Symbol:
Dpy19l3
Name:
dpy-19 like C-mannosyltransferase 3
RGD ID:
1308334
Description:
Predicted to enable mannosyltransferase activity. Predicted to be active in endoplasmic reticulum membrane. Orthologous to human DPY19L3 (dpy-19 like C-mannosyltransferase 3); INTERACTS WITH (+)-schisandrin B; 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
dpy-19-like 3; dpy-19-like 3 (C. elegans); LOC308519; probable C-mannosyltransferase DPY19L3; protein dpy-19 homolog 3; RGD1308334; similar to hypothetical protein FLJ32949
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 97,487,206 - 97,554,232 (-) NCBI GRCr8 mRatBN7.2 1 88,350,303 - 88,417,339 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 88,350,303 - 88,417,339 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 93,755,161 - 93,821,989 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 102,221,124 - 102,287,965 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 95,513,448 - 95,580,285 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 92,002,927 - 92,069,855 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 92,002,927 - 92,069,160 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 93,134,892 - 93,199,944 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 88,244,980 - 88,311,604 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 88,323,525 - 88,388,025 (-) NCBI Celera 1 82,699,204 - 82,766,607 (-) NCBI Celera Cytogenetic Map 1 q21 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Dpy19l3 Rat (+)-schisandrin B multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of DPY19L3 mRNA] CTD PMID:31150632 Dpy19l3 Rat (1->4)-beta-D-glucan multiple interactions ISO Dpy19l3 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of DPY19L3 mRNA CTD PMID:36331819 Dpy19l3 Rat 17beta-estradiol affects expression EXP 6480464 Estradiol affects the expression of DPY19L3 mRNA CTD PMID:32145629 Dpy19l3 Rat 17beta-estradiol increases expression EXP 6480464 Estradiol results in increased expression of DPY19L3 mRNA CTD PMID:35192832 Dpy19l3 Rat 2,3',4,4',5-Pentachlorobiphenyl increases expression ISO Dpy19l3 (Mus musculus) 6480464 2 more ... CTD PMID:31388691 Dpy19l3 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Dpy19l3 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of DPY19L3 mRNA CTD PMID:19465110 Dpy19l3 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of DPY19L3 mRNA CTD PMID:34747641 Dpy19l3 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Dpy19l3 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of DPY19L3 mRNA CTD PMID:26290441 and PMID:28922406 Dpy19l3 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Dpy19l3 (Mus musculus) 6480464 [TIPARP gene mutant form results in increased susceptibility to Tetrachlorodibenzodioxin] which results in decreased expression of DPY19L3 mRNA CTD PMID:25975270 Dpy19l3 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of DPY19L3 mRNA CTD PMID:22298810 Dpy19l3 Rat 3,4-methylenedioxymethamphetamine increases expression ISO Dpy19l3 (Mus musculus) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in increased expression of DPY19L3 mRNA CTD PMID:20188158 Dpy19l3 Rat 4,4'-sulfonyldiphenol multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of DPY19L3 mRNA CTD PMID:36041667 Dpy19l3 Rat aflatoxin B1 decreases methylation ISO DPY19L3 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of DPY19L3 intron CTD PMID:30157460 Dpy19l3 Rat Aflatoxin B2 alpha decreases methylation ISO DPY19L3 (Homo sapiens) 6480464 aflatoxin B2 results in decreased methylation of DPY19L3 intron CTD PMID:30157460 Dpy19l3 Rat all-trans-retinoic acid increases expression ISO DPY19L3 (Homo sapiens) 6480464 Tretinoin results in increased expression of DPY19L3 mRNA CTD PMID:33167477 Dpy19l3 Rat aristolochic acid A decreases expression ISO DPY19L3 (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of DPY19L3 mRNA CTD PMID:33212167 Dpy19l3 Rat benzo[e]pyrene decreases methylation ISO DPY19L3 (Homo sapiens) 6480464 benzo(e)pyrene results in decreased methylation of DPY19L3 intron CTD PMID:30157460 Dpy19l3 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of DPY19L3 mRNA CTD PMID:25181051 Dpy19l3 Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of DPY19L3 mRNA CTD PMID:36041667 Dpy19l3 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of DPY19L3 mRNA CTD PMID:32145629 Dpy19l3 