amount (VT:0008595) plasma interleukin-6 level (CMO:0001927) 14 1 41131407 Rat 2300159 Bmd61 Bone mineral density QTL 61 5.3 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 14 1 26541967 Rat 70204 Niddm20 Non-insulin dependent diabetes mellitus QTL 20 5.1 0.000008 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 14 1217606 16960180 Rat 2302045 Pia39 Pristane induced arthritis QTL 39 4.9 0.001 blood immunoglobulin amount (VT:0002460) serum immunoglobulin G2a level (CMO:0002116) 14 8267090 53267090 Rat 1300140 Srn3 Serum renin concentration QTL 3 3.19 blood renin amount (VT:0003349) plasma renin activity level (CMO:0000116) 14 14875168 30883947 Rat
D14Rat78
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 14 16,279,376 - 16,279,486 (+) Marker Load Pipeline mRatBN7.2 14 15,995,099 - 15,995,211 (+) MAPPER mRatBN7.2 Rnor_6.0 14 17,499,969 - 17,500,078 NCBI Rnor6.0 Rnor_5.0 14 17,417,347 - 17,417,456 UniSTS Rnor5.0 RGSC_v3.4 14 17,564,855 - 17,564,965 RGD RGSC3.4 RGSC_v3.4 14 17,564,856 - 17,564,965 UniSTS RGSC3.4 RGSC_v3.1 14 17,564,855 - 17,564,965 RGD Celera 14 15,390,261 - 15,390,370 UniSTS SHRSP x BN Map 14 6.9 UniSTS SHRSP x BN Map 14 6.9 RGD Cytogenetic Map 14 p22 UniSTS
D14Hmgc13
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 14 16,276,405 - 16,276,639 (+) Marker Load Pipeline mRatBN7.2 14 15,992,128 - 15,992,362 (+) MAPPER mRatBN7.2 Rnor_6.0 14 17,496,999 - 17,497,232 NCBI Rnor6.0 Rnor_5.0 14 17,414,377 - 17,414,610 UniSTS Rnor5.0 Celera 14 15,387,291 - 15,387,524 UniSTS Cytogenetic Map 14 p22 UniSTS
RH125852
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 14 16,017,892 - 16,018,140 (+) MAPPER mRatBN7.2 Rnor_6.0 14 17,520,592 - 17,520,839 NCBI Rnor6.0 Rnor_5.0 14 17,437,970 - 17,438,217 UniSTS Rnor5.0 RGSC_v3.4 14 17,588,056 - 17,588,303 UniSTS RGSC3.4 Celera 14 15,410,634 - 15,410,881 UniSTS Cytogenetic Map 14 p22 UniSTS
RH141183
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 14 16,018,710 - 16,018,907 (+) MAPPER mRatBN7.2 mRatBN7.2 3 59,363,011 - 59,363,187 (+) MAPPER mRatBN7.2 Rnor_6.0 3 61,371,485 - 61,371,660 NCBI Rnor6.0 Rnor_6.0 14 17,521,410 - 17,521,606 NCBI Rnor6.0 Rnor_5.0 14 17,438,788 - 17,438,984 UniSTS Rnor5.0 Rnor_5.0 3 67,839,469 - 67,839,644 UniSTS Rnor5.0 RGSC_v3.4 14 17,588,874 - 17,589,070 UniSTS RGSC3.4 RGSC_v3.4 3 57,074,290 - 57,074,465 UniSTS RGSC3.4 Celera 3 58,886,168 - 58,886,343 UniSTS Celera 14 15,411,452 - 15,411,648 UniSTS Cytogenetic Map 14 p22 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000003346 ⟹ ENSRNOP00000003346
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 14 15,987,676 - 16,018,975 (+) Ensembl Rnor_6.0 Ensembl 14 17,492,081 - 17,520,792 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000094514 ⟹ ENSRNOP00000091154
