Advanced Search (OLGA)

Gene: Fkbp8 (FKBP prolyl isomerase 8) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Fkbp8

Name:

FKBP prolyl isomerase 8

RGD ID:

1308670

Description:

Predicted to enable several functions, including calmodulin binding activity; disordered domain specific binding activity; and identical protein binding activity. Predicted to be involved in several processes, including negative regulation of protein phosphorylation; protein folding; and regulation of mitophagy. Predicted to act upstream of or within several processes, including nervous system development; positive regulation of BMP signaling pathway; and smoothened signaling pathway. Predicted to be located in endoplasmic reticulum membrane and mitochondrion. Predicted to be part of protein-containing complex. Predicted to be active in several cellular components, including cytosol; endomembrane system; and mitochondrial envelope. Orthologous to human FKBP8 (FKBP prolyl isomerase 8); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,4,6-trinitrotoluene; 4-amino-2,6-dinitrotoluene.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

FK506 binding protein 8; FK506 binding protein 8, 38kDa; FK506-binding protein 8; FKBP-8; LOC290652; MGC125185; peptidyl-prolyl cis-trans isomerase; peptidyl-prolyl cis-trans isomerase FKBP8; PPIase; PPIase FKBP8; rotamase

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	FKBP8 (FKBP prolyl isomerase 8)	HGNC	Ensembl, HomoloGene, Inparanoid, NCBI, Panther, PhylomeDB
Mus musculus (house mouse):	Fkbp8 (FK506 binding protein 8)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Fkbp8 (FKBP prolyl isomerase 8)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	FKBP8 (FKBP prolyl isomerase 8)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	FKBP8 (FKBP prolyl isomerase 8)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Fkbp8 (FKBP prolyl isomerase 8)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	FKBP8 (FKBP prolyl isomerase 8)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	FKBP8 (FKBP prolyl isomerase 8)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Fkbp8 (FKBP prolyl isomerase 8)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	FKBP8 (FKBP prolyl isomerase 8)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Fkbp8 (FK506 binding protein 8)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	fkbp8 (FKBP prolyl isomerase 8)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	zda	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	fkbp8	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	16	18,929,581 - 18,936,621 (-)	NCBI		GRCr8
mRatBN7.2	16	18,895,608 - 18,902,648 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	16	18,893,576 - 18,902,612 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	16	18,937,354 - 18,944,324 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	16	20,070,071 - 20,077,034 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	16	18,990,316 - 18,997,286 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	16	20,645,956 - 20,652,890 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	16	20,645,957 - 20,652,889 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	16	20,501,665 - 20,508,369 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	16	19,401,883 - 19,407,192 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	16	19,401,881 - 19,408,527 (-)	NCBI
Celera	16	19,087,049 - 19,094,012 (-)	NCBI		Celera
Cytogenetic Map	16	p14	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Fkbp8	Rat	Marfanoid Mental Retardation Syndrome, Autosomal		ISO	FKBP8 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Marfanoid habitus and intellectual disability	ClinVar	PMID:25741868
Fkbp8	Rat	Megalencephaly-Polymicrogyria-Polydactyly-Hydrocephalus Syndrome 1		ISO	FKBP8 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Megalencephaly-polymicrogyria-polydactyly-hydrocephalus syndrome 1	ClinVar	PMID:28492532

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Fkbp8	Rat	clubfoot		ISS	Fkbp8 (Mus musculus)	13592920	OMIM:119800	MouseDO
Fkbp8	Rat	spina bifida		ISS	Fkbp8 (Mus musculus)	13592920		MouseDO

