Symbol:
Tbcel
Name:
tubulin folding cofactor E-like
RGD ID:
1308880
Description:
Predicted to enable alpha-tubulin binding activity. Predicted to be involved in microtubule cytoskeleton organization; post-chaperonin tubulin folding pathway; and tubulin complex assembly. Predicted to be located in cytoskeleton. Predicted to be active in cytoplasm. Orthologous to human TBCEL (tubulin folding cofactor E like); INTERACTS WITH 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine; 2,3,7,8-Tetrachlorodibenzofuran.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
leucine rich repeat containing 35; leucine-rich repeat-containing protein 35; LOC315591; Lrrc35; RGD1308880; similar to RIKEN cDNA E130107N23; tubulin-specific chaperone cofactor E-like protein
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
TBCEL (tubulin folding cofactor E like) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, PhylomeDB
Mus musculus (house mouse):
Tbcel (tubulin folding cofactor E-like) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Tbcel (tubulin folding cofactor E like) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
TBCEL (tubulin folding cofactor E like) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Tbcel (tubulin folding cofactor E like) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Mus musculus (house mouse):
Tbcel (tubulin folding cofactor E-like)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
TBCEL (tubulin folding cofactor E like)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
tbcela (tubulin folding cofactor E-like a)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
tbcelb (tubulin folding cofactor E-like b)
Alliance
DIOPT (Ensembl Compara|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB)
Saccharomyces cerevisiae (baker's yeast):
PAC2
Alliance
DIOPT (Ensembl Compara|OrthoFinder|PANTHER)
Caenorhabditis elegans (roundworm):
coel-1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Drosophila melanogaster (fruit fly):
mlt
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
tbcel
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 8 51,692,660 - 51,751,560 (-) NCBI GRCr8 mRatBN7.2 8 42,795,648 - 42,854,552 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 8 42,796,730 - 42,854,552 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 8 48,293,276 - 48,348,946 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 8 46,571,951 - 46,627,619 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 8 44,439,545 - 44,495,219 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 8 46,691,488 - 46,750,816 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 8 46,694,561 - 46,750,898 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 8 45,165,667 - 45,224,997 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 8 45,403,536 - 45,459,207 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 8 45,412,302 - 45,467,973 (-) NCBI Celera 8 42,392,239 - 42,447,663 (-) NCBI Celera Cytogenetic Map 8 q22 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Tbcel Rat (1->4)-beta-D-glucan multiple interactions ISO Tbcel (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of TBCEL mRNA CTD PMID:36331819 Tbcel Rat 1,1-dichloroethene decreases expression ISO Tbcel (Mus musculus) 6480464 vinylidene chloride results in decreased expression of TBCEL mRNA CTD PMID:26682919 Tbcel Rat 1,2-dimethylhydrazine decreases expression ISO Tbcel (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of TBCEL mRNA CTD PMID:22206623 Tbcel Rat 17beta-estradiol decreases expression ISO Tbcel (Mus musculus) 6480464 Estradiol results in decreased expression of TBCEL mRNA CTD PMID:39298647 Tbcel Rat 17beta-estradiol increases expression EXP 6480464 Estradiol results in increased expression of TBCEL mRNA CTD PMID:35192832 Tbcel Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Tbcel (Mus musculus) 6480464 [Tetrachlorodibenzodioxin binds to AHR protein] which results in increased expression of TBCEL mRNA and [TIPARP gene mutant form results in increased susceptibility to Tetrachlorodibenzodioxin] which results in increased expression of TBCEL mRNA CTD PMID:16214954 and PMID:25975270 Tbcel Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of TBCEL mRNA CTD PMID:33387578 