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of DPY19L3 mRNA CTD PMID:30816183 more ... Dpy19l3 Rat bisphenol F multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of DPY19L3 mRNA CTD PMID:36041667 Dpy19l3 Rat butanal decreases expression ISO DPY19L3 (Homo sapiens) 6480464 butyraldehyde results in decreased expression of DPY19L3 mRNA CTD PMID:26079696 Dpy19l3 Rat carbon nanotube increases expression ISO Dpy19l3 (Mus musculus) 6480464 Nanotubes and Carbon results in increased expression of DPY19L3 mRNA CTD PMID:25554681 Dpy19l3 Rat CGP 52608 multiple interactions ISO DPY19L3 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to DPY19L3 gene] CTD PMID:28238834 Dpy19l3 Rat chlorpyrifos decreases expression ISO Dpy19l3 (Mus musculus) 6480464 Chlorpyrifos results in decreased expression of DPY19L3 mRNA CTD PMID:37019170 Dpy19l3 Rat cyclosporin A decreases expression ISO DPY19L3 (Homo sapiens) 6480464 Cyclosporine results in decreased expression of DPY19L3 mRNA CTD PMID:25562108 Dpy19l3 Rat Dibutyl phosphate affects expression ISO DPY19L3 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of DPY19L3 mRNA CTD PMID:37042841 Dpy19l3 Rat dorsomorphin multiple interactions ISO DPY19L3 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of DPY19L3 mRNA CTD PMID:27188386 Dpy19l3 Rat endosulfan decreases expression EXP 6480464 Endosulfan results in decreased expression of DPY19L3 mRNA CTD PMID:29391264 Dpy19l3 Rat ethanol increases expression ISO Dpy19l3 (Mus musculus) 6480464 Ethanol results in increased expression of DPY19L3 mRNA CTD PMID:30319688 Dpy19l3 Rat ethanol affects splicing ISO Dpy19l3 (Mus musculus) 6480464 Ethanol affects the splicing of DPY19L3 mRNA CTD PMID:30319688 Dpy19l3 Rat flutamide decreases expression EXP 6480464 Flutamide results in decreased expression of DPY19L3 mRNA CTD PMID:24793618 Dpy19l3 Rat formaldehyde decreases expression ISO DPY19L3 (Homo sapiens) 6480464 Formaldehyde results in decreased expression of DPY19L3 mRNA CTD PMID:23649840 Dpy19l3 Rat furan increases methylation EXP 6480464 furan results in increased methylation of DPY19L3 gene CTD PMID:22079235 Dpy19l3 Rat genistein increases expression ISO Dpy19l3 (Mus musculus) 6480464 Genistein results in increased expression of DPY19L3 mRNA CTD PMID:32186404 Dpy19l3 Rat gentamycin decreases expression EXP 6480464 Gentamicins results in decreased expression of DPY19L3 mRNA CTD PMID:33387578 Dpy19l3 Rat glyphosate decreases methylation EXP 6480464 Glyphosate results in decreased methylation of DPY19L3 gene CTD PMID:31011160 Dpy19l3 Rat hydralazine multiple interactions ISO DPY19L3 (Homo sapiens) 6480464 [Hydralazine co-treated with Valproic Acid] results in increased expression of DPY19L3 mRNA CTD PMID:17183730 Dpy19l3 Rat maneb multiple interactions ISO Dpy19l3 (Mus musculus) 6480464 [Maneb co-treated with Paraquat] results in decreased expression of DPY19L3 mRNA CTD PMID:36117858 Dpy19l3 Rat methapyrilene decreases methylation ISO DPY19L3 (Homo sapiens) 6480464 Methapyrilene results in decreased methylation of DPY19L3 intron CTD PMID:30157460 Dpy19l3 Rat N-nitrosodiethylamine increases expression ISO Dpy19l3 (Mus musculus) 6480464 Diethylnitrosamine results in increased expression of DPY19L3 mRNA CTD PMID:24535843 Dpy19l3 Rat nickel sulfate decreases expression ISO DPY19L3 (Homo sapiens) 6480464 nickel sulfate results in decreased expression of DPY19L3 mRNA CTD PMID:22714537 Dpy19l3 Rat paracetamol decreases expression ISO DPY19L3 (Homo sapiens) 6480464 Acetaminophen results in decreased expression of DPY19L3 mRNA CTD PMID:21420995 Dpy19l3 Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of DPY19L3 mRNA CTD PMID:33387578 Dpy19l3 Rat paraquat multiple interactions ISO Dpy19l3 (Mus musculus) 6480464 [Maneb co-treated with Paraquat] results in decreased expression of DPY19L3 mRNA CTD PMID:36117858 Dpy19l3 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Dpy19l3 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of DPY19L3 mRNA CTD PMID:36331819 Dpy19l3 Rat phenobarbital multiple interactions ISO Dpy19l3 (Mus musculus) 6480464 NR1I3 protein affects the reaction [Phenobarbital results in decreased expression of DPY19L3 mRNA] CTD PMID:19482888 Dpy19l3 Rat phenobarbital affects expression ISO Dpy19l3 (Mus musculus) 6480464 Phenobarbital affects the expression of DPY19L3 mRNA CTD PMID:23091169 Dpy19l3 Rat phenobarbital