Advanced Search (OLGA)

Gene: Phyhipl (phytanoyl-CoA 2-hydroxylase interacting protein-like) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Phyhipl

Name:

phytanoyl-CoA 2-hydroxylase interacting protein-like

RGD ID:

1307967

Description:

Predicted to be active in cytoplasm. Orthologous to human PHYHIPL (phytanoyl-CoA 2-hydroxylase interacting protein like); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,3,7,8-Tetrachlorodibenzofuran; 3,3',4,4',5-pentachlorobiphenyl.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

LOC309901; phytanoyl-CoA hydroxylase interacting protein-like; phytanoyl-CoA hydroxylase-interacting protein-like

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	20	18,023,831 - 18,064,903 (+)	NCBI		GRCr8
mRatBN7.2	20	18,024,744 - 18,065,822 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	20	18,024,666 - 18,065,478 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	20	18,751,385 - 18,792,447 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	20	18,106,092 - 18,147,153 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	20	18,579,046 - 18,620,121 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	20	19,318,090 - 19,359,063 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	20	19,318,250 - 19,358,719 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	20	21,467,024 - 21,507,993 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	20	18,815,710 - 18,849,381 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	20	18,829,509 - 18,863,178 (+)	NCBI
Celera	20	19,424,021 - 19,457,478 (+)	NCBI		Celera
Cytogenetic Map	20	p11	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Phyhipl	Rat	2,2',4,4'-Tetrabromodiphenyl ether	decreases expression	ISO	PHYHIPL (Homo sapiens)	6480464	2 more ...	CTD	PMID:31675489
Phyhipl	Rat	2,3,7,8-tetrachlorodibenzodioxine	increases expression	EXP		6480464	Tetrachlorodibenzodioxin results in increased expression of PHYHIPL mRNA	CTD	PMID:33387578
Phyhipl	Rat	2,3,7,8-Tetrachlorodibenzofuran	decreases expression	EXP		6480464	2 more ...	CTD	PMID:32109520
Phyhipl	Rat	2,4,6-tribromophenol	decreases expression	ISO	PHYHIPL (Homo sapiens)	6480464	2 more ...	CTD	PMID:31675489
Phyhipl	Rat	2-methylcholine	affects expression	ISO	PHYHIPL (Homo sapiens)	6480464	beta-methylcholine affects the expression of PHYHIPL mRNA	CTD	PMID:21179406
Phyhipl	Rat	3,3',4,4',5-pentachlorobiphenyl	decreases expression	EXP		6480464	3 more ...	CTD	PMID:23196670
Phyhipl	Rat	3,3',5,5'-tetrabromobisphenol A	decreases expression	ISO	PHYHIPL (Homo sapiens)	6480464	tetrabromobisphenol A results in decreased expression of PHYHIPL protein	CTD	PMID:31675489
Phyhipl	Rat	alpha-Zearalanol	multiple interactions	EXP		6480464	[Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of PHYHIPL mRNA	CTD	PMID:35163327
Phyhipl	Rat	arsane	multiple interactions	ISO	PHYHIPL (Homo sapiens)	6480464	[sodium arsenate results in increased abundance of Arsenic] which results in increased expression of PHYHIPL mRNA	CTD	PMID:32525701
Phyhipl	Rat	arsenic atom	multiple interactions	ISO	PHYHIPL (Homo sapiens)	6480464	[sodium arsenate results in increased abundance of Arsenic] which results in increased expression of PHYHIPL mRNA	CTD	PMID:32525701