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Fkbp8	Rat	1,2-dimethylhydrazine	increases expression	ISO	Fkbp8 (Mus musculus)	6480464	1 and 2-Dimethylhydrazine results in increased expression of FKBP8 mRNA	CTD	PMID:22206623
Fkbp8	Rat	1-chloro-2,4-dinitrobenzene	affects binding	ISO	FKBP8 (Homo sapiens)	6480464	Dinitrochlorobenzene binds to FKBP8 protein	CTD	PMID:32991956
Fkbp8	Rat	17beta-hydroxy-17-methylestra-4,9,11-trien-3-one	decreases expression	ISO	FKBP8 (Homo sapiens)	6480464	Metribolone results in decreased expression of FKBP8 protein	CTD	PMID:17152098
Fkbp8	Rat	2,3,7,8-tetrachlorodibenzodioxine	affects expression	ISO	Fkbp8 (Mus musculus)	6480464	Tetrachlorodibenzodioxin affects the expression of FKBP8 mRNA	CTD	PMID:21570461
Fkbp8	Rat	2,3,7,8-tetrachlorodibenzodioxine	decreases expression	EXP		6480464	Tetrachlorodibenzodioxin results in decreased expression of FKBP8 mRNA	CTD	PMID:32109520
Fkbp8	Rat	2,4,6-trinitrotoluene	affects expression	EXP		6480464	Trinitrotoluene affects the expression of FKBP8 mRNA	CTD	PMID:21346803
Fkbp8	Rat	3,4-methylenedioxymethamphetamine	increases expression	ISO	Fkbp8 (Mus musculus)	6480464	N-Methyl-3 and 4-methylenedioxyamphetamine results in increased expression of FKBP8 mRNA	CTD	PMID:20188158
Fkbp8	Rat	4,4'-sulfonyldiphenol	increases expression	ISO	Fkbp8 (Mus musculus)	6480464	bisphenol S results in increased expression of FKBP8 mRNA	CTD	PMID:31881267 and PMID:39298647
Fkbp8	Rat	4-amino-2,6-dinitrotoluene	affects expression	EXP		6480464	4-amino-2 and 6-dinitrotoluene affects the expression of FKBP8 mRNA	CTD	PMID:21346803
Fkbp8	Rat	all-trans-4-oxoretinoic acid	increases expression	ISO	FKBP8 (Homo sapiens)	6480464	4-oxoretinoic acid results in increased expression of FKBP8 mRNA	CTD	PMID:15982314
Fkbp8	Rat	all-trans-retinoic acid	decreases expression	ISO	FKBP8 (Homo sapiens)	6480464	Tretinoin results in decreased expression of FKBP8 mRNA	CTD	PMID:15982314
Fkbp8	Rat	arsane	multiple interactions	ISO	FKBP8 (Homo sapiens)	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of FKBP8 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of FKBP8 mRNA	CTD	PMID:39836092
Fkbp8	Rat	arsenic atom	multiple interactions	ISO	FKBP8 (Homo sapiens)	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of FKBP8 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of FKBP8 mRNA	CTD	PMID:39836092
Fkbp8	Rat	atrazine	increases expression	ISO	FKBP8 (Homo sapiens)	6480464	Atrazine results in increased expression of FKBP8 mRNA	CTD	PMID:22378314
Fkbp8	Rat	beta-lapachone	decreases expression	ISO	FKBP8 (Homo sapiens)	6480464	beta-lapachone results in decreased expression of FKBP8 mRNA	CTD	PMID:38218311
Fkbp8	Rat	bis(2-ethylhexyl) phthalate	increases expression	ISO	Fkbp8 (Mus musculus)	6480464	Diethylhexyl Phthalate results in increased expression of FKBP8 mRNA	CTD	PMID:33754040
Fkbp8	Rat	bisphenol A	increases expression	EXP		6480464	bisphenol A results in increased expression of FKBP8 mRNA	CTD	PMID:25181051 and PMID:34947998
Fkbp8	Rat	bisphenol A	decreases expression	ISO	FKBP8 (Homo sapiens)	6480464	bisphenol A results in decreased expression of FKBP8 protein	CTD	PMID:37567409
Fkbp8	Rat	bisphenol A	increases expression	ISO	Fkbp8 (Mus musculus)	6480464	bisphenol A results in increased expression of FKBP8 mRNA	CTD	PMID:33221593
Fkbp8	Rat	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of FKBP8 mRNA	CTD	PMID:33296240
Fkbp8	Rat	bisphenol AF	increases expression	ISO	FKBP8 (Homo sapiens)	6480464	bisphenol AF results in increased expression of FKBP8 protein	CTD	PMID:34186270
Fkbp8	Rat	Bisphenol B	increases expression	ISO	FKBP8 (Homo sapiens)	6480464	bisphenol B results in increased expression of FKBP8 protein	CTD	PMID:34186270
Fkbp8	Rat	bisphenol F	increases expression	ISO	FKBP8 (Homo sapiens)	6480464	bisphenol F results in increased expression of FKBP8 protein	CTD	PMID:34186270
Fkbp8	Rat	cadmium dichloride	decreases methylation	EXP		6480464	Cadmium Chloride results in decreased methylation of FKBP8 promoter	CTD	PMID:22457795
Fkbp8	Rat	cannabidiol	multiple interactions	ISO	FKBP8 (Homo sapiens)	6480464	[Cuprizone co-treated with Cannabidiol] results in decreased expression of FKBP8 protein	CTD	PMID:34122009
Fkbp8	Rat	CGP 52608	multiple interactions	ISO	FKBP8 (Homo sapiens)	6480464	CGP 52608 promotes the reaction [RORA protein binds to FKBP8 gene]	CTD	PMID:28238834
Fkbp8	Rat	chlorpyrifos	decreases expression	ISO	Fkbp8 (Mus musculus)	6480464	Chlorpyrifos results in decreased expression of FKBP8 mRNA	CTD	PMID:32715474
Fkbp8	Rat	chlorpyrifos	increases expression	ISO	Fkbp8 (Mus musculus)	6480464	Chlorpyrifos results in increased expression of FKBP8 mRNA	CTD	PMID:37019170
Fkbp8	Rat	chromium(6+)	affects expression	ISO	Fkbp8 (Mus musculus)	6480464	chromium hexavalent ion affects the expression of FKBP8 mRNA	CTD	PMID:24374135
Fkbp8	Rat	ciguatoxin CTX1B	affects expression	ISO	Fkbp8 (Mus musculus)	6480464	Ciguatoxins affects the expression of FKBP8 mRNA	CTD	PMID:18353800
Fkbp8	Rat	clofibrate	decreases expression	ISO	Fkbp8 (Mus musculus)	6480464	Clofibrate results in decreased expression of FKBP8 mRNA	CTD	PMID:17585979
Fkbp8	Rat	clozapine	decreases expression	ISO	FKBP8 (Homo sapiens)	6480464	Clozapine results in decreased expression of FKBP8 protein	CTD	PMID:34122009
Fkbp8	Rat	Cuprizon	multiple interactions	ISO	FKBP8 (Homo sapiens)	6480464	[Cuprizone co-treated with Cannabidiol] results in decreased expression of FKBP8 protein	CTD	PMID:34122009
Fkbp8	Rat	doxorubicin	increases expression	ISO	FKBP8 (Homo sapiens)	6480464	Doxorubicin results in increased expression of FKBP8 mRNA	CTD	PMID:16404146 and PMID:29803840
Fkbp8	Rat	epoxiconazole	decreases expression	ISO	Fkbp8 (Mus musculus)	6480464	epoxiconazole results in decreased expression of FKBP8 mRNA	CTD	PMID:35436446
Fkbp8	Rat	ethanol	affects splicing	ISO	Fkbp8 (Mus musculus)	6480464	Ethanol affects the splicing of FKBP8 mRNA	CTD	PMID:30319688
Fkbp8	Rat	fenofibrate	increases expression	ISO	Fkbp8 (Mus musculus)	6480464	Fenofibrate results in increased expression of FKBP8 mRNA	CTD	PMID:21318169