decreases expression ISO Dpy19l3 (Mus musculus) 6480464 Phenobarbital results in decreased expression of DPY19L3 mRNA CTD PMID:19482888 Dpy19l3 Rat pirinixic acid decreases expression ISO Dpy19l3 (Mus musculus) 6480464 pirinixic acid results in decreased expression of DPY19L3 mRNA CTD PMID:20813756 Dpy19l3 Rat pirinixic acid increases expression ISO Dpy19l3 (Mus musculus) 6480464 pirinixic acid results in increased expression of DPY19L3 mRNA CTD PMID:18301758 and PMID:23811191 Dpy19l3 Rat potassium chromate decreases expression ISO DPY19L3 (Homo sapiens) 6480464 potassium chromate(VI) results in decreased expression of DPY19L3 mRNA CTD PMID:22714537 Dpy19l3 Rat resveratrol multiple interactions ISO DPY19L3 (Homo sapiens) 6480464 [Plant Extracts co-treated with Resveratrol] results in increased expression of DPY19L3 mRNA CTD PMID:23557933 Dpy19l3 Rat SB 431542 multiple interactions ISO DPY19L3 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of DPY19L3 mRNA CTD PMID:27188386 Dpy19l3 Rat silicon dioxide increases expression ISO DPY19L3 (Homo sapiens) 6480464 Silicon Dioxide results in increased expression of DPY19L3 mRNA CTD PMID:34973136 Dpy19l3 Rat tamoxifen increases expression ISO Dpy19l3 (Mus musculus) 6480464 Tamoxifen results in increased expression of DPY19L3 mRNA CTD PMID:25123088 Dpy19l3 Rat tetrachloromethane multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of DPY19L3 mRNA] CTD PMID:31150632 Dpy19l3 Rat tetrachloromethane multiple interactions ISO Dpy19l3 (Mus musculus) 6480464 [PANX1 protein co-treated with Carbon Tetrachloride] affects the expression of DPY19L3 mRNA CTD PMID:29987408 Dpy19l3 Rat tetrachloromethane decreases expression EXP 6480464 Carbon Tetrachloride results in decreased expression of DPY19L3 mRNA CTD PMID:31150632 Dpy19l3 Rat thioacetamide decreases expression EXP 6480464 Thioacetamide results in decreased expression of DPY19L3 mRNA CTD PMID:34492290 Dpy19l3 Rat titanium dioxide increases expression ISO Dpy19l3 (Mus musculus) 6480464 titanium dioxide results in increased expression of DPY19L3 mRNA CTD PMID:23557971 Dpy19l3 Rat titanium dioxide increases expression ISO DPY19L3 (Homo sapiens) 6480464 titanium dioxide results in increased expression of DPY19L3 mRNA CTD PMID:34973136 Dpy19l3 Rat titanium dioxide decreases methylation ISO Dpy19l3 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of DPY19L3 gene and titanium dioxide results in decreased methylation of DPY19L3 promoter CTD PMID:35295148 Dpy19l3 Rat urethane decreases expression ISO DPY19L3 (Homo sapiens) 6480464 Urethane results in decreased expression of DPY19L3 mRNA CTD PMID:28818685 Dpy19l3 Rat valproic acid multiple interactions ISO DPY19L3 (Homo sapiens) 6480464 [Hydralazine co-treated with Valproic Acid] results in increased expression of DPY19L3 mRNA more ... CTD PMID:17183730 and PMID:27188386 Dpy19l3 Rat valproic acid decreases expression ISO DPY19L3 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of DPY19L3 mRNA CTD PMID:23179753 more ... Dpy19l3 Rat valproic acid affects expression ISO DPY19L3 (Homo sapiens) 6480464 Valproic Acid affects the expression of DPY19L3 mRNA CTD PMID:25979313 Dpy19l3 Rat vinclozolin decreases expression EXP 6480464 vinclozolin results in decreased expression of DPY19L3 mRNA CTD PMID:23034163
(+)-schisandrin B (EXP) (1->4)-beta-D-glucan (ISO) 17beta-estradiol (EXP) 2,3',4,4',5-Pentachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 3,4-methylenedioxymethamphetamine (ISO) 4,4'-sulfonyldiphenol (EXP) aflatoxin B1 (ISO) Aflatoxin B2 alpha (ISO) all-trans-retinoic acid (ISO) aristolochic acid A (ISO) benzo[e]pyrene (ISO) bisphenol A (EXP) bisphenol F (EXP) butanal (ISO) carbon nanotube (ISO) CGP 52608 (ISO) chlorpyrifos (ISO) cyclosporin A (ISO) Dibutyl phosphate (ISO) dorsomorphin (ISO) endosulfan (EXP) ethanol (ISO) flutamide (EXP) formaldehyde (ISO) furan (EXP) genistein (ISO) gentamycin (EXP) glyphosate (EXP) hydralazine (ISO) maneb (ISO) methapyrilene (ISO) N-nitrosodiethylamine (ISO) nickel sulfate (ISO) paracetamol (EXP,ISO) paraquat (ISO) perfluorooctane-1-sulfonic acid (ISO) phenobarbital (ISO) pirinixic acid (ISO) potassium chromate (ISO) resveratrol (ISO) SB 431542 (ISO) silicon dioxide (ISO) tamoxifen (ISO) tetrachloromethane (EXP,ISO) thioacetamide (EXP) titanium dioxide (ISO) urethane (ISO) valproic acid (ISO) vinclozolin (EXP)