Tbcel Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of TBCEL mRNA CTD PMID:32109520 Tbcel Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Tbcel (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of TBCEL mRNA CTD PMID:18343893 more ... Tbcel Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Tbcel (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of TBCEL mRNA CTD PMID:23994337 Tbcel Rat 2,3,7,8-Tetrachlorodibenzofuran affects expression ISO Tbcel (Mus musculus) 6480464 2 more ... CTD PMID:18343893 Tbcel Rat 2,3,7,8-Tetrachlorodibenzofuran decreases expression EXP 6480464 2 more ... CTD PMID:32109520 Tbcel Rat 3,3',4,4',5-pentachlorobiphenyl increases expression ISO Tbcel (Mus musculus) 6480464 3 more ... CTD PMID:23994337 Tbcel Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO TBCEL (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of TBCEL mRNA CTD PMID:28628672 Tbcel Rat 4,4'-sulfonyldiphenol affects expression ISO Tbcel (Mus musculus) 6480464 bisphenol S affects the expression of TBCEL mRNA CTD PMID:39298647 Tbcel Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of TBCEL mRNA CTD PMID:24780913 and PMID:25825206 Tbcel Rat acrylamide increases expression ISO Tbcel (Mus musculus) 6480464 Acrylamide results in increased expression of TBCEL mRNA CTD PMID:30807115 Tbcel Rat arsenite(3-) increases methylation ISO TBCEL (Homo sapiens) 6480464 arsenite results in increased methylation of TBCEL promoter CTD PMID:23974009 Tbcel Rat benzo[a]pyrene increases methylation ISO TBCEL (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of TBCEL promoter CTD PMID:27901495 Tbcel Rat beta-naphthoflavone increases expression ISO Tbcel (Mus musculus) 6480464 beta-Naphthoflavone results in increased expression of TBCEL mRNA CTD PMID:23994337 Tbcel Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of TBCEL mRNA CTD PMID:25181051 Tbcel Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of TBCEL gene CTD PMID:28505145 Tbcel Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of TBCEL mRNA CTD PMID:30816183 Tbcel Rat bisphenol F multiple interactions ISO TBCEL (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of TBCEL mRNA CTD PMID:28628672 Tbcel Rat carbon nanotube decreases expression ISO Tbcel (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 and PMID:25620056 Tbcel Rat CGP 52608 multiple interactions ISO TBCEL (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to TBCEL gene] CTD PMID:28238834 Tbcel Rat chlorpyrifos decreases expression ISO Tbcel (Mus musculus) 6480464 Chlorpyrifos results in decreased expression of TBCEL mRNA CTD PMID:37019170 Tbcel Rat cobalt dichloride increases expression ISO Tbcel (Mus musculus) 6480464 cobaltous chloride results in increased expression of TBCEL mRNA CTD PMID:21139344 Tbcel Rat copper(II) sulfate decreases expression ISO TBCEL (Homo sapiens) 6480464 Copper Sulfate results in decreased expression of TBCEL mRNA CTD PMID:19549813 Tbcel Rat Cuprizon increases expression EXP 6480464 Cuprizone results in increased expression of TBCEL mRNA CTD PMID:26577399 Tbcel Rat cyclosporin A decreases expression ISO Tbcel (Mus musculus) 6480464 Cyclosporine results in decreased expression of TBCEL mRNA CTD PMID:19770486 Tbcel Rat cyclosporin A decreases expression ISO TBCEL (Homo sapiens) 6480464 Cyclosporine results in decreased expression of TBCEL mRNA CTD PMID:25562108 Tbcel Rat dexamethasone multiple interactions ISO TBCEL (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of TBCEL mRNA CTD PMID:28628672 Tbcel Rat dichloroacetic acid increases expression ISO Tbcel (Mus musculus) 6480464 Dichloroacetic Acid results in increased expression of TBCEL mRNA CTD PMID:28962523 Tbcel Rat dicrotophos decreases expression ISO TBCEL (Homo sapiens) 6480464 dicrotophos results in decreased expression of TBCEL mRNA CTD PMID:28302478 Tbcel Rat diethyl maleate increases expression ISO Tbcel (Mus musculus) 6480464 diethyl maleate results in increased expression of TBCEL mRNA CTD PMID:25270620 Tbcel Rat dioxygen increases expression ISO Tbcel (Mus musculus) 6480464 Oxygen deficiency results in increased expression of TBCEL mRNA CTD PMID:22629407 Tbcel Rat dioxygen multiple interactions ISO Tbcel (Mus musculus) 6480464 Oxygen inhibits the reaction [Oxygen deficiency