Phyhipl	Rat	arsenous acid	multiple interactions	ISO	PHYHIPL (Homo sapiens)	6480464	Arsenic Trioxide inhibits the reaction [4-aminophenylarsenoxide binds to PHYHIPL protein]	CTD	PMID:26598702
Phyhipl	Rat	atrazine	affects methylation	EXP		6480464	Atrazine affects the methylation of PHYHIPL gene	CTD	PMID:28931070
Phyhipl	Rat	benzo[a]pyrene	increases methylation	ISO	PHYHIPL (Homo sapiens)	6480464	Benzo(a)pyrene results in increased methylation of PHYHIPL 3' UTR	CTD	PMID:27901495
Phyhipl	Rat	benzo[a]pyrene	decreases methylation	ISO	PHYHIPL (Homo sapiens)	6480464	Benzo(a)pyrene results in decreased methylation of PHYHIPL 5' UTR and Benzo(a)pyrene results in decreased methylation of PHYHIPL promoter	CTD	PMID:27901495
Phyhipl	Rat	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of PHYHIPL mRNA	CTD	PMID:25181051
Phyhipl	Rat	bisphenol A	decreases expression	ISO	Phyhipl (Mus musculus)	6480464	bisphenol A results in decreased expression of PHYHIPL mRNA	CTD	PMID:32156529
Phyhipl	Rat	bisphenol A	affects expression	ISO	PHYHIPL (Homo sapiens)	6480464	bisphenol A affects the expression of PHYHIPL mRNA	CTD	PMID:30903817
Phyhipl	Rat	bisphenol A	increases methylation	EXP		6480464	bisphenol A results in increased methylation of PHYHIPL gene	CTD	PMID:28505145
Phyhipl	Rat	bisphenol F	multiple interactions	ISO	PHYHIPL (Homo sapiens)	6480464	[bisphenol F co-treated with Fulvestrant] results in increased methylation of PHYHIPL gene	CTD	PMID:31601247
Phyhipl	Rat	chlorpyrifos	increases expression	ISO	Phyhipl (Mus musculus)	6480464	Chlorpyrifos results in increased expression of PHYHIPL mRNA	CTD	PMID:37019170
Phyhipl	Rat	cyclosporin A	decreases expression	ISO	PHYHIPL (Homo sapiens)	6480464	Cyclosporine results in decreased expression of PHYHIPL mRNA	CTD	PMID:25562108
Phyhipl	Rat	cytarabine	increases expression	ISO	PHYHIPL (Homo sapiens)	6480464	Cytarabine results in increased expression of PHYHIPL mRNA	CTD	PMID:21198554
Phyhipl	Rat	decabromodiphenyl ether	decreases expression	ISO	PHYHIPL (Homo sapiens)	6480464	decabromobiphenyl ether results in decreased expression of PHYHIPL protein	CTD	PMID:31675489
Phyhipl	Rat	diarsenic trioxide	multiple interactions	ISO	PHYHIPL (Homo sapiens)	6480464	Arsenic Trioxide inhibits the reaction [4-aminophenylarsenoxide binds to PHYHIPL protein]	CTD	PMID:26598702
Phyhipl	Rat	diclofenac	decreases expression	ISO	Phyhipl (Mus musculus)	6480464	Diclofenac results in decreased expression of PHYHIPL mRNA	CTD	PMID:26934552
Phyhipl	Rat	fonofos	increases methylation	ISO	PHYHIPL (Homo sapiens)	6480464	Fonofos results in increased methylation of PHYHIPL promoter	CTD	PMID:22847954
Phyhipl	Rat	FR900359	decreases phosphorylation	ISO	PHYHIPL (Homo sapiens)	6480464	FR900359 results in decreased phosphorylation of PHYHIPL protein	CTD	PMID:37730182
Phyhipl	Rat	fulvestrant	multiple interactions	ISO	PHYHIPL (Homo sapiens)	6480464	[bisphenol F co-treated with Fulvestrant] results in increased methylation of PHYHIPL gene	CTD	PMID:31601247
Phyhipl	Rat	genistein	decreases expression	ISO	Phyhipl (Mus musculus)	6480464	Genistein results in decreased expression of PHYHIPL mRNA	CTD	PMID:32186404