Dpy19l3 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 97,487,206 - 97,554,232 (-) NCBI GRCr8 mRatBN7.2 1 88,350,303 - 88,417,339 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 88,350,303 - 88,417,339 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 93,755,161 - 93,821,989 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 102,221,124 - 102,287,965 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 95,513,448 - 95,580,285 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 92,002,927 - 92,069,855 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 92,002,927 - 92,069,160 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 93,134,892 - 93,199,944 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 88,244,980 - 88,311,604 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 88,323,525 - 88,388,025 (-) NCBI Celera 1 82,699,204 - 82,766,607 (-) NCBI Celera Cytogenetic Map 1 q21 NCBI
DPY19L3 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 19 32,405,770 - 32,485,890 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 19 32,405,543 - 32,485,895 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 19 32,896,676 - 32,976,796 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 19 37,588,871 - 37,667,076 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 19 29,590,304 - 29,670,441 (+) NCBI Celera Cytogenetic Map 19 q13.11 NCBI HuRef 19 29,399,707 - 29,479,881 (+) NCBI HuRef CHM1_1 19 32,897,720 - 32,977,978 (+) NCBI CHM1_1 T2T-CHM13v2.0 19 34,924,425 - 35,004,566 (+) NCBI T2T-CHM13v2.0
Dpy19l3 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 7 35,384,925 - 35,453,879 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 7 35,384,590 - 35,453,879 (-) Ensembl GRCm39 Ensembl GRCm38 7 35,685,500 - 35,754,460 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 7 35,685,165 - 35,754,454 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 7 36,470,519 - 36,539,473 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 7 35,397,594 - 35,463,158 (-) NCBI MGSCv36 mm8 Celera 7 30,809,746 - 30,878,603 (-) NCBI Celera Cytogenetic Map 7 B2 NCBI cM Map 7 21.37 NCBI
Dpy19l3 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955468 5,466,061 - 5,543,644 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955468 5,466,094 - 5,544,956 (-) NCBI ChiLan1.0 ChiLan1.0
DPY19L3 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 20 38,379,061 - 38,459,122 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 19 40,375,784 - 40,455,890 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 19 29,326,368 - 29,406,365 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 19 38,077,718 - 38,154,683 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 19 38,077,718 - 38,154,683 (+) Ensembl panpan1.1 panPan2
DPY19L3 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 1 119,458,008 - 119,526,738 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 1 119,457,952 - 119,527,420 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 1 118,857,349 - 118,927,060 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 1 120,058,859 - 120,128,574 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 1 120,058,806 - 120,128,613 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 1 119,621,693 - 119,691,291 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 1 119,241,487 - 119,310,977 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 1 120,301,666 - 120,371,419 (-) NCBI UU_Cfam_GSD_1.0
Dpy19l3 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024409349 8,364,811 - 8,446,369 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936570 3,199,437 - 3,280,266 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936570 3,199,513 - 3,281,519 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
DPY19L3 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 6 42,334,736 - 42,414,830 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 6 42,335,462 - 42,414,834 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 6 37,865,628 - 37,924,103 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
DPY19L3 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 6 27,455,468 - 27,536,337 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 6 27,456,490 - 27,536,338 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666073 5,027,548 - 5,107,651 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Dpy19l3
.