results in increased expression of TBCEL mRNA] CTD PMID:22629407 Tbcel Rat doxorubicin decreases expression ISO TBCEL (Homo sapiens) 6480464 Doxorubicin results in decreased expression of TBCEL mRNA CTD PMID:29803840 Tbcel Rat epoxiconazole affects expression ISO Tbcel (Mus musculus) 6480464 epoxiconazole affects the expression of TBCEL mRNA CTD PMID:35436446 Tbcel Rat formaldehyde increases expression ISO TBCEL (Homo sapiens) 6480464 Formaldehyde results in increased expression of TBCEL mRNA CTD PMID:23649840 Tbcel Rat fulvestrant increases methylation ISO TBCEL (Homo sapiens) 6480464 Fulvestrant results in increased methylation of TBCEL gene CTD PMID:31601247 Tbcel Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of TBCEL mRNA CTD PMID:33387578 Tbcel Rat hypochlorous acid increases expression ISO Tbcel (Mus musculus) 6480464 Hypochlorous Acid results in increased expression of TBCEL mRNA CTD PMID:19376150 Tbcel Rat indometacin multiple interactions ISO TBCEL (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of TBCEL mRNA CTD PMID:28628672 Tbcel Rat inulin multiple interactions ISO Tbcel (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in increased expression of TBCEL mRNA CTD PMID:36331819 Tbcel Rat leflunomide increases expression ISO TBCEL (Homo sapiens) 6480464 leflunomide results in increased expression of TBCEL mRNA CTD PMID:28988120 Tbcel Rat methyl methanesulfonate increases expression ISO TBCEL (Homo sapiens) 6480464 Methyl Methanesulfonate results in increased expression of TBCEL mRNA CTD PMID:23649840 Tbcel Rat methylmercury chloride decreases expression ISO TBCEL (Homo sapiens) 6480464 methylmercuric chloride results in decreased expression of TBCEL mRNA CTD PMID:28001369 Tbcel Rat orphenadrine affects expression EXP 6480464 Orphenadrine affects the expression of TBCEL mRNA CTD PMID:23665939 Tbcel Rat ozone multiple interactions ISO TBCEL (Homo sapiens) 6480464 [Air Pollutants results in increased abundance of Ozone] which affects the expression of TBCEL mRNA CTD PMID:35430440 Tbcel Rat paracetamol affects expression ISO Tbcel (Mus musculus) 6480464 Acetaminophen affects the expression of TBCEL mRNA CTD PMID:17562736 Tbcel Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of TBCEL mRNA CTD PMID:33387578 Tbcel Rat pentachlorophenol increases expression ISO Tbcel (Mus musculus) 6480464 Pentachlorophenol results in increased expression of TBCEL mRNA CTD PMID:23892564 Tbcel Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Tbcel (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of TBCEL mRNA more ... CTD PMID:36331819 Tbcel Rat phenobarbital multiple interactions ISO Tbcel (Mus musculus) 6480464 NR1I3 protein affects the reaction [Phenobarbital results in increased expression of TBCEL mRNA] CTD PMID:19482888 Tbcel Rat phenobarbital affects expression ISO Tbcel (Mus musculus) 6480464 Phenobarbital affects the expression of TBCEL mRNA CTD PMID:23091169 Tbcel Rat phenobarbital increases expression ISO Tbcel (Mus musculus) 6480464 Phenobarbital results in increased expression of TBCEL mRNA CTD PMID:19482888 Tbcel Rat sodium arsenite decreases expression ISO TBCEL (Homo sapiens) 6480464 sodium arsenite results in decreased expression of TBCEL mRNA CTD PMID:34032870 Tbcel Rat sodium fluoride increases expression ISO Tbcel (Mus musculus) 6480464 Sodium Fluoride results in increased expression of TBCEL protein CTD PMID:28918527 Tbcel Rat tamoxifen decreases expression ISO Tbcel (Mus musculus) 6480464 Tamoxifen results in decreased expression of TBCEL mRNA CTD PMID:25123088 Tbcel Rat tetrachloromethane decreases expression EXP 6480464 Carbon Tetrachloride results in decreased expression of TBCEL mRNA CTD PMID:31150632 Tbcel Rat tetrachloromethane decreases expression ISO Tbcel (Mus musculus) 6480464 Carbon Tetrachloride results in decreased expression of TBCEL mRNA CTD PMID:31919559 Tbcel Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of TBCEL mRNA CTD PMID:23411599 Tbcel Rat titanium dioxide increases expression ISO Tbcel (Mus musculus) 6480464 titanium dioxide results in increased expression of TBCEL mRNA CTD PMID:29264374 Tbcel Rat trichloroethene increases expression EXP 6480464 Trichloroethylene results in increased expression of TBCEL mRNA CTD PMID:33387578 Tbcel Rat triphenyl phosphate increases expression EXP 6480464 triphenyl phosphate results in increased expression of TBCEL mRNA CTD PMID:30589522 Tbcel Rat triphenyl phosphate affects expression ISO TBCEL (Homo sapiens) 6480464 triphenyl phosphate affects the expression of TBCEL mRNA CTD PMID:37042841 Tbcel Rat troglitazone decreases expression ISO Tbcel (Mus musculus) 6480464 troglitazone results in decreased expression of TBCEL mRNA CTD PMID:28973697 Tbcel Rat zearalenone decreases expression ISO Tbcel (Mus musculus) 6480464 Zearalenone results in decreased expression of TBCEL protein CTD PMID:36252740