Fkbp8	Rat	fenthion	increases expression	ISO	Fkbp8 (Mus musculus)	6480464	Fenthion results in increased expression of FKBP8 mRNA	CTD	PMID:34813904
Fkbp8	Rat	flutamide	increases expression	EXP		6480464	Flutamide results in increased expression of FKBP8 mRNA	CTD	PMID:24136188
Fkbp8	Rat	folic acid	increases expression	ISO	Fkbp8 (Mus musculus)	6480464	Folic Acid results in increased expression of FKBP8 mRNA	CTD	PMID:25629700
Fkbp8	Rat	FR900359	increases phosphorylation	ISO	FKBP8 (Homo sapiens)	6480464	FR900359 results in increased phosphorylation of FKBP8 protein	CTD	PMID:37730182
Fkbp8	Rat	gentamycin	decreases expression	EXP		6480464	Gentamicins results in decreased expression of FKBP8 mRNA	CTD	PMID:22061828
Fkbp8	Rat	hydrogen cyanide	decreases expression	ISO	Fkbp8 (Mus musculus)	6480464	Hydrogen Cyanide results in decreased expression of FKBP8 mRNA	CTD	PMID:33914522
Fkbp8	Rat	isotretinoin	decreases expression	ISO	FKBP8 (Homo sapiens)	6480464	Isotretinoin results in decreased expression of FKBP8 mRNA	CTD	PMID:15982314
Fkbp8	Rat	ivermectin	decreases expression	ISO	FKBP8 (Homo sapiens)	6480464	Ivermectin results in decreased expression of FKBP8 protein	CTD	PMID:32959892
Fkbp8	Rat	manganese atom	multiple interactions	ISO	FKBP8 (Homo sapiens)	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of FKBP8 mRNA	CTD	PMID:39836092
Fkbp8	Rat	manganese(0)	multiple interactions	ISO	FKBP8 (Homo sapiens)	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of FKBP8 mRNA	CTD	PMID:39836092
Fkbp8	Rat	manganese(II) chloride	multiple interactions	ISO	FKBP8 (Homo sapiens)	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of FKBP8 mRNA	CTD	PMID:39836092
Fkbp8	Rat	methotrexate	decreases expression	ISO	FKBP8 (Homo sapiens)	6480464	Methotrexate results in decreased expression of FKBP8 mRNA	CTD	PMID:24449571
Fkbp8	Rat	N-methyl-4-phenylpyridinium	increases expression	ISO	Fkbp8 (Mus musculus)	6480464	1-Methyl-4-phenylpyridinium results in increased expression of FKBP8 protein	CTD	PMID:26558463
Fkbp8	Rat	nitrates	multiple interactions	ISO	Fkbp8 (Mus musculus)	6480464	[Particulate Matter results in increased abundance of Nitrates] which results in increased expression of FKBP8 mRNA	CTD	PMID:35964746
Fkbp8	Rat	ochratoxin A	increases acetylation	ISO	FKBP8 (Homo sapiens)	6480464	ochratoxin A results in increased acetylation of FKBP8 promoter	CTD	PMID:29098329
Fkbp8	Rat	ochratoxin A	multiple interactions	ISO	FKBP8 (Homo sapiens)	6480464	[ochratoxin A results in increased acetylation of FKBP8 promoter] which results in increased expression of FKBP8 mRNA	CTD	PMID:29098329
Fkbp8	Rat	ochratoxin A	increases expression	ISO	FKBP8 (Homo sapiens)	6480464	ochratoxin A results in increased expression of FKBP8 mRNA	CTD	PMID:29098329
Fkbp8	Rat	paracetamol	decreases expression	ISO	FKBP8 (Homo sapiens)	6480464	Acetaminophen results in decreased expression of FKBP8 mRNA	CTD	PMID:29067470
Fkbp8	Rat	pentachlorophenol	increases expression	ISO	Fkbp8 (Mus musculus)	6480464	Pentachlorophenol results in increased expression of FKBP8 mRNA	CTD	PMID:23892564
Fkbp8	Rat	pioglitazone	increases expression	ISO	FKBP8 (Homo sapiens)	6480464	Pioglitazone results in increased expression of FKBP8 mRNA	CTD	PMID:32589349
Fkbp8	Rat	potassium cyanide	increases expression	ISO	Fkbp8 (Mus musculus)	6480464	Potassium Cyanide results in increased expression of FKBP8 mRNA	CTD	PMID:33914522
Fkbp8	Rat	quercetin	increases expression	ISO	FKBP8 (Homo sapiens)	6480464	Quercetin results in increased expression of FKBP8 mRNA	CTD	PMID:21632981
Fkbp8	Rat	resveratrol	multiple interactions	ISO	FKBP8 (Homo sapiens)	6480464	[Plant Extracts co-treated with Resveratrol] results in decreased expression of FKBP8 mRNA	CTD	PMID:23557933
Fkbp8	Rat	rotenone	decreases expression	ISO	Fkbp8 (Mus musculus)	6480464	Rotenone results in decreased expression of FKBP8 mRNA	CTD	PMID:23186747
Fkbp8	Rat	SB 431542	multiple interactions	ISO	FKBP8 (Homo sapiens)	6480464	[LDN 193189 co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide co-treated with FGF2 protein] results in decreased expression of FKBP8 protein	CTD	PMID:37664457
Fkbp8	Rat	sodium arsenite	increases expression	EXP		6480464	sodium arsenite results in increased expression of FKBP8 protein	CTD	PMID:29459688
Fkbp8	Rat	sodium arsenite	multiple interactions	ISO	FKBP8 (Homo sapiens)	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of FKBP8 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of FKBP8 mRNA	CTD	PMID:39836092
Fkbp8	Rat	sodium arsenite	increases expression	ISO	FKBP8 (Homo sapiens)	6480464	sodium arsenite results in increased expression of FKBP8 mRNA	CTD	PMID:38568856
Fkbp8	Rat	tert-butyl hydroperoxide	decreases expression	ISO	FKBP8 (Homo sapiens)	6480464	tert-Butylhydroperoxide results in decreased expression of FKBP8 mRNA	CTD	PMID:15336504
Fkbp8	Rat	testosterone enanthate	affects expression	ISO	FKBP8 (Homo sapiens)	6480464	testosterone enanthate affects the expression of FKBP8 mRNA	CTD	PMID:17440010
Fkbp8	Rat	tetrahydropalmatine	decreases expression	ISO	FKBP8 (Homo sapiens)	6480464	tetrahydropalmatine results in decreased expression of FKBP8 protein	CTD	PMID:20109541
Fkbp8	Rat	titanium dioxide	decreases methylation	ISO	Fkbp8 (Mus musculus)	6480464	titanium dioxide results in decreased methylation of FKBP8 promoter alternative form	CTD	PMID:35295148
Fkbp8	Rat	triphenyl phosphate	affects expression	ISO	FKBP8 (Homo sapiens)	6480464	triphenyl phosphate affects the expression of FKBP8 mRNA	CTD	PMID:37042841
Fkbp8	Rat	trovafloxacin	decreases expression	ISO	Fkbp8 (Mus musculus)	6480464	trovafloxacin results in decreased expression of FKBP8 mRNA	CTD	PMID:35537566
Fkbp8	Rat	valproic acid	affects expression	ISO	Fkbp8 (Mus musculus)	6480464	Valproic Acid affects the expression of FKBP8 mRNA	CTD	PMID:17963808
Fkbp8	Rat	valproic acid	decreases expression	ISO	Fkbp8 (Mus musculus)	6480464	Valproic Acid results in decreased expression of FKBP8 mRNA	CTD	PMID:21427059