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 14 15,987,417 - 16,020,548 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000117159 ⟹ ENSRNOP00000079770
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 14 15,997,965 - 16,018,968 (+) Ensembl
RefSeq Acc Id:
NM_001013989 ⟹ NP_001014011
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 14 16,271,656 - 16,304,828 (+) NCBI mRatBN7.2 14 15,987,377 - 16,020,555 (+) NCBI Rnor_6.0 14 17,492,081 - 17,520,795 (+) NCBI Rnor_5.0 14 17,354,824 - 17,440,632 (+) NCBI RGSC_v3.4 14 17,556,967 - 17,588,259 (+) RGD Celera 14 15,382,373 - 15,410,837 (+) RGD
Sequence:
CCCGAGTGAGCGAGCGCGGCGCCATACTGCGCGTGCTCCGCAGAGGGACGCGAGAAGGCTGGGTCCAGCTCTCCAAACTGATGCCTGATTGGCTGGCGTTGTGCTGGGGGGTTCCCTAGCCCTTTCCG
hide sequence
RefSeq Acc Id:
NM_001401436 ⟹ NP_001388365
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 14 16,271,656 - 16,304,828 (+) NCBI mRatBN7.2 14 15,987,377 - 16,020,555 (+) NCBI
RefSeq Acc Id:
NM_001401437 ⟹ NP_001388366
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 14 16,216,684 - 16,304,828 (+) NCBI mRatBN7.2 14 15,932,403 - 16,020,555 (+) NCBI
RefSeq Acc Id:
NM_001401438 ⟹ NP_001388367
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 14 16,216,684 - 16,304,828 (+) NCBI mRatBN7.2 14 15,932,403 - 16,020,555 (+) NCBI
RefSeq Acc Id:
NM_001401439 ⟹ NP_001388368
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 14 16,271,911 - 16,304,828 (+) NCBI mRatBN7.2 14 15,987,632 - 16,020,555 (+) NCBI
RefSeq Acc Id:
XM_006250734 ⟹ XP_006250796
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 14 16,271,903 - 16,304,824 (+) NCBI mRatBN7.2 14 15,987,624 - 16,020,555 (+) NCBI Rnor_6.0 14 17,492,211 - 17,523,254 (+) NCBI Rnor_5.0 14 17,354,824 - 17,440,632 (+) NCBI
Sequence:
GGGGTAAAACAATAAGAGGGGGCGGCGGCAAAGGGGGCGGGACGTCCGTGTTCTCGGAGCTCGTTGCAGCTCTAGGCTCTCGGGAAGAGGTGGCTGTGAGAGGCCCGAGCTCGCTGCTCTCTGGATTC
hide sequence
RefSeq Acc Id:
XM_006250736 ⟹ XP_006250798
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 14 16,272,485 - 16,304,824 (+) NCBI mRatBN7.2 14 15,988,204 - 16,020,555 (+) NCBI Rnor_6.0 14 17,493,128 - 17,523,252 (+) NCBI Rnor_5.0 14 17,354,824 - 17,440,632 (+) NCBI
Sequence:
GTTACCGAGGAATTAAAAGGACGTTTCAGTGCTTTGGGAATGGGTTTTCTACCCCCACCATTCT
hide sequence
RefSeq Acc Id:
XM_063273059 ⟹ XP_063129129
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 14 16,272,485 - 16,304,824 (+) NCBI
RefSeq Acc Id:
NP_001014011 ⟸ NM_001013989
- Peptide Label:
isoform 2
- UniProtKB:
Q6AY21 (UniProtKB/TrEMBL), A0A8I6ABI3 (UniProtKB/TrEMBL), A0A8I5ZNB2 (UniProtKB/TrEMBL)
- Sequence:
MVMEKPSPLLVGREFVRQYYTLLNKAPEYLHRFYGRNSSYVHGGVDASGKPQEAVYGQNDIHHKVLSLNFSECHTKIRHVDAHATLSDGVVVQVMGLLSNSGQPERKFMQTFVLAPEGSVPNKFYVHN
hide sequence
RefSeq Acc Id:
XP_006250796 ⟸ XM_006250734