(1->4)-beta-D-glucan (ISO) 1,1-dichloroethene (ISO) 1,2-dimethylhydrazine (ISO) 17beta-estradiol (EXP,ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,3,7,8-Tetrachlorodibenzofuran (EXP,ISO) 3,3',4,4',5-pentachlorobiphenyl (ISO) 3-isobutyl-1-methyl-7H-xanthine (ISO) 4,4'-sulfonyldiphenol (ISO) 6-propyl-2-thiouracil (EXP) acrylamide (ISO) arsenite(3-) (ISO) benzo[a]pyrene (ISO) beta-naphthoflavone (ISO) bisphenol A (EXP) bisphenol F (ISO) carbon nanotube (ISO) CGP 52608 (ISO) chlorpyrifos (ISO) cobalt dichloride (ISO) copper(II) sulfate (ISO) Cuprizon (EXP) cyclosporin A (ISO) dexamethasone (ISO) dichloroacetic acid (ISO) dicrotophos (ISO) diethyl maleate (ISO) dioxygen (ISO) doxorubicin (ISO) epoxiconazole (ISO) formaldehyde (ISO) fulvestrant (ISO) gentamycin (EXP) hypochlorous acid (ISO) indometacin (ISO) inulin (ISO) leflunomide (ISO) methyl methanesulfonate (ISO) methylmercury chloride (ISO) orphenadrine (EXP) ozone (ISO) paracetamol (EXP,ISO) pentachlorophenol (ISO) perfluorooctane-1-sulfonic acid (ISO) phenobarbital (ISO) sodium arsenite (ISO) sodium fluoride (ISO) tamoxifen (ISO) tetrachloromethane (EXP,ISO) thioacetamide (EXP) titanium dioxide (ISO) trichloroethene (EXP) triphenyl phosphate (EXP,ISO) troglitazone (ISO) zearalenone (ISO)
Tbcel Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 8 51,692,660 - 51,751,560 (-) NCBI GRCr8 mRatBN7.2 8 42,795,648 - 42,854,552 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 8 42,796,730 - 42,854,552 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 8 48,293,276 - 48,348,946 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 8 46,571,951 - 46,627,619 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 8 44,439,545 - 44,495,219 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 8 46,691,488 - 46,750,816 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 8 46,694,561 - 46,750,898 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 8 45,165,667 - 45,224,997 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 8 45,403,536 - 45,459,207 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 8 45,412,302 - 45,467,973 (-) NCBI Celera 8 42,392,239 - 42,447,663 (-) NCBI Celera Cytogenetic Map 8 q22 NCBI
TBCEL Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 11 121,024,102 - 121,090,776 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 11 121,024,072 - 121,090,776 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 11 120,894,811 - 120,961,485 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 11 120,400,040 - 120,463,333 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 11 118,054,255 - 118,119,808 (+) NCBI Celera Cytogenetic Map 11 q23.3 NCBI HuRef 11 116,834,886 - 116,900,437 (+) NCBI HuRef CHM1_1 11 120,782,217 - 120,847,771 (+) NCBI CHM1_1 T2T-CHM13v2.0 11 121,047,848 - 121,114,522 (+) NCBI T2T-CHM13v2.0
Tbcel Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 9 42,323,612 - 42,383,534 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 9 42,323,612 - 42,419,105 (-) Ensembl GRCm39 Ensembl GRCm38 9 42,412,316 - 42,472,238 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 9 42,412,316 - 42,507,809 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 9 42,220,400 - 42,280,309 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 9 42,163,312 - 42,223,221 (-) NCBI MGSCv36 mm8 Celera 9 39,660,436 - 39,721,240 (-) NCBI Celera Cytogenetic Map 9 A5.1 NCBI cM Map 9 23.71 NCBI
Tbcel Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955412 21,968,964 - 22,045,813 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955412 21,969,521 - 22,044,348 (+) NCBI ChiLan1.0 ChiLan1.0
TBCEL
Tbcel
.