Phyhipl	Rat	gentamycin	increases expression	EXP		6480464	Gentamicins results in increased expression of PHYHIPL mRNA	CTD	PMID:33387578
Phyhipl	Rat	ozone	decreases expression	EXP		6480464	Ozone results in decreased expression of PHYHIPL mRNA	CTD	PMID:28623178
Phyhipl	Rat	paracetamol	increases expression	EXP		6480464	Acetaminophen results in increased expression of PHYHIPL mRNA	CTD	PMID:33387578
Phyhipl	Rat	paraquat	decreases expression	EXP		6480464	Paraquat results in decreased expression of PHYHIPL mRNA	CTD	PMID:32680482
Phyhipl	Rat	parathion	increases methylation	ISO	PHYHIPL (Homo sapiens)	6480464	Parathion results in increased methylation of PHYHIPL promoter	CTD	PMID:22847954
Phyhipl	Rat	perfluorooctanoic acid	multiple interactions	EXP		6480464	[Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of PHYHIPL mRNA	CTD	PMID:35163327
Phyhipl	Rat	quercetin	decreases expression	ISO	PHYHIPL (Homo sapiens)	6480464	Quercetin results in decreased expression of PHYHIPL mRNA	CTD	PMID:21632981
Phyhipl	Rat	sodium arsenate	multiple interactions	ISO	PHYHIPL (Homo sapiens)	6480464	[sodium arsenate results in increased abundance of Arsenic] which results in increased expression of PHYHIPL mRNA	CTD	PMID:32525701
Phyhipl	Rat	sunitinib	decreases expression	ISO	PHYHIPL (Homo sapiens)	6480464	Sunitinib results in decreased expression of PHYHIPL mRNA	CTD	PMID:31533062
Phyhipl	Rat	terbufos	increases methylation	ISO	PHYHIPL (Homo sapiens)	6480464	terbufos results in increased methylation of PHYHIPL promoter	CTD	PMID:22847954
Phyhipl	Rat	thapsigargin	increases expression	EXP		6480464	Thapsigargin results in increased expression of PHYHIPL protein	CTD	PMID:35544339
Phyhipl	Rat	thioacetamide	increases expression	EXP		6480464	Thioacetamide results in increased expression of PHYHIPL mRNA	CTD	PMID:23411599
Phyhipl	Rat	thioacetamide	increases methylation	EXP		6480464	Thioacetamide results in increased methylation of PHYHIPL promoter	CTD	PMID:27914986
Phyhipl	Rat	titanium dioxide	increases methylation	ISO	Phyhipl (Mus musculus)	6480464	titanium dioxide results in increased methylation of PHYHIPL promoter	CTD	PMID:35295148
Phyhipl	Rat	titanium dioxide	decreases methylation	ISO	Phyhipl (Mus musculus)	6480464	titanium dioxide results in decreased methylation of PHYHIPL promoter	CTD	PMID:35295148
Phyhipl	Rat	triclosan	decreases expression	ISO	PHYHIPL (Homo sapiens)	6480464	Triclosan results in decreased expression of PHYHIPL mRNA	CTD	PMID:30510588
Phyhipl	Rat	triptonide	increases expression	ISO	Phyhipl (Mus musculus)	6480464	triptonide results in increased expression of PHYHIPL mRNA	CTD	PMID:33045310
Phyhipl	Rat	tunicamycin	decreases expression	ISO	PHYHIPL (Homo sapiens)	6480464	Tunicamycin results in decreased expression of PHYHIPL mRNA	CTD	PMID:22378314
Phyhipl	Rat	urethane	decreases expression	ISO	PHYHIPL (Homo sapiens)	6480464	Urethane results in decreased expression of PHYHIPL mRNA	CTD	PMID:28818685
Phyhipl	Rat	valproic acid	increases expression	ISO	PHYHIPL (Homo sapiens)	6480464	Valproic Acid results in increased expression of PHYHIPL mRNA	CTD	PMID:29154799
Phyhipl	Rat	valproic acid	increases expression	ISO	Phyhipl (Mus musculus)	6480464	Valproic Acid results in increased expression of PHYHIPL mRNA	CTD	PMID:21427059