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Fkbp8	Rat	apoptotic process	acts_upstream_of	IEA	UniProtKB:O35465 and ensembl:ENSMUSP00000114069	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Fkbp8	Rat	apoptotic process	involved_in	IEA	UniProtKB-KW:KW-0053	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Fkbp8	Rat	apoptotic process	acts_upstream_of	ISO	Fkbp8 (Mus musculus)	1624291	MGI:3775614 PMID:18003640	RGD	PMID:18003640
Fkbp8	Rat	BMP signaling pathway	acts_upstream_of	ISO	Fkbp8 (Mus musculus)	1624291	MGI:3042750 PMID:18590716	RGD	PMID:18590716
Fkbp8	Rat	BMP signaling pathway	acts_upstream_of	IEA	UniProtKB:O35465 and ensembl:ENSMUSP00000114069	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Fkbp8	Rat	camera-type eye development	acts_upstream_of_or_within	ISO	Fkbp8 (Mus musculus)	1624291	MGI:3042750 PMID:15105374	RGD	PMID:15105374
Fkbp8	Rat	camera-type eye development	acts_upstream_of_or_within	IEA	UniProtKB:O35465 and ensembl:ENSMUSP00000114069	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Fkbp8	Rat	cell fate specification	acts_upstream_of_or_within	IEA	UniProtKB:O35465 and ensembl:ENSMUSP00000114069	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Fkbp8	Rat	cell fate specification	acts_upstream_of_or_within	ISO	Fkbp8 (Mus musculus)	1624291	MGI:3042750 PMID:18590716	RGD	PMID:18590716
Fkbp8	Rat	dorsal/ventral neural tube patterning	acts_upstream_of_or_within	ISO	Fkbp8 (Mus musculus)	1624291	MGI:107689 more ...	RGD	PMID:18003640 and PMID:18590716
Fkbp8	Rat	dorsal/ventral neural tube patterning	acts_upstream_of_or_within	IEA	UniProtKB:O35465 and ensembl:ENSMUSP00000114069	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Fkbp8	Rat	dorsal/ventral pattern formation	acts_upstream_of_or_within	ISO	Fkbp8 (Mus musculus)	1624291	MGI:3042750 PMID:15105374	RGD	PMID:15105374
Fkbp8	Rat	dorsal/ventral pattern formation	acts_upstream_of_or_within	IEA	UniProtKB:O35465 and ensembl:ENSMUSP00000114069	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Fkbp8	Rat	multicellular organism growth	acts_upstream_of_or_within	IEA	UniProtKB:O35465 and ensembl:ENSMUSP00000114069	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Fkbp8	Rat	multicellular organism growth	acts_upstream_of_or_within	ISO	Fkbp8 (Mus musculus)	1624291	MGI:108075 PMID:18590716	RGD	PMID:18590716
Fkbp8	Rat	negative regulation of apoptotic process	acts_upstream_of_or_within	ISO	Fkbp8 (Mus musculus)	1624291	MGI:3775614 PMID:18003640	RGD	PMID:18003640
Fkbp8	Rat	negative regulation of apoptotic process	acts_upstream_of_or_within	IEA	UniProtKB:O35465 and ensembl:ENSMUSP00000114069	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Fkbp8	Rat	negative regulation of apoptotic process	involved_in	IBA	MGI:1341070 and PANTHER:PTN005308844	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Fkbp8	Rat	negative regulation of protein phosphorylation	involved_in	ISO	FKBP8 (Homo sapiens)	1624291	PMID:15733859	RGD	PMID:15733859
Fkbp8	Rat	neural tube development	acts_upstream_of_or_within	IEA	UniProtKB:O35465 and ensembl:ENSMUSP00000114069	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Fkbp8	Rat	neural tube development	acts_upstream_of_or_within	ISO	Fkbp8 (Mus musculus)	1624291	MGI:3042750 PMID:18590716	RGD	PMID:18590716
Fkbp8	Rat	neuron fate specification	acts_upstream_of_or_within	ISO	Fkbp8 (Mus musculus)	1624291	MGI:3042750 PMID:15105374	RGD	PMID:15105374
Fkbp8	Rat	neuron fate specification	acts_upstream_of_or_within	IEA	UniProtKB:O35465 and ensembl:ENSMUSP00000114069	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Fkbp8	Rat	positive regulation of BMP signaling pathway	acts_upstream_of_or_within	ISO	Fkbp8 (Mus musculus)	1624291	MGI:3042750 PMID:18590716	RGD	PMID:18590716
Fkbp8	Rat	positive regulation of BMP signaling pathway	acts_upstream_of_or_within	IEA	UniProtKB:O35465 and ensembl:ENSMUSP00000114069	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Fkbp8	Rat	protein folding	acts_upstream_of_or_within	ISO	FKBP8 (Homo sapiens)	1624291	PMID:29916806	RGD	PMID:29916806
Fkbp8	Rat	protein folding	acts_upstream_of_or_within	IEA	UniProtKB:Q14318 and ensembl:ENSP00000476767	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Fkbp8	Rat	protein folding	acts_upstream_of_or_within	ISO	Fkbp8 (Mus musculus)	1624291	PMID:29916806	RGD	PMID:29916806
Fkbp8	Rat	protein folding	involved_in	IBA	MGI:1341070 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Fkbp8	Rat	protein folding	acts_upstream_of_or_within	IEA	UniProtKB:O35465 and ensembl:ENSMUSP00000114069	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Fkbp8	Rat	protein localization to mitochondrion	involved_in	ISO	FKBP8 (Homo sapiens)	1624291	UniProtKB:Q9GZQ8 and PMID:31908024	RGD	PMID:31908024
Fkbp8	Rat	protein localization to mitochondrion	involved_in	IEA	UniProtKB:Q14318 and ensembl:ENSP00000476767	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Fkbp8	Rat	regulation of BMP signaling pathway	acts_upstream_of_or_within	ISO	Fkbp8 (Mus musculus)	1624291	MGI:95728 PMID:18590716	RGD	PMID:18590716
Fkbp8	Rat	regulation of BMP signaling pathway	acts_upstream_of_or_within	IEA	UniProtKB:O35465 and ensembl:ENSMUSP00000114069	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Fkbp8	Rat	regulation of gene expression	acts_upstream_of_or_within	ISO	Fkbp8 (Mus musculus)	1624291	MGI:108075 PMID:18590716	RGD	PMID:18590716
Fkbp8	Rat	regulation of gene expression	acts_upstream_of_or_within	IEA	UniProtKB:O35465 and ensembl:ENSMUSP00000114069	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Fkbp8	Rat	regulation of mitophagy	involved_in	ISO	FKBP8 (Homo sapiens)	1624291	PMID:28381481 and PMID:31908024	RGD	PMID:28381481 and PMID:31908024
Fkbp8	Rat	regulation of mitophagy	involved_in	IEA	UniProtKB:Q14318 and ensembl:ENSP00000476767	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Fkbp8	Rat	smoothened signaling pathway	acts_upstream_of_or_within	ISO	Fkbp8 (Mus musculus)	1624291	MGI:3042750 more ...	RGD	PMID:15105374
Fkbp8	Rat	smoothened signaling pathway	acts_upstream_of_or_within	IEA	UniProtKB:O35465 and ensembl:ENSMUSP00000114069	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Fkbp8	Rat	cytosol	located_in	ISO	FKBP8 (Homo sapiens) more ...	1624291		RGD	GO_REF:0000052
Fkbp8	Rat	cytosol	located_in	IEA	UniProtKB:Q14318 and ensembl:ENSP00000476767	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Fkbp8	Rat	cytosol	is_active_in	IBA	FB:FBgn0034368 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Fkbp8	Rat	endomembrane system	is_active_in	IBA	FB:FBgn0034368 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Fkbp8	Rat	endoplasmic reticulum	located_in	ISO	FKBP8 (Homo sapiens) more ...	1624291		RGD	GO_REF:0000052
Fkbp8	Rat	endoplasmic reticulum	located_in	IEA	UniProtKB:Q14318 and ensembl:ENSP00000476767	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Fkbp8	Rat	endoplasmic reticulum membrane	located_in	IEA	UniProtKB:O35465 and ensembl:ENSMUSP00000114069	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Fkbp8	Rat	endoplasmic reticulum membrane	located_in	ISO	Fkbp8 (Mus musculus)	1624291	PMID:15105374	RGD	PMID:15105374
Fkbp8	Rat	membrane	located_in	IEA	UniProtKB-KW:KW-0472	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Fkbp8	Rat	membrane	is_active_in	IBA	MGI:1341070 and PANTHER:PTN005308844	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Fkbp8	Rat	mitochondrial envelope	located_in	IEA	UniProtKB:O35465 and ensembl:ENSMUSP00000114069	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Fkbp8	Rat	mitochondrial envelope	located_in	ISO	Fkbp8 (Mus musculus)	1624291	PMID:15105374	RGD	PMID:15105374
Fkbp8	Rat	mitochondrial envelope	is_active_in	IBA	MGI:1341070 and PANTHER:PTN005308844	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Fkbp8	Rat	mitochondrial membrane	located_in	IEA	UniProtKB-SubCell:SL-0171	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Fkbp8	Rat	mitochondrion	located_in	ISO	FKBP8 (Homo sapiens) more ...	1624291		RGD	GO_REF:0000052
Fkbp8	Rat	mitochondrion	located_in	IEA	UniProtKB-KW:KW-0496	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Fkbp8	Rat	mitochondrion	located_in	IEA	UniProtKB:Q14318 and ensembl:ENSP00000476767	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Fkbp8	Rat	protein-containing complex	part_of	ISO	FKBP8 (Homo sapiens)	1624291	PMID:15733859	RGD	PMID:15733859
Fkbp8	Rat	protein-containing complex	part_of	IEA	UniProtKB:Q14318 and ensembl:ENSP00000476767	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Fkbp8	Rat	calmodulin binding	enables	ISO	FKBP8 (Homo sapiens)	1624291	UniProtKB:P0DP23 more ...	RGD	PMID:20707607 and PMID:24145868
Fkbp8	Rat	calmodulin binding	enables	IEA	UniProtKB:Q14318 and ensembl:ENSP00000476767	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Fkbp8	Rat	disordered domain specific binding	enables	ISO	FKBP8 (Homo sapiens)	1624291	UniProtKB:P10415 and PMID:15733859	RGD	PMID:15733859
Fkbp8	Rat	disordered domain specific binding	enables	IEA	UniProtKB:Q14318 and ensembl:ENSP00000476767	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Fkbp8	Rat	identical protein binding	enables	ISO	FKBP8 (Homo sapiens)	1624291	UniProtKB:Q14318 and PMID:17024179	RGD	PMID:17024179
Fkbp8	Rat	identical protein binding	enables	IEA	UniProtKB:Q14318 and ensembl:ENSP00000476767	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Fkbp8	Rat	isomerase activity	enables	IEA	UniProtKB-KW:KW-0413	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Fkbp8	Rat	isomerase activity	enables	IEA	UniRule:UR000413783	1600115	GO_REF:0000104	UniProt	GO_REF:0000104
Fkbp8	Rat	peptidyl-prolyl cis-trans isomerase activity	enables	IEA	UniProtKB-KW:KW-0697	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Fkbp8	Rat	peptidyl-prolyl cis-trans isomerase activity	enables	IEA	RHEA:16237	1600115	GO_REF:0000116	RHEA	GO_REF:0000116
Fkbp8	Rat	peptidyl-prolyl cis-trans isomerase activity	enables	IEA	EC:5.2.1.8	1600115	GO_REF:0000003	UniProt	GO_REF:0000003
Fkbp8	Rat	peptidyl-prolyl cis-trans isomerase activity	enables	IEA	InterPro:IPR001179 and InterPro:IPR046357	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Fkbp8	Rat	protein binding	enables	ISO	FKBP8 (Homo sapiens)	1624291	UniProtKB:C5E526 more ...	RGD	PMID:16844119 more ...
Fkbp8	Rat	protein binding	enables	ISO	Fkbp8 (Mus musculus)	1624291	PR:Q8VHE6 more ...	RGD	PMID:29916806
Fkbp8	Rat	protein binding	enables	ISO	FKBP8 (Sus scrofa)	1624291	UniProtKB:P19712-PRO_0000038060 and PMID:26748656	RGD	PMID:26748656
Fkbp8	Rat	protein binding	enables	ISO	FKBP8 (Homo sapiens) and UniProtKB:Q14318-2	1624291	UniProtKB:Q15746-1 and PMID:35537812	RGD	PMID:35537812
Fkbp8	Rat	protein folding chaperone	enables	ISO	FKBP8 (Homo sapiens)	1624291	PMID:29916806	RGD	PMID:29916806
Fkbp8	Rat	protein folding chaperone	enables	IEA	UniProtKB:O35465 and ensembl:ENSMUSP00000114069	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Fkbp8	Rat	protein folding chaperone	enables	ISO	Fkbp8 (Mus musculus)	1624291	PMID:29916806	RGD	PMID:29916806
Fkbp8	Rat	protein folding chaperone	enables	IBA	MGI:1341070 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Fkbp8	Rat	protein folding chaperone	enables	IEA	UniProtKB:Q14318 and ensembl:ENSP00000476767	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
3.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
4.	GOA pipeline	RGD automated data pipeline
5.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