Predicted Target Of
Count of predictions: 276 Count of miRNA genes: 187 Interacting mature miRNAs: 212 Transcripts: ENSRNOT00000039115 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
2313059 Bss55 Bone structure and strength QTL 55 3.2 0.0001 tibia size trait (VT:0100001) tibia midshaft cross-sectional area (CMO:0001717) 1 43284731 118944897 Rat 631688 Hcas2 Hepatocarcinoma susceptibility QTL 2 3 0.0001 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 1 5925874 115540829 Rat 1578649 Bmd8 Bone mineral density QTL 8 4.9 femur mineral mass (VT:0010011) trabecular volumetric bone mineral density (CMO:0001729) 1 49393172 94393172 Rat 1582234 Gluco18 Glucose level QTL 18 3.4 0.0003 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 78479925 123479925 Rat 1358359 Sradr1 Stress Responsive Adrenal Weight QTL 1 4.74 adrenal gland mass (VT:0010420) both adrenal glands wet weight (CMO:0000164) 1 30882023 123479925 Rat 634314 Niddm44 Non-insulin dependent diabetes mellitus QTL 44 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 49393289 199050459 Rat 1578780 Cm52 Cardiac mass QTL 52 3.3 0.0001 heart mass (VT:0007028) heart wet weight (CMO:0000069) 1 81591954 219808434 Rat 1578654 Bss10 Bone structure and strength QTL 10 4 femur morphology trait (VT:0000559) femoral neck cortical cross-sectional area (CMO:0001702) 1 49393172 159356837 Rat 2300324 Fetw1 Fetal weight QTL 1 12.1 0.005 fetal growth trait (VT:0004201) fetal body weight (CMO:0002080) 1 85424647 100358001 Rat 1300121 Hrtrt1 Heart rate QTL 1 3.7 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 1 65789093 115540829 Rat 7421628 Bp361 Blood pressure QTL 361 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 66023617 118608521 Rat 631495 Bp96 Blood pressure QTL 96 4.52 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 22340647 102268831 Rat 70225 Bp58 Blood pressure QTL 58 3.3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 32356093 162846471 Rat 631512 Scl6 Serum cholesterol level QTL 6 9.6 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 1 72197680 90508767 Rat 2298545 Neuinf8 Neuroinflammation QTL 8 4.6 nervous system integrity trait (VT:0010566) spinal cord beta-2 microglobulin mRNA level (CMO:0002125) 1 57336763 151090257 Rat 2313072 Bss53 Bone structure and strength QTL 53 4.3 0.0001 tibia length (VT:0004357) tibia length (CMO:0000450) 1 43284731 118944897 Rat 10059597 Bp377 Blood pressure QTL 377 3.42 0.025 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 32737458 199368955 Rat 2313078 Bss54 Bone structure and strength QTL 54 3.5 0.0001 tibia area (VT:1000281) tibia midshaft cross-sectional area (CMO:0001717) 1 43284731 118944897 Rat 1549903 Bp267 Blood pressure QTL 267 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 77876254 106047988 Rat 2313083 Bmd74 Bone mineral density QTL 74 4 0.0001 tibia mineral mass (VT:1000283) total volumetric bone mineral density (CMO:0001728) 1 82174743 118944897 Rat 2313402 Anxrr24 Anxiety related response QTL 24 aggression-related behavior trait (VT:0015014) tameness/aggressiveness composite score (CMO:0002136) 1 48963584 144267916 Rat 4889494 Scort2 Serum corticosterone level QTL 2 4.2 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 1 80592172 125592172 Rat 61342 Bp27 Blood pressure QTL 27 3.4 0.0006 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 56732668 98773277 Rat 1300172 Bp172 Blood pressure QTL 172 3.56 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 1 32737273 90665040 Rat 61344 Bp29 Blood pressure QTL 29 7.5 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 78350581 123350581 Rat 1358192 Ept13 Estrogen-induced pituitary tumorigenesis QTL 13 3.4 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 1 77494165 122494165 Rat 2313094 Bss58 Bone structure and strength QTL 58 3.7 0.0001 tibia strength trait (VT:1000284) tibia total energy absorbed before break (CMO:0001736) 1 43284731 118944897 Rat 6903308 Scl36 Serum cholesterol QTL 36 2 0.0125 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 1 53863041 90532583 Rat 2300164 Bmd44 Bone mineral density QTL 44 5.4 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 1 56949932 101949932 Rat 2313099 Bss56 Bone structure and strength QTL 56 2.4 0.0001 tibia size trait (VT:0100001) tibia midshaft endosteal cross-sectional area (CMO:0001716) 1 43284731 118944897 Rat 2313098 Bmd70 Bone mineral density QTL 70 3.6 0.0001 tibia mineral mass (VT:1000283) compact volumetric bone mineral density (CMO:0001730) 1 43284731 118944897 Rat 738022 Anxrr13 Anxiety related response QTL 13 4.6 0.00039 locomotor behavior trait (VT:0001392) number of 20 x 20 cm floor squares crossed into, out of or within a discrete space in an experimental apparatus (CMO:0001514) 1 83547917 128547917 Rat 152025249 Scl82 Serum cholesterol level QTL 82 4.77 blood cholesterol amount (VT:0000180) 1 50343510 99980958 Rat 10054135 Gmadr2 Adrenal mass QTL 2 1.97 0.0129 adrenal gland mass (VT:0010420) both adrenal glands wet weight (CMO:0000164) 1 77857876 122857876 Rat 7411712 Strs4 Sensitivity to stroke QTL 4 8.7 cerebrum integrity trait (VT:0010549) percentage of study population developing cerebrovascular lesions during a period of time (CMO:0000932) 1 78430536 123430536 Rat 2313051 Bss57 Bone structure and strength QTL 57 3.7 0.0001 tibia strength trait (VT:1000284) bone polar moment of inertia (CMO:0001558) 1 43284731 118944897 Rat 61433 Cia2 Collagen induced arthritis QTL 2 5 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 1 78430754 91209302 Rat 724529 Cm16 Cardiac mass QTL 16 2.7 heart mass (VT:0007028) calculated heart weight (CMO:0000073) 1 87580395 150700247 Rat
RH127533
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 88,411,227 - 88,411,445 (+) MAPPER mRatBN7.2 Rnor_6.0 1 92,063,049 - 92,063,266 NCBI Rnor6.0 Rnor_5.0 1 93,193,833 - 93,194,050 UniSTS Rnor5.0 RGSC_v3.4 1 88,305,493 - 88,305,710 UniSTS RGSC3.4 Celera 1 82,760,496 - 82,760,713 UniSTS RH 3.4 Map 1 882.0 UniSTS Cytogenetic Map 1 q21 UniSTS
RH133560