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Phyhipl	Rat	cytoplasm	located_in	IEA	UniProtKB:Q96FC7 and ensembl:ENSP00000362987	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Phyhipl	Rat	cytoplasm	is_active_in	IBA	PANTHER:PTN001437819 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Phyhipl	Rat	cytoplasm	located_in	ISO	PHYHIPL (Homo sapiens)	1624291		RGD	GO_REF:0000054

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Phyhipl	Rat	protein binding	enables	ISO	PHYHIPL (Homo sapiens)	1624291	UniProtKB:A8MW99 more ...	RGD	PMID:32296183
Phyhipl	Rat	protein binding	enables	ISO	PHYHIPL (Homo sapiens) and UniProtKB:Q96FC7-2	1624291	UniProtKB:O76083 and PMID:25416956	RGD	PMID:25416956

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

PMID:12477932	PMID:25931508	PMID:30053369

Phyhipl
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	20	18,023,831 - 18,064,903 (+)	NCBI		GRCr8
mRatBN7.2	20	18,024,744 - 18,065,822 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	20	18,024,666 - 18,065,478 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	20	18,751,385 - 18,792,447 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	20	18,106,092 - 18,147,153 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	20	18,579,046 - 18,620,121 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	20	19,318,090 - 19,359,063 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	20	19,318,250 - 19,358,719 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	20	21,467,024 - 21,507,993 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	20	18,815,710 - 18,849,381 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	20	18,829,509 - 18,863,178 (+)	NCBI
Celera	20	19,424,021 - 19,457,478 (+)	NCBI		Celera
Cytogenetic Map	20	p11	NCBI

PHYHIPL
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	10	59,173,597 - 59,247,770 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	10	59,176,643 - 59,247,774 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	10	60,936,403 - 61,007,530 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	10	60,606,353 - 60,677,062 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	10	60,606,352 - 60,677,062	NCBI
Celera	10	54,202,113 - 54,273,651 (+)	NCBI		Celera
Cytogenetic Map	10	q21.1	NCBI
HuRef	10	54,927,612 - 54,998,570 (+)	NCBI		HuRef
CHM1_1	10	61,218,097 - 61,289,255 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	10	60,029,843 - 60,102,075 (+)	NCBI		T2T-CHM13v2.0

Phyhipl
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	10	70,393,516 - 70,435,121 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	10	70,393,512 - 70,491,795 (-)	Ensembl		GRCm39 Ensembl
GRCm38	10	70,557,686 - 70,599,291 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	10	70,557,682 - 70,655,965 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	10	70,020,434 - 70,062,039 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	10	69,952,986 - 69,994,577 (-)	NCBI		MGSCv36	mm8
Celera	10	71,648,067 - 71,689,644 (-)	NCBI		Celera
Cytogenetic Map	10	B5.3	NCBI
cM Map	10	36.69	NCBI

Phyhipl
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955425	12,841,027 - 12,885,260 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955425	12,841,027 - 12,885,260 (+)	NCBI	ChiLan1.0	ChiLan1.0

PHYHIPL
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	8	71,387,887 - 71,459,032 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	10	71,393,210 - 71,464,354 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	10	55,710,893 - 55,782,817 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	10	57,928,697 - 58,000,665 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	10	57,928,697 - 58,000,665 (+)	Ensembl	panpan1.1		panPan2

PHYHIPL
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	4	11,387,346 - 11,461,014 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	4	11,387,295 - 11,460,638 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	4	11,578,920 - 11,652,945 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	4	11,649,749 - 11,723,857 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	4	11,649,786 - 11,774,794 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	4	11,628,236 - 11,702,265 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	4	11,747,118 - 11,821,206 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	4	12,056,569 - 12,130,666 (+)	NCBI		UU_Cfam_GSD_1.0

Phyhipl
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024407213	69,759,819 - 69,816,970 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936614	3,843,845 - 3,902,997 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936614	3,845,440 - 3,902,998 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

PHYHIPL
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	14	62,525,903 - 62,627,586 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	14	62,525,915 - 62,630,383 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	14	67,475,936 - 67,496,632 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