PMID:12477932	PMID:15105374	PMID:15733859	PMID:17024179	PMID:18003640	PMID:18590716	PMID:18614015	PMID:19946888	PMID:26748656	PMID:29916806	PMID:31505169

Fkbp8
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	16	18,929,581 - 18,936,621 (-)	NCBI		GRCr8
mRatBN7.2	16	18,895,608 - 18,902,648 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	16	18,893,576 - 18,902,612 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	16	18,937,354 - 18,944,324 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	16	20,070,071 - 20,077,034 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	16	18,990,316 - 18,997,286 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	16	20,645,956 - 20,652,890 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	16	20,645,957 - 20,652,889 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	16	20,501,665 - 20,508,369 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	16	19,401,883 - 19,407,192 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	16	19,401,881 - 19,408,527 (-)	NCBI
Celera	16	19,087,049 - 19,094,012 (-)	NCBI		Celera
Cytogenetic Map	16	p14	NCBI

FKBP8
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	19	18,531,763 - 18,543,573 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	19	18,531,751 - 18,544,077 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	19	18,642,573 - 18,654,383 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	19	18,503,568 - 18,515,383 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	19	18,503,567 - 18,515,383	NCBI
Celera	19	18,544,773 - 18,556,588 (-)	NCBI		Celera
Cytogenetic Map	19	p13.11	NCBI
HuRef	19	18,205,047 - 18,217,230 (-)	NCBI		HuRef
CHM1_1	19	18,643,053 - 18,654,863 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	19	18,667,119 - 18,678,929 (-)	NCBI		T2T-CHM13v2.0

Fkbp8
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	8	70,980,371 - 70,987,978 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	8	70,980,374 - 70,987,978 (+)	Ensembl		GRCm39 Ensembl
GRCm38	8	70,527,721 - 70,535,328 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	8	70,527,724 - 70,535,328 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	8	73,051,642 - 73,059,227 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	8	73,458,516 - 73,464,312 (+)	NCBI		MGSCv36	mm8
Celera	8	73,084,164 - 73,091,753 (+)	NCBI		Celera
Cytogenetic Map	8	B3.3	NCBI
cM Map	8	34.15	NCBI

Fkbp8
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955524	3,036,953 - 3,044,296 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955524	3,037,825 - 3,044,296 (+)	NCBI	ChiLan1.0	ChiLan1.0

FKBP8
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	20	23,391,263 - 23,403,519 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	19	22,399,718 - 22,411,982 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	19	18,009,505 - 18,021,772 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	19	18,980,269 - 18,992,170 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	19	18,980,269 - 18,992,170 (-)	Ensembl	panpan1.1		panPan2

FKBP8
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	20	44,494,856 - 44,504,084 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	20	44,489,219 - 44,598,497 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	20	44,409,560 - 44,418,774 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	20	44,981,067 - 44,990,281 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	20	44,980,688 - 44,990,281 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	20	44,218,433 - 44,227,646 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	20	44,628,579 - 44,637,790 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	20	44,904,032 - 44,913,247 (+)	NCBI		UU_Cfam_GSD_1.0

Fkbp8
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405118	203,177,956 - 203,186,579 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936596	2,728,114 - 2,735,317 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936596	2,728,089 - 2,735,718 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

FKBP8
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	2	59,253,342 - 59,267,165 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	2	59,256,546 - 59,267,171 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	2	59,035,636 - 59,046,247 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

FKBP8
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	6	17,007,764 - 17,018,409 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	6	17,007,390 - 17,017,714 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666074	2,321,762 - 2,332,880 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Fkbp8
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla 1.0	NW_004624908	1,713,590 - 1,720,709 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Fkbp8
18 total Variants

Assembly: RGSC_v3.4

Chromosome	Start Pos	End Pos	Reference Nucleotide	Variant Nucleotide	Variant Type	Strain	Variant Page
16	19406900	19406901	C	A	snv	SS/JrHsdMcwi (MCW)	View more Information