Predicted Target Of
Count of predictions: 96 Count of miRNA genes: 80 Interacting mature miRNAs: 86 Transcripts: ENSRNOT00000059951 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1298065 Scl16 Serum cholesterol level QTL 16 3.8 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 8 30856404 75856404 Rat 1554321 Bmd3 Bone mineral density QTL 3 7.9 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 8 40952565 123900184 Rat 1578769 Uae31 Urinary albumin excretion QTL 31 3.3 0.001 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 8 30848154 101699754 Rat 1298079 Activ2 Activity QTL 2 9.5 0.000001 voluntary movement trait (VT:0003491) rearing measurement (CMO:0001515) 8 41866876 86866876 Rat 11556286 Cm81 Cardiac mass QTL 81 0.01 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 8 30848154 61290444 Rat 70161 Bp62 Blood pressure QTL 62 2.9 0.001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 8 42692684 90165460 Rat 1578765 Klgr1 Kidney lesion grade QTL 1 3.3 0.0001 kidney morphology trait (VT:0002135) organ lesion measurement (CMO:0000677) 8 30848154 101699754 Rat 1582222 Epfw2 Epididymal fat weight QTL 2 3.2 0.0005 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 8 31737729 76737729 Rat 1354627 Despr14 Despair related QTL 14 0.0056 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 8 7688955 52688955 Rat 61464 Niddm11 Non-insulin dependent diabetes mellitus QTL 11 3.1 0.001 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 8 35582032 80582032 Rat 1578755 Pur5 Proteinuria QTL 5 3.3 0.0001 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 8 30848154 101699754 Rat 1300146 Rf17 Renal function QTL 17 2.9 renal blood flow trait (VT:2000006) absolute change in renal blood flow rate (CMO:0001168) 8 28242912 73242912 Rat 8662823 Vetf5 Vascular elastic tissue fragility QTL 5 1.9 artery integrity trait (VT:0010639) patent ductus arteriosus score (CMO:0002566) 8 28242912 99525068 Rat 2313088 Bss75 Bone structure and strength QTL 75 3.1 0.0001 body length (VT:0001256) body length, nose to rump (CMO:0000079) 8 30848154 82460899 Rat 1358896 Bp262 Blood pressure QTL 262 2.89 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 8 27205715 99103503 Rat 731182 Uae24 Urinary albumin excretion QTL 24 6.4 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 8 19331152 93965294 Rat 724514 Uae15 Urinary albumin excretion QTL 15 2.9 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 8 29502665 70386295 Rat 61353 Bp35 Blood pressure QTL 35 0.001 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 8 30848154 61290444 Rat 631842 Inf1 Infertility severity QTL 1 4.1 0.001 seminal gland mass (VT:0010524) seminal vesicle wet weight (CMO:0001603) 8 22662330 67662330 Rat 737824 Hcar10 Hepatocarcinoma resistance QTL 10 2.9 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 8 40713066 82925667 Rat 1359033 Bp273 Blood pressure QTL 273 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 8 30848154 61290444 Rat 1331769 Rf39 Renal function QTL 39 3.871 urine output (VT:0003620) timed urine volume (CMO:0000260) 8 41866876 75097878 Rat 61358 Bp39 Blood pressure QTL 39 2 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 8 35551938 80551938 Rat 