PHYHIPL
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	9	72,038,796 - 72,103,386 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	9	72,039,531 - 72,101,719 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666048	32,923,857 - 32,990,490 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Phyhipl
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624791	4,297,376 - 4,344,799 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624791	4,297,376 - 4,344,284 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Phyhipl
193 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	187
Count of miRNA genes:	107
Interacting mature miRNAs:	119
Transcripts:	ENSRNOT00000000299, ENSRNOT00000058151
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
4889610	Pancm3	Pancreatic morphology QTL 3	3.75	0.001	pancreas mass (VT:0010144)	pancreas wet weight (CMO:0000626)	20	17617832	47606836	Rat
1641915	Colcr9	Colorectal carcinoma resistance QTL 9	2.97	0.0024	intestine integrity trait (VT:0010554)	benign colorectal tumor number (CMO:0001795)	20	1530655	46530655	Rat
2317057	Aia27	Adjuvant induced arthritis QTL 27	2.83		joint integrity trait (VT:0010548)	right rear ankle joint diameter (CMO:0002150)	20	2892597	26381954	Rat
7387283	Uae44	Urinary albumin excretion QTL 44		0.1712	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	20	1	26123605	Rat
4889870	Pur30	Proteinuria QTL 30	19	0.005	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	20	8042410	29322208	Rat
7411668	Foco32	Food consumption QTL 32	8	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	20	1	36600972	Rat
2305926	Iddm37	Insulin dependent diabetes mellitus QTL 37	6		blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	20	1527842	46527842	Rat
1354642	Despr15	Despair related QTL 15		0.0027	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	20	1	24159021	Rat
1600382	Edcs3	Endometrial carcinoma susceptibility QTL3	3.5	0.003	uterus morphology trait (VT:0001120)	percentage of study population developing endometrioid carcinoma during a period of time (CMO:0001759)	20	1	25159026	Rat
8694189	Bw153	Body weight QTL 153	3.13	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	20	1	29191651	Rat
9590109	Sffal8	Serum free fatty acids level QTL 8	5.32	0.01	blood free fatty acid amount (VT:0001553)	plasma free fatty acids level (CMO:0000546)	20	1	29191651	Rat
9590275	Scort15	Serum corticosterone level QTL 15	3.48	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	20	1	29191651	Rat
9589155	Insul32	Insulin level QTL 32	6.38	0.001	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	20	1	29191651	Rat
7411650	Foco23	Food consumption QTL 23	20.7	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	20	1	29191651	Rat
7411652	Foco24	Food consumption QTL 24		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	20	11757515	54435887	Rat
2317851	Alcrsp22	Alcohol response QTL 22	3.2	0.05	response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	20	1	27339237	Rat
1598816	Memor12	Memory QTL 12	2.4		exploratory behavior trait (VT:0010471)	average horizontal distance between subject and target during voluntary locomotion in an experimental apparatus (CMO:0002674)	20	2606836	47606836	Rat
2317880	Alcrsp25	Alcohol response QTL 25	2.3		response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	20	17697550	54435887	Rat
1641893	Alcrsp7	Alcohol response QTL 7			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	20	1	27339237	Rat
6893685	Bw111	Body weight QTL 111	2.7	0.004	body mass (VT:0001259)	body weight (CMO:0000012)	20	1	32578807	Rat
9590252	Scort12	Serum corticosterone level QTL 12	20.46	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	20	1	36600972	Rat
9590092	Insglur9	Insulin/glucose ratio QTL 9	18.38	0.001	blood insulin amount (VT:0001560)	calculated plasma insulin level (CMO:0002170)	20	11757515	54435887	Rat

RH127414

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	20	18,065,709 - 18,065,898 (+)	MAPPER	mRatBN7.2
Rnor_6.0	20	19,358,951 - 19,359,139	NCBI	Rnor6.0
Rnor_5.0	20	21,507,885 - 21,508,073	UniSTS	Rnor5.0
RGSC_v3.4	20	18,849,610 - 18,849,798	UniSTS	RGSC3.4
Celera	20	19,457,707 - 19,457,895	UniSTS
Cytogenetic Map	20	p11	UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	10	47	113	86	85	54	25	54	6	210	94	93	45	60	31


RefSeq Transcripts	NM_001012076	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_001398984	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063279186	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC078977	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473988	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ214387	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000020	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000000299 ⟹ ENSRNOP00000000299

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	20	18,052,262 - 18,065,478 (+)	Ensembl
Rnor_6.0 Ensembl	20	19,318,250 - 19,358,368 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000058151 ⟹ ENSRNOP00000054955

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	20	18,031,805 - 18,065,478 (+)	Ensembl
Rnor_6.0 Ensembl	20	19,325,121 - 19,358,719 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000105062 ⟹ ENSRNOP00000089889