Predicted Target Of

	Summary Value
Count of predictions:	76
Count of miRNA genes:	62
Interacting mature miRNAs:	68
Transcripts:	ENSRNOT00000027040
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
631561	Hcuc2	Hepatic copper content QTL 2	2.8		liver copper amount (VT:0003065)	liver total copper weight (CMO:0001507)	16	1	39533949	Rat
1582235	Insul8	Insulin level QTL 8	3.3	0.0063	blood insulin amount (VT:0001560)	calculated serum insulin level (CMO:0000359)	16	1	26727669	Rat
2307172	Activ4	Activity QTL 4	3.71	0.00023	locomotor behavior trait (VT:0001392)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	16	1	33418960	Rat
1354584	Despr6	Despair related QTL 6	3.1	0.0067	locomotor behavior trait (VT:0001392)	amount of time spent in voluntary immobility (CMO:0001043)	16	1	39533930	Rat
2302380	Slep6	Serum leptin concentration QTL 6	3.36		blood leptin amount (VT:0005667)	serum leptin level (CMO:0000780)	16	1	32139025	Rat
737819	Hcas4	Hepatocarcinoma susceptibility QTL 4	4.43		liver integrity trait (VT:0010547)	volume of individual liver tumorous lesion (CMO:0001078)	16	4227609	46975965	Rat
631517	Scl9	Serum cholesterol level QTL 9	3.3		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	16	15726433	21034895	Rat
9590151	Scort8	Serum corticosterone level QTL 8	8.45	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	16	1	30836262	Rat
1354625	Despr7	Despair related QTL 7	3.16	0.016	locomotor behavior trait (VT:0001392)	amount of time spent in voluntary immobility (CMO:0001043)	16	1	44977551	Rat
61338	Bp23	Blood pressure QTL 23	4.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	16	4227609	49227609	Rat
61405	Niddm6	Non-insulin dependent diabetes mellitus QTL 6	3.66	0.001	blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	16	4227609	48972724	Rat
631830	Alc7	Alcohol consumption QTL 7	2.9		consumption behavior trait (VT:0002069)	ethanol drink intake rate (CMO:0001407)	16	1	26727669	Rat
7411664	Foco30	Food consumption QTL 30	11	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	16	1	44588133	Rat
1600378	Arunc4	Aerobic running capacity QTL 4		0.03	exercise endurance trait (VT:0002332)	maximum distance run on treadmill (CMO:0001406)	16	380245	80345693	Rat
70183	BpQTLcluster13	Blood pressure QTL cluster 13	3.654		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	16	4227609	43025077	Rat
1600369	Hcas8	Hepatocarcinoma susceptibility QTL 8			liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	16	1	22477621	Rat
737826	Alc11	Alcohol consumption QTL 11	3.2		consumption behavior trait (VT:0002069)	ethanol drink intake rate (CMO:0001407)	16	4227609	60252231	Rat
2303566	Bw90	Body weight QTL 90	2		body mass (VT:0001259)	body weight (CMO:0000012)	16	1	39533930	Rat
2312663	Slep9	Serum leptin concentration QTL 9		0.001	blood leptin amount (VT:0005667)	serum leptin level (CMO:0000780)	16	832236	59492508	Rat
2306902	Bp339	Blood pressure QTL 339		0.01	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	16	3380150	43025077	Rat
1300133	Rf24	Renal function QTL 24	3.64		blood creatinine amount (VT:0005328)	creatinine clearance (CMO:0000765)	16	3380150	21361552	Rat
2312660	Bw95	Body weight QTL 95		0.05	inguinal fat pad mass (VT:0010424)	inguinal fat pad weight to body weight ratio (CMO:0001253)	16	832236	59492508	Rat
2312666	Insul16	Insulin level QTL 16		0.01	blood insulin amount (VT:0001560)	serum insulin level (CMO:0000358)	16	832236	59492508	Rat
634355	Rends4	Renal damage susceptibility QTL 4		0.05	kidney blood vessel morphology trait (VT:0000530)	organ lesion measurement (CMO:0000677)	16	1	26727669	Rat
70205	Gcr3	Gastric cancer resistance QTL 3	2.3		stomach morphology trait (VT:0000470)	stomach tumor diameter (CMO:0001889)	16	17696791	82635055	Rat
2293343	Glom16	Glomerulus QTL 16	7.4		kidney glomerulus integrity trait (VT:0010546)	kidney sclerotic glomeruli count to total glomeruli count ratio (CMO:0001269)	16	832236	46053497	Rat
6903319	Bw114	Body weight QTL 114	2.7	0.0037	body mass (VT:0001259)	body weight (CMO:0000012)	16	1	43534949	Rat
2312669	Stl23	Serum triglyceride level QTL 23		0.01	blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	16	832236	59492508	Rat

RH128354

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	16	18,895,671 - 18,895,853 (+)	MAPPER	mRatBN7.2
Rnor_6.0	16	20,646,020 - 20,646,201	NCBI	Rnor6.0
Rnor_5.0	16	20,501,729 - 20,501,910	UniSTS	Rnor5.0
RGSC_v3.4	16	19,401,947 - 19,402,128	UniSTS	RGSC3.4
Celera	16	19,087,113 - 19,087,294	UniSTS
RH 3.4 Map	16	214.6	UniSTS
Cytogenetic Map	16	p14	UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31


RefSeq Transcripts	NM_001037180	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039094321	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039094322	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039094323	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039094326	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039094327	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039094328	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063275162	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063275163	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063275164	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063275165	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063275166	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063275167	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063275169	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063275170	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063275171	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063275172	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063275173	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063275174	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063275175	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063275176	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063275177	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063275178	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063275179	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063275180	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063275181	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063275182	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063275183	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063275184	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063275185	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC107454	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474031	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ216680	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ219623	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000016	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000077756 ⟹ ENSRNOP00000074539

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	16	18,893,576 - 18,902,612 (-)	Ensembl
Rnor_6.0 Ensembl	16	20,645,957 - 20,652,889 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000095622 ⟹ ENSRNOP00000087668

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	16	18,895,633 - 18,900,999 (-)	Ensembl

RefSeq Acc Id:

NM_001037180 ⟹ NP_001032257

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	16	18,929,581 - 18,936,543 (-)	NCBI
mRatBN7.2	16	18,895,608 - 18,902,570 (-)	NCBI
Rnor_6.0	16	20,645,956 - 20,652,890 (-)	NCBI
Rnor_5.0	16	20,501,665 - 20,508,369 (-)	NCBI
RGSC_v3.4	16	19,401,883 - 19,407,192 (-)	RGD
Celera	16	19,087,049 - 19,094,012 (-)	RGD

Sequence:

show sequence

CTGGGGGTGGGGAGGGGGGCACAGGACCCCAAGCGGGGTCCCCAAGCCGCAGGGCCAGTTCCTGATCCCCCAGCAGCATGGCGTCTTGGGCCGAGCCCTCTGAGCCTGCTGCCCAGCTACTTTGTGGG
GCCCCACTCCTGGAGGGCTTTGAGGTGCTTGATGGGGTTGATGATGCAGAGGAGGAAGATGACCTAAGTGGGTTGCCACCACTAGAGGATATGGGACAGCCTACGGTGGAGGAGGCTGAGCAGCCTGG
AGCCCTAGCTCGGGAGTTCCTGGCAGCCACAGAGCCTGAGCCAGCCCCAGCCCCCGCCCCGGAAGAGTGGCTGGACATTCTGGGGAACGGATTGCTGCGTAAGAAGACACTGGTCCCAGGCCCAACAG
GCTCTAGCCGCCCACTCAAGGGCCAGGTGGTGACCGTACACCTGCAGATGTCCCTGGAGAATGGCACCCGTGTGCAAGAGGAGCCCGAACTGGCTTTCACGCTTGGAGACTGCGATGTTATCCAGGCC
CTGGACCTCAGCGTCCCGCTCATGCATGTGGGCGAGACAGCAATGGTCACCGCTGACTCCAAGTACTGCTACGGTCCCCAGGGCAGCAGGAGCCCATACATCCCCCCCCATGCAGCCCTGTGCCTGGA
AGTCACCCTGAAGACAGCAGAGGATGGACCTGACCTGGAGATGCTGAGTGGGCAGGAGCGCGTGGCCCTGGCCAACCGCAAGCGGGAGTGTGGCAATGCCCACTACCAGCGTGCTGACTTTGTGCTGG
CTGCCAACTCCTATGACCTGGCCATCAAGGCCATCACCTCCAACGCCAAAGTGGACATGACTTGTGAGGAGGAGGAGGAGCTGCTACAGCTGAAGGTCAAGTGTCTGAACAACCTTGCGGCATCGCAG
CTAAAGCTGGACCACTACCGAGCAGCACTGCGCTCCTGTAGCCAGGTGCTGGAGCACCAGCCAGACAACATCAAGGCACTGTTCCGCAAGGGCAAGGTGCTGGCTCAGCAGGGTGAATACAGTGAGGC
CATCCCCATCCTGAGGGCGGCCCTGAAGCTGGAGCCTTCCAACAAGACGATCCATGCGGAGCTCTCAAAGCTGGTAAAGAAGCGTGCTGCACAGCGGAGCACAGAGACTGCCCTGTACCGAAAGATGC
TAGGCAACCCCAGCCGGCTGCCTGCCAAGTGTCCGGGCAAGGGTGCCTGGTCCATCCCGTGGAAATGGCTGTTTGGGGCAACTGCCGTGGCCCTGGGGGGCGTGGCTCTCTCTGTGGTCATTGCTGCC
AGGAACTGACTGTCCCCCTGCATACCTGGACCCCAACCTGTGCTCCCCAACTCCCCCAGGCTCCCTGTCCACTGCCCTCCCTGGCCGAGACACCTCCTATGGGTTGGGGGAGCAAGGATTGAGGGTCG
CACACCCCAACAAGCAGGAAAGACTGAGACCCTGAAAGGGGGCATGGGGTACAGCCCAGAGGGAGGGGCCCTGTTCCTCCAGACCCAGTTGTCTCTCTCCCACAACCCTGTTGTCCTCTGGGGTCAGG
CCTCAGCTGGGGCAGCCTCAGTTTTCCCTCAGTAGGCCTGGGGGCAGCACTACCATTCCTTCCTGCCCGCCTGCACCCTCTGTCCAGGCTTCCCCACAGTGATTTAAATAAAGCCTCACCCCACACCC
TAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_039094321 ⟹ XP_038950249

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	16	18,929,581 - 18,936,581 (-)	NCBI
mRatBN7.2	16	18,895,608 - 18,902,648 (-)	NCBI

RefSeq Acc Id:

XM_039094322 ⟹ XP_038950250

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	16	18,929,581 - 18,936,336 (-)	NCBI
mRatBN7.2	16	18,895,608 - 18,902,452 (-)	NCBI

RefSeq Acc Id:

XM_039094323 ⟹ XP_038950251

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	16	18,929,581 - 18,936,545 (-)	NCBI
mRatBN7.2	16	18,895,608 - 18,902,600 (-)	NCBI

RefSeq Acc Id:

XM_039094326 ⟹ XP_038950254

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	16	18,929,581 - 18,936,425 (-)	NCBI
mRatBN7.2	16	18,895,608 - 18,902,452 (-)	NCBI

RefSeq Acc Id:

XM_039094327 ⟹ XP_038950255

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	16	18,929,581 - 18,936,621 (-)	NCBI
mRatBN7.2	16	18,895,608 - 18,902,648 (-)	NCBI

RefSeq Acc Id:

XM_039094328 ⟹ XP_038950256

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	16	18,929,581 - 18,936,580 (-)	NCBI
mRatBN7.2	16	18,895,608 - 18,902,600 (-)	NCBI

RefSeq Acc Id:

XM_063275162 ⟹ XP_063131232

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	16	18,929,581 - 18,936,551 (-)	NCBI

RefSeq Acc Id:

XM_063275163 ⟹ XP_063131233

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	16	18,929,581 - 18,936,621 (-)	NCBI

RefSeq Acc Id:

XM_063275164 ⟹ XP_063131234

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	16	18,929,581 - 18,936,425 (-)	NCBI

RefSeq Acc Id:

XM_063275165 ⟹ XP_063131235

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	16	18,929,581 - 18,936,296 (-)	NCBI

RefSeq Acc Id:

XM_063275166 ⟹ XP_063131236

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	16	18,929,581 - 18,936,553 (-)	NCBI

RefSeq Acc Id:

XM_063275167 ⟹ XP_063131237

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	16	18,929,581 - 18,936,320 (-)	NCBI

RefSeq Acc Id:

XM_063275169 ⟹ XP_063131239

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	16	18,929,581 - 18,936,548 (-)	NCBI

RefSeq Acc Id:

XM_063275170 ⟹ XP_063131240

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	16	18,929,581 - 18,936,339 (-)	NCBI

RefSeq Acc Id:

XM_063275171 ⟹ XP_063131241

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	16	18,929,581 - 18,936,289 (-)	NCBI

RefSeq Acc Id:

XM_063275172 ⟹ XP_063131242

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	16	18,929,581 - 18,936,571 (-)	NCBI

RefSeq Acc Id:

XM_063275173 ⟹ XP_063131243

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	16	18,929,581 - 18,936,621 (-)	NCBI

RefSeq Acc Id:

XM_063275174 ⟹ XP_063131244

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	16	18,929,581 - 18,936,580 (-)	NCBI

RefSeq Acc Id:

XM_063275175 ⟹ XP_063131245

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	16	18,929,581 - 18,936,345 (-)	NCBI

RefSeq Acc Id:

XM_063275176 ⟹ XP_063131246

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	16	18,929,581 - 18,936,550 (-)	NCBI

RefSeq Acc Id:

XM_063275177 ⟹ XP_063131247

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	16	18,929,581 - 18,936,482 (-)	NCBI

RefSeq Acc Id:

XM_063275178 ⟹ XP_063131248

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	16	18,929,581 - 18,936,547 (-)	NCBI

RefSeq Acc Id:

XM_063275179 ⟹ XP_063131249

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	16	18,929,581 - 18,936,320 (-)	NCBI

RefSeq Acc Id:

XM_063275180 ⟹ XP_063131250

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	16	18,929,581 - 18,936,580 (-)	NCBI

RefSeq Acc Id:

XM_063275181 ⟹ XP_063131251

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	16	18,929,581 - 18,936,571 (-)	NCBI

RefSeq Acc Id:

XM_063275182 ⟹ XP_063131252

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	16	18,929,581 - 18,936,299 (-)	NCBI

RefSeq Acc Id:

XM_063275183 ⟹ XP_063131253

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	16	18,929,581 - 18,936,345 (-)	NCBI

RefSeq Acc Id:

XM_063275184 ⟹ XP_063131254

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	16	18,929,581 - 18,936,563 (-)	NCBI

RefSeq Acc Id:

XM_063275185 ⟹ XP_063131255

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	16	18,929,581 - 18,936,296 (-)	NCBI