- Peptide Label:
isoform X1
- UniProtKB:
F7F5P9 (UniProtKB/TrEMBL), A6KKA6 (UniProtKB/TrEMBL), A0A8I5ZNB2 (UniProtKB/TrEMBL)
- Sequence:
MVMEKPSPLLVGREFVRQYYTLLNKAPEYLHRFYGRNSSYVHGGVDASGKPQEAVYGQNDIHHKVLSLNFSECHTKIRHVDAHATLSDGVVVQVMGLLSNSGQPERKFMQTFVLAPEGSVPNKFYVHN
hide sequence
RefSeq Acc Id:
XP_006250798 ⟸ XM_006250736
- Peptide Label:
isoform X1
- UniProtKB:
F7F5P9 (UniProtKB/TrEMBL), A6KKA6 (UniProtKB/TrEMBL), A0A8I5ZNB2 (UniProtKB/TrEMBL)
- Sequence:
MVMEKPSPLLVGREFVRQYYTLLNKAPEYLHRFYGRNSSYVHGGVDASGKPQEAVYGQNDIHHKVLSLNFSECHTKIRHVDAHATLSDGVVVQVMGLLSNSGQPERKFMQTFVLAPEGSVPNKFYVHN
hide sequence
Ensembl Acc Id:
ENSRNOP00000003346 ⟸ ENSRNOT00000003346
Ensembl Acc Id:
ENSRNOP00000091154 ⟸ ENSRNOT00000094514
Ensembl Acc Id:
ENSRNOP00000079770 ⟸ ENSRNOT00000117159
RefSeq Acc Id:
NP_001388366 ⟸ NM_001401437
- Peptide Label:
isoform 1
- UniProtKB:
F7F5P9 (UniProtKB/TrEMBL), A6KKA6 (UniProtKB/TrEMBL), A0A8I5ZNB2 (UniProtKB/TrEMBL)
RefSeq Acc Id:
NP_001388367 ⟸ NM_001401438
- Peptide Label:
isoform 2
- UniProtKB:
Q6AY21 (UniProtKB/TrEMBL), A0A8I6ABI3 (UniProtKB/TrEMBL), A0A8I5ZNB2 (UniProtKB/TrEMBL)
RefSeq Acc Id:
NP_001388365 ⟸ NM_001401436
- Peptide Label:
isoform 1
- UniProtKB:
F7F5P9 (UniProtKB/TrEMBL), A6KKA6 (UniProtKB/TrEMBL), A0A8I5ZNB2 (UniProtKB/TrEMBL)
RefSeq Acc Id:
NP_001388368 ⟸ NM_001401439
- Peptide Label:
isoform 2
- UniProtKB:
Q6AY21 (UniProtKB/TrEMBL), A0A8I6ABI3 (UniProtKB/TrEMBL), A0A8I5ZNB2 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063129129 ⟸ XM_063273059
- Peptide Label:
isoform X2
- UniProtKB:
A0A8I6ABI3 (UniProtKB/TrEMBL), Q6AY21 (UniProtKB/TrEMBL), A0A8I5ZNB2 (UniProtKB/TrEMBL)
RGD ID: 13699217 Promoter ID: EPDNEW_R9742 Type: initiation region Name: G3bp2_1 Description: G3BP stress granule assembly factor 2 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 14 17,492,253 - 17,492,313 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-03-08
G3bp2
G3BP stress granule assembly factor 2
G3bp2
GTPase activating protein (SH3 domain) binding protein 2
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-02-26
G3bp2
GTPase activating protein (SH3 domain) binding protein 2
RGD1309571
similar to RNA-binding protein isoform G3BP-2a
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2005-12-06
RGD1309571
similar to RNA-binding protein isoform G3BP-2a
RGD1309571_predicted
similar to RNA-binding protein isoform G3BP-2a (predicted)
Symbol and Name updated
1559027 APPROVED
2005-01-20
RGD1309571_predicted
similar to RNA-binding protein isoform G3BP-2a (predicted)
LOC305240_predicted
Symbol and Name status set to approved
1331353 APPROVED
2005-01-12
LOC305240_predicted
similar to RNA-binding protein isoform G3BP-2a (predicted)
Symbol and Name status set to provisional
70820 PROVISIONAL