1358906 Bp253 Blood pressure QTL 253 4 0.0004 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 8 40713066 93965294 Rat 1358907 Cm40 Cardiac mass QTL 40 1.89 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 8 27205715 99103503 Rat 1331744 Bp217 Blood pressure QTL 217 3.398 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 8 30848154 58482492 Rat 2316950 Scl66 Serum cholesterol level QTL 66 4.1 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 8 30848259 105647037 Rat 1358892 Kidm26 Kidney mass QTL 26 3.69 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 8 27205715 99103503 Rat 1359021 Bp271 Blood pressure QTL 271 1.8 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 8 26644912 46711092 Rat 631216 Stl9 Serum triglyceride level QTL 9 4.71 0.0001 blood triglyceride amount (VT:0002644) serum triglyceride level (CMO:0000360) 8 41867010 70386132 Rat 61373 Mcs4 Mammary carcinoma susceptibility QTL 4 1.1 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 8 16290444 61290444 Rat 2313057 Bss76 Bone structure and strength QTL 76 3 0.0001 tibia size trait (VT:0100001) tibia midshaft cross-sectional area (CMO:0001717) 8 30848154 82460899 Rat 1549908 Neudeg1 Neurodegradation QTL 1 5.5 0 nervous system integrity trait (VT:0010566) logarithm of the ratio of the lesioned side motor neuron count to contralateral side motor neuron count (CMO:0001986) 8 30188867 94457446 Rat 2317030 Wbc5 White blood cell count QTL 5 3.21 0.005 leukocyte quantity (VT:0000217) white blood cell count (CMO:0000027) 8 8736635 53736635 Rat 1331804 Cm30 Cardiac mass QTL 30 3.77443 heart mass (VT:0007028) heart wet weight (CMO:0000069) 8 28242912 53961020 Rat 2313067 Bss77 Bone structure and strength QTL 77 3.1 0.0001 tibia size trait (VT:0100001) tibia midshaft endosteal cross-sectional area (CMO:0001716) 8 30848154 82460899 Rat 2317032 Ginf2 Gastrointestinal inflammation QTL 2 3.21 0.005 liver integrity trait (VT:0010547) liver granuloma severity score (CMO:0002157) 8 4705810 49705810 Rat 2301416 Bp315 Blood pressure QTL 315 0.008 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 8 7670578 52670578 Rat 2317036 Livw3 Liver weight QTL 3 2.43 0.01 liver mass (VT:0003402) liver weight to body weight ratio (CMO:0000633) 8 4705810 49705810 Rat 12880023 Bw184 Body weight QTL 184 0.001 body mass (VT:0001259) body weight (CMO:0000012) 8 2097640 47097640 Rat 5684993 Bmd84 Bone mineral density QTL 84 4.1 tibia mineral mass (VT:1000283) bone mineral content (CMO:0001554) 8 42692684 50095447 Rat 12880028 Cm103 Cardiac mass QTL 103 0.02 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 8 2097640 47097640 Rat 2317051 Aia18 Adjuvant induced arthritis QTL 18 2.42 joint integrity trait (VT:0010548) left rear ankle joint diameter (CMO:0002149) 8 8736635 53736635 Rat 2317048 Ginf1 Gastrointestinal inflammation QTL 1 3.52 0.005 cecum mucosa thickness (VT:0010234) enterocolitis severity score (CMO:0002138) 8 4705810 49705810 Rat 12880025 Cm102 Cardiac mass QTL 102 0.044 heart mass (VT:0007028) heart wet weight to body weight ratio (CMO:0002408) 8 2097640 47097640 Rat 1558646 Swd5 Spike wave discharge measurement QTL 5 3.45 0.00036 brain electrophysiology trait (VT:0010557) brain