Protein RefSeqs	NP_001032257	(Get FASTA)	NCBI Sequence Viewer
	XP_038950249	(Get FASTA)	NCBI Sequence Viewer
	XP_038950250	(Get FASTA)	NCBI Sequence Viewer
	XP_038950251	(Get FASTA)	NCBI Sequence Viewer
	XP_038950254	(Get FASTA)	NCBI Sequence Viewer
	XP_038950255	(Get FASTA)	NCBI Sequence Viewer
	XP_038950256	(Get FASTA)	NCBI Sequence Viewer
	XP_063131232	(Get FASTA)	NCBI Sequence Viewer
	XP_063131233	(Get FASTA)	NCBI Sequence Viewer
	XP_063131234	(Get FASTA)	NCBI Sequence Viewer
	XP_063131235	(Get FASTA)	NCBI Sequence Viewer
	XP_063131236	(Get FASTA)	NCBI Sequence Viewer
	XP_063131237	(Get FASTA)	NCBI Sequence Viewer
	XP_063131239	(Get FASTA)	NCBI Sequence Viewer
	XP_063131240	(Get FASTA)	NCBI Sequence Viewer
	XP_063131241	(Get FASTA)	NCBI Sequence Viewer
	XP_063131242	(Get FASTA)	NCBI Sequence Viewer
	XP_063131243	(Get FASTA)	NCBI Sequence Viewer
	XP_063131244	(Get FASTA)	NCBI Sequence Viewer
	XP_063131245	(Get FASTA)	NCBI Sequence Viewer
	XP_063131246	(Get FASTA)	NCBI Sequence Viewer
	XP_063131247	(Get FASTA)	NCBI Sequence Viewer
	XP_063131248	(Get FASTA)	NCBI Sequence Viewer
	XP_063131249	(Get FASTA)	NCBI Sequence Viewer
	XP_063131250	(Get FASTA)	NCBI Sequence Viewer
	XP_063131251	(Get FASTA)	NCBI Sequence Viewer
	XP_063131252	(Get FASTA)	NCBI Sequence Viewer
	XP_063131253	(Get FASTA)	NCBI Sequence Viewer
	XP_063131254	(Get FASTA)	NCBI Sequence Viewer
	XP_063131255	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAI07455	(Get FASTA)	NCBI Sequence Viewer
	EDL90703	(Get FASTA)	NCBI Sequence Viewer
	EDL90704	(Get FASTA)	NCBI Sequence Viewer
	EDL90705	(Get FASTA)	NCBI Sequence Viewer
	EDL90706	(Get FASTA)	NCBI Sequence Viewer
	EDL90707	(Get FASTA)	NCBI Sequence Viewer
	EDL90708	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000074539
	ENSRNOP00000074539.1
	ENSRNOP00000087668
GenBank Protein	Q3B7U9	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_001032257 ⟸ NM_001037180

- UniProtKB:

Q3B7U9 (UniProtKB/Swiss-Prot), A0A8I6A3K9 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MASWAEPSEPAAQLLCGAPLLEGFEVLDGVDDAEEEDDLSGLPPLEDMGQPTVEEAEQPGALAREFLAATEPEPAPAPAPEEWLDILGNGLLRKKTLVPGPTGSSRPLKGQVVTVHLQMSLENGTRVQ
EEPELAFTLGDCDVIQALDLSVPLMHVGETAMVTADSKYCYGPQGSRSPYIPPHAALCLEVTLKTAEDGPDLEMLSGQERVALANRKRECGNAHYQRADFVLAANSYDLAIKAITSNAKVDMTCEEEE
ELLQLKVKCLNNLAASQLKLDHYRAALRSCSQVLEHQPDNIKALFRKGKVLAQQGEYSEAIPILRAALKLEPSNKTIHAELSKLVKKRAAQRSTETALYRKMLGNPSRLPAKCPGKGAWSIPWKWLFG
ATAVALGGVALSVVIAARN

hide sequence

Ensembl Acc Id:

ENSRNOP00000074539 ⟸ ENSRNOT00000077756

RefSeq Acc Id:	XP_038950255 ⟸ XM_039094327
- Peptide Label:	isoform X8
- UniProtKB:	A0A8I6A3K9 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038950249 ⟸ XM_039094321
- Peptide Label:	isoform X5
- UniProtKB:	A0A8I6A3K9 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038950256 ⟸ XM_039094328
- Peptide Label:	isoform X8
- UniProtKB:	A0A8I6A3K9 (UniProtKB/TrEMBL)

Protein Domains

PPIase FKBP-type

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q3B7U9-F1-model_v2	AlphaFold	Q3B7U9	1-403	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

RGD ID:

13700026

Promoter ID:

EPDNEW_R10549

Type:

multiple initiation site

Name:

Fkbp8_1

Description:

FK506 binding protein 8

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	16	20,652,925 - 20,652,985	EPDNEW

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-11785	BioCyc
Ensembl Genes	ENSRNOG00000058359	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000077756	ENTREZGENE
	ENSRNOT00000077756.2	UniProtKB/Swiss-Prot
	ENSRNOT00000095622	ENTREZGENE
Gene3D-CATH	1.25.40.10	UniProtKB/Swiss-Prot
	3.10.50.40	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7378812	IMAGE-MGC_LOAD
InterPro	Immunophilin_FKBP-type	UniProtKB/Swiss-Prot
	PPIase_dom_sf	UniProtKB/Swiss-Prot
	PPIase_FKBP_dom	UniProtKB/Swiss-Prot
	TPR-like_helical_dom_sf	UniProtKB/Swiss-Prot
	TPR_repeat	UniProtKB/Swiss-Prot
KEGG Report	rno:290652	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:125185	IMAGE-MGC_LOAD
NCBI Gene	290652	ENTREZGENE
PANTHER	PEPTIDYL-PROLYL CIS-TRANS ISOMERASE FKBP8	UniProtKB/Swiss-Prot
	PEPTIDYLPROLYL ISOMERASE	UniProtKB/Swiss-Prot
Pfam	FKBP_C	UniProtKB/Swiss-Prot
	TPR_16	UniProtKB/Swiss-Prot
PhenoGen	Fkbp8	PhenoGen
PROSITE	FKBP_PPIASE	UniProtKB/Swiss-Prot
	TPR	UniProtKB/Swiss-Prot
	TPR_REGION	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000058359	RatGTEx
SMART	TPR	UniProtKB/Swiss-Prot
Superfamily-SCOP	FKBP-like	UniProtKB/Swiss-Prot
	SSF48452	UniProtKB/Swiss-Prot
UniProt	A0A8I6A3K9	ENTREZGENE, UniProtKB/TrEMBL
	A6KA29_RAT	UniProtKB/TrEMBL
	A6KA30_RAT	UniProtKB/TrEMBL
	A6KA33_RAT	UniProtKB/TrEMBL
	FKBP8_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2018-11-09	Fkbp8	FKBP prolyl isomerase 8	Fkbp8	FK506 binding protein 8	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2009-10-22	Fkbp8	FK506 binding protein 8	Fkbp8	FK506 binding protein 8, 38kDa	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-09-24	Fkbp8	FK506 binding protein 8, 38kDa	Fkbp8	FK506 binding protein 8	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-12-06	Fkbp8	FK506 binding protein 8	Fkbp8_predicted	FK506 binding protein 8 (predicted)	Symbol and Name updated	1559027	APPROVED
2005-01-12	Fkbp8_predicted	FK506 binding protein 8 (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Imported Disease Annotations - ClinVar

Imported Disease Annotations - MGI

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - MGI