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 88,353,177 - 88,353,392 (+) MAPPER mRatBN7.2 Rnor_6.0 1 92,005,802 - 92,006,016 NCBI Rnor6.0 Rnor_5.0 1 93,137,767 - 93,137,981 UniSTS Rnor5.0 RGSC_v3.4 1 88,243,062 - 88,243,276 UniSTS RGSC3.4 Celera 1 82,702,079 - 82,702,293 UniSTS RH 3.4 Map 1 873.4 UniSTS Cytogenetic Map 1 q21 UniSTS
BF394744
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 88,372,882 - 88,372,986 (+) MAPPER mRatBN7.2 Rnor_6.0 1 92,025,506 - 92,025,609 NCBI Rnor6.0 Rnor_5.0 1 93,157,471 - 93,157,574 UniSTS Rnor5.0 RGSC_v3.4 1 88,262,766 - 88,262,869 UniSTS RGSC3.4 Celera 1 82,721,773 - 82,721,876 UniSTS RH 3.4 Map 1 873.4 UniSTS Cytogenetic Map 1 q21 UniSTS
BE113438
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 88,353,595 - 88,353,746 (+) MAPPER mRatBN7.2 Rnor_6.0 1 92,006,220 - 92,006,370 NCBI Rnor6.0 Rnor_5.0 1 93,138,185 - 93,138,335 UniSTS Rnor5.0 RGSC_v3.4 1 88,243,480 - 88,243,630 UniSTS RGSC3.4 Celera 1 82,702,497 - 82,702,647 UniSTS RH 3.4 Map 1 873.4 UniSTS Cytogenetic Map 1 q21 UniSTS
RH138925
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 88,350,331 - 88,350,528 (+) MAPPER mRatBN7.2 Rnor_6.0 1 92,002,956 - 92,003,152 NCBI Rnor6.0 Rnor_5.0 1 93,134,921 - 93,135,117 UniSTS Rnor5.0 RGSC_v3.4 1 88,240,216 - 88,240,412 UniSTS RGSC3.4 Celera 1 82,699,233 - 82,699,429 UniSTS RH 3.4 Map 1 873.4 UniSTS Cytogenetic Map 1 q21 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000039115 ⟹ ENSRNOP00000033949
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 88,350,303 - 88,417,339 (-) Ensembl Rnor_6.0 Ensembl 1 92,002,927 - 92,069,160 (-) Ensembl
RefSeq Acc Id:
NM_001135835 ⟹ NP_001129307
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 97,487,206 - 97,554,232 (-) NCBI mRatBN7.2 1 88,350,303 - 88,417,339 (-) NCBI Rnor_6.0 1 92,002,927 - 92,069,160 (-) NCBI Rnor_5.0 1 93,134,892 - 93,199,944 (-) NCBI RGSC_v3.4 1 88,244,980 - 88,311,604 (-) RGD Celera 1 82,699,204 - 82,766,607 (-) NCBI
Sequence:
GCGCCCCTTCCCGGGGCTGCAGACGCCCCCCAGGCCCATCCTTGCACCGCACCGCACATTGCCGGCGACAGCTGGGTCCTCCGGGTCTTCAACTCGCTGTAGCCCGTAAAGTGGGCGCGTCCCCAAGG
hide sequence
RefSeq Acc Id:
XM_006228888 ⟹ XP_006228950
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 97,487,208 - 97,554,154 (-) NCBI mRatBN7.2 1 88,350,303 - 88,417,261 (-) NCBI Rnor_6.0 1 92,007,509 - 92,069,855 (-) NCBI Rnor_5.0 1 93,134,892 - 93,199,944 (-) NCBI
Sequence:
ATAGGTAGCTAAGAAAGGCAGGGTGGACAGAGCAATTTTTGTTAGAATTAGATGACAGGCTGCC
hide sequence
RefSeq Acc Id:
XM_006228889 ⟹ XP_006228951
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 97,487,208 - 97,553,983 (-) NCBI mRatBN7.2 1 88,355,531 - 88,417,092 (-) NCBI Rnor_6.0 1 92,008,155 - 92,068,909 (-) NCBI Rnor_5.0 1 93,134,892 - 93,199,944 (-) NCBI
Sequence:
GGGCGGGGCGTGGGAGGGAGCGTCTCTGAGCGGGAGCTTGTGCCTCGAGGTCCCCCCGGCCGGCTGGCATCTGGCCCACTCGTGGACTCGCCAGGGGTGGTTGGAAGAACAATGCCTATGAGTCTTTG
hide sequence
RefSeq Acc Id:
XM_008759164 ⟹ XP_008757386
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 97,487,208 - 97,552,238 (-) NCBI mRatBN7.2 1 88,350,303 - 88,415,343 (-) NCBI Rnor_6.0 1 92,007,509 - 92,067,348 (-) NCBI