spike-and-wave discharge frequency (CMO:0001742) 8 14906751 59906751 Rat 2302278 Gluco36 Glucose level QTL 36 4.2 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 8 29502665 50095447 Rat 12880044 Am9 Aortic mass QTL 9 0.007 aorta mass (VT:0002845) aorta weight to aorta length to body weight ratio (CMO:0002722) 8 2097640 47097640 Rat 631648 Stl5 Serum triglyceride level QTL 5 4 0.0003 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 8 27205715 54998217 Rat 1331838 Niddm61 Non-insulin dependent diabetes mellitus QTL 61 3.53 0.0004 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 8 36469535 99083736 Rat 631650 Stl6 Serum triglyceride level QTL 6 4 0.0019 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 8 10378157 112202585 Rat 1581557 Eae16 Experimental allergic encephalomyelitis QTL 16 3.8 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046) 8 8462195 110921472 Rat 631271 Lecl1 Lens clarity QTL 1 0.001 lens clarity trait (VT:0001304) age of onset/diagnosis of cataract (CMO:0001584) 8 18984168 84531599 Rat 2303564 Gluco43 Glucose level QTL 43 3 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 8 26130187 71130187 Rat 1598824 Memor4 Memory QTL 4 2.5 exploratory behavior trait (VT:0010471) total horizontal distance resulting from voluntary locomotion in an experimental apparatus (CMO:0001443) 8 9712220 53356647 Rat 2313046 Bss78 Bone structure and strength QTL 78 3.5 0.0001 tibia strength trait (VT:1000284) tibia total energy absorbed before break (CMO:0001736) 8 30848154 82460899 Rat 1354595 Despr4 Despair related QTL 4 2.16 0.0036 locomotor behavior trait (VT:0001392) amount of time spent in voluntary immobility (CMO:0001043) 8 7688955 52688955 Rat 2303572 Insul13 Insulin level QTL 13 2 blood insulin amount (VT:0001560) blood insulin level (CMO:0000349) 8 26130187 71130187 Rat
BF409772
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 8 42,852,565 - 42,852,659 (+) MAPPER mRatBN7.2 Rnor_6.0 8 46,748,830 - 46,748,923 NCBI Rnor6.0 Rnor_5.0 8 45,223,011 - 45,223,104 UniSTS Rnor5.0 RGSC_v3.4 8 45,457,221 - 45,457,314 UniSTS RGSC3.4 Celera 8 42,445,678 - 42,445,771 UniSTS RH 3.4 Map 8 407.6 UniSTS Cytogenetic Map 8 q22 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000059951 ⟹ ENSRNOP00000056698
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 8 42,798,879 - 42,844,167 (-) Ensembl Rnor_6.0 Ensembl 8 46,694,561 - 46,750,898 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000115149 ⟹ ENSRNOP00000091803
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 8 42,796,730 - 42,854,552 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000119305 ⟹ ENSRNOP00000083279
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 8 42,798,879 - 42,838,791 (-) Ensembl
RefSeq Acc Id:
NM_001014089 ⟹ NP_001014111
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 51,695,889 - 51,751,560 (-) NCBI mRatBN7.2 8 42,798,878 - 42,854,552 (-) NCBI Rnor_6.0 8 46,694,718 - 46,750,816 (-) NCBI Rnor_5.0 8 45,165,667 - 45,224,997 (-) NCBI RGSC_v3.4 8 45,403,536 - 45,459,207 (-) RGD Celera 8 42,392,239 - 42,447,663 (-) RGD
Sequence:
GCAGGACACTGGGCTCCGCGGCCGGAGAGGGGGTCGAGGTGAAGCGGAGCTGGTCCGGGGCCGGCCTGGAACAGGCCGGAAGCCGAGCGGAGGCGACGGCGGTGGCCGGGCGGGCGGAGGCGCAGCCC
hide sequence
RefSeq Acc Id:
XM_006242859 ⟹ XP_006242921
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 51,692,660 - 51,741,798 (-) NCBI mRatBN7.2 8 42,795,648 - 42,844,788 (-) NCBI Rnor_6.0 8 46,691,488 - 46,742,783 (-) NCBI Rnor_5.0 8 45,165,667 - 45,224,997 (-) NCBI
Sequence:
GCATAATCTTTTTTCCAGTTTTAGGTGTGTCTTTTATGTTTTTAACGTCTTTTGATGATCAAAA
hide sequence
RefSeq Acc Id:
XM_039081415 ⟹ XP_038937343
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 51,692,660 - 51,741,798 (-) NCBI mRatBN7.2 8 42,795,648 - 42,844,788 (-) NCBI
RefSeq Acc Id:
XM_039081416 ⟹ XP_038937344
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 51,692,660 - 51,751,491 (-) NCBI mRatBN7.2 8 42,795,648 - 42,854,486 (-) NCBI
RefSeq Acc Id:
XM_039081417 ⟹ XP_038937345
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 51,711,958 - 51,741,798 (-) NCBI mRatBN7.2 8 42,816,800 - 42,844,788 (-) NCBI
RefSeq Acc Id:
XM_039081418 ⟹ XP_038937346
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 51,692,660 - 51,730,202 (-) NCBI mRatBN7.2 8 42,795,648 - 42,833,192 (-) NCBI
RefSeq Acc Id:
NP_001014111 ⟸ NM_001014089
- UniProtKB:
Q5PQJ7 (UniProtKB/Swiss-Prot), A0A8I5ZV57 (UniProtKB/TrEMBL)
- Sequence:
MDQPSGRSFMQVLCEKYSPENFPYRRGPGMGVHVPATPQGSPMKDRLNLPSVLVLNSCGITCAGDEREIAAFCAHVSELDLSDNKLQDWHEVSKIVSNVPQLEFLNLSSNPLSLSVLERTCAGSFSGV
hide sequence
RefSeq Acc Id:
XP_006242921 ⟸ XM_006242859
- Peptide Label:
isoform X3
- UniProtKB:
A0A8L2QRT5 (UniProtKB/TrEMBL), A6J3T2 (UniProtKB/TrEMBL), A0A8I5ZV57 (UniProtKB/TrEMBL)
- Sequence:
MASGVNVSNPALNFSEKKMDQPSGRSFMQVLCEKYSPENFPYRRGPGMGVHVPATPQGSPMKDR
hide sequence
Ensembl Acc Id:
ENSRNOP00000056698 ⟸ ENSRNOT00000059951
RefSeq Acc Id:
XP_038937344 ⟸ XM_039081416
- Peptide Label:
isoform X2
- UniProtKB:
A0A8I6AFW9 (UniProtKB/TrEMBL), A0A8I5ZV57 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038937343 ⟸ XM_039081415
- Peptide Label:
isoform X1
- UniProtKB:
A0A8I5ZV57 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038937346 ⟸ XM_039081418
- Peptide Label:
isoform X5
RefSeq Acc Id:
XP_038937345 ⟸ XM_039081417
- Peptide Label:
isoform X4
Ensembl Acc Id:
ENSRNOP00000091803 ⟸ ENSRNOT00000115149
Ensembl Acc Id:
ENSRNOP00000083279 ⟸ ENSRNOT00000119305
RGD ID: 13695876 Promoter ID: EPDNEW_R6401 Type: multiple initiation site Name: Tbcel_1 Description: tubulin folding cofactor E-like SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 8 46,750,809 - 46,750,869 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2008-03-06
Tbcel
tubulin folding cofactor E-like
Lrrc35
leucine rich repeat containing 35
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2006-03-30
Lrrc35
leucine rich repeat containing 35
RGD1308880
similar to RIKEN cDNA E130107N23
Symbol and Name updated
1299863 APPROVED
2005-12-06
RGD1308880
similar to RIKEN cDNA E130107N23
RGD1308880_predicted
similar to RIKEN cDNA E130107N23 (predicted)
Symbol and Name updated
1559027 APPROVED
2005-01-20
RGD1308880_predicted
similar to RIKEN cDNA E130107N23 (predicted)
LOC315591_predicted
Symbol and Name status set to approved
1331353 APPROVED
2005-01-12
LOC315591_predicted
similar to RIKEN cDNA E130107N23 (predicted)
Symbol and Name status set to provisional
70820 PROVISIONAL