Sequence:
GCAGCATTTTGGATTACTTTCACTTCTGAGAATTAACATATGTCACAATCTAATAGGGAAAAAAAAAAATTGGTGCCACTTACGAAGGACACTTGTTCCAGCACCCAGAAACTCTGACTGAACTTTGA
hide sequence
RefSeq Acc Id:
XM_017589127 ⟹ XP_017444616
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 97,487,208 - 97,552,237 (-) NCBI mRatBN7.2 1 88,350,303 - 88,415,343 (-) NCBI Rnor_6.0 1 92,007,509 - 92,067,348 (-) NCBI
Sequence:
GCAGCATTTTGGATTACTTTCACTTCTGAGAATTAACATATGTCACAATCTAATAGGGAAAAAAAAAAATTGGTGCCACTTACGAAGGACACTTGTTCCAGCACCCAGAAACTCTGACTGAACTTTGA
hide sequence
RefSeq Acc Id:
NP_001129307 ⟸ NM_001135835
- UniProtKB:
D4A9G5 (UniProtKB/TrEMBL), A6JAC6 (UniProtKB/TrEMBL)
- Sequence:
MMMYIRQRKETKPVEVSEDFPSPKEDVKLEKKLPSGCASGRFWKILSSAVGGTVALCIGLLTSVYLATLHENDLWFSNIKEVEREISFRTECGLYYSYYKQMLQAPTLLQGFHGLIYDNKTESMRTIN
hide sequence
RefSeq Acc Id:
XP_006228950 ⟸ XM_006228888
- Peptide Label:
isoform X1
- UniProtKB:
D4A9G5 (UniProtKB/TrEMBL), A6JAC6 (UniProtKB/TrEMBL)
- Sequence:
MMMYIRQRKETKPVEVSEDFPSPKEDVKLEKKLPSGCASGRFWKILSSAVGGTVALCIGLLTSVYLATLHENDLWFSNIKEVEREISFRTECGLYYSYYKQMLQAPTLLQGFHGLIYDNKTESMRTIN
hide sequence
RefSeq Acc Id:
XP_006228951 ⟸ XM_006228889
- Peptide Label:
isoform X1
- UniProtKB:
D4A9G5 (UniProtKB/TrEMBL), A6JAC6 (UniProtKB/TrEMBL)
- Sequence:
MMMYIRQRKETKPVEVSEDFPSPKEDVKLEKKLPSGCASGRFWKILSSAVGGTVALCIGLLTSVYLATLHENDLWFSNIKEVEREISFRTECGLYYSYYKQMLQAPTLLQGFHGLIYDNKTESMRTIN
hide sequence
RefSeq Acc Id:
XP_008757386 ⟸ XM_008759164
- Peptide Label:
isoform X3
- UniProtKB:
A6JAC6 (UniProtKB/TrEMBL)
- Sequence:
MRTINLLQRMNIYQEVFLSVLYRVLPIQKYLEPVYFYIYTLFGLQAVYVTALYITSWLLSGTWLSGLLAALWYVTNRIDTTRVEFTIPLRENWALPFFAIQIAAITYFLRPNLQPLSERLTLLAIFVS
hide sequence
RefSeq Acc Id:
XP_017444616 ⟸ XM_017589127
- Peptide Label:
isoform X2
- UniProtKB:
A6JAC6 (UniProtKB/TrEMBL)
- Sequence:
MLQAPTLLQGFHGLIYDNKTESMRTINLLQRMNIYQEVFLSVLYRVLPIQKYLEPVYFYIYTLFGLQAVYVTALYITSWLLSGTWLSGLLAALWYVTNRIDTTRVEFTIPLRENWALPFFAIQIAAIT
hide sequence
Ensembl Acc Id:
ENSRNOP00000033949 ⟸ ENSRNOT00000039115
RGD ID: 13689974 Promoter ID: EPDNEW_R499 Type: initiation region Name: Dpy19l3_1 Description: dpy-19 like C-mannosyltransferase 3 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 1 92,069,123 - 92,069,183 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2017-08-16
Dpy19l3
dpy-19 like C-mannosyltransferase 3
Dpy19l3
dpy-19-like 3 (C. elegans)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-04-30
Dpy19l3
dpy-19-like 3 (C. elegans)
Dpy19l3_predicted
dpy-19-like 3 (C. elegans) (predicted)
'predicted' is removed
2292626 APPROVED
2006-03-30
Dpy19l3_predicted
dpy-19-like 3 (C. elegans) (predicted)
RGD1308334_predicted
similar to hypothetical protein FLJ32949 (predicted)
Symbol and Name updated
1299863 APPROVED
2005-01-20
RGD1308334_predicted
similar to hypothetical protein FLJ32949 (predicted)
LOC308519_predicted
Symbol and Name status set to approved
1331353 APPROVED
2005-01-12
LOC308519_predicted
similar to hypothetical protein FLJ32949 (predicted)
Symbol and Name status set to provisional
70820 PROVISIONAL