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	20	18,024,666 - 18,065,478 (+)	Ensembl

RefSeq Acc Id:

NM_001012076 ⟹ NP_001012076

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	20	18,030,882 - 18,064,903 (+)	NCBI
mRatBN7.2	20	18,031,795 - 18,065,822 (+)	NCBI
Rnor_6.0	20	19,325,121 - 19,358,722 (+)	NCBI
Rnor_5.0	20	21,467,024 - 21,507,993 (+)	NCBI
RGSC_v3.4	20	18,815,710 - 18,849,381 (+)	RGD
Celera	20	19,424,021 - 19,457,478 (+)	RGD

Sequence:

show sequence

GGAAGAAAGAGGTTTGGATTTTCCATCAGCTTTAGAGTGGTCTTTAAGGAGCTTCGTAGTATCTCCCTCCCAGACGAAGAGTGAACCCAGTCTGGGGAAGGCCGAAGTCGAATCCAAAAGATGAACTA
AGTCTGCAATCCAGGTAACAAATCACAAGACAGTGGCATAGCAGAGATGGAAGAGCTCCCCGTCCCACACAACATCAAAATAAATAACATCACATGTGACTCCTTCAAGATCTCATGGGACATGGACT
CCAAGTCGAAGGACCGCATCACACACTACTTCATTGACCTCAACAAGAAAGAGAACAAGAACTCTAACAAGTTTAAACACAAGGATGTTCCAACAAAACTGGTGGCCAAAGCTGTTCCCTTGCCAATG
ACTGTTCGTGGACACTGGTTTTTGAGCCCAAGGACTGAGTATACAGTAGCGGTGCAGACGGCCTCAAAACAAGTCGATGGTGATTACGTCGTGTCGGAATGGAGTGAGATTATAGAATTCTGTACAGC
AGATTACTCAAAAGTTCATCTGACCCAGCTGCTGGAGAAGGCTGACGTGATTGCAGGACGCATGCTTAAGTTCTCTGTATTCTATCGGAACCAGCACAAAGAGTATTTTGACTATGTTAGAGATCACT
ATGGGAACGCCATGCAGCCTTCCATCAAGGACAACAGTGGTAGCCACGGCTCTCCCATCAGTGGGAAATTGGAAGGCATCTTCTTCAGCTGCAGCACCGAGTTCAATACAGGGAAGCCACCCCAGGAT
TCACCGTACGGAAGATACAGGTTTGAGATCGCAGCAGAAAAACTGTTCAACCCCAACACTAACTTATACTTTGGGGACTTCTACTGTATGTACACCGCTTATCATTATGTGATTCTTGTCATTGCCCC
TGTGGGATCGCCAGGAGATGAATTTTGTAAGCAGCGCCTTCCTCAACTAAATTCCAAGGATAATAAGTTTTTGACCTGTACAGAAGAAGATGGGAGGCTGCTGTACCACCACGCCCAGGATGTCATTT
TAGAAGTCATTTACACTGACCCTGTGGCTCTTTCCCTGGGCACCGTGGCAGAAATCACTGGTCATCAGCTCATGAGTTTGTCTACTGCAAACGCAAAGAAAGACCCCAGCTGCAAAACCTGTAACATC
AGTGTCGGACGCTAACGCCACTTTCGTACCCCCCACCCTGTCTTCCCATAGGCGCATTTCCCTCTGTTGTACATCCGCCATCAGATGTCCCCACTGAAGCATGCATATGCCGCTGTCACCAAAAGCAG
ACTGTCACTCAGAGCCTTTCCATGTCTCCTCTTGCCCACCCTTGTCCACTTCCAACCATGTCCCCAAGTTGTCCTGACACTTTGTTTGCCTAGATGCTGCAATGCTTTTGTTTCCTTTATGCCAAACA
TAACAAGACAGTTATAGAGGCTGCTTTAGCGAAGTACAAAATAATGGCTTATAAATGGTGTTTAAATGTGCATCCATTTTAATCTACTGAATAAATATTGGGATGACTCCAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

NM_001398984 ⟹ NP_001385913

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	20	18,023,831 - 18,064,903 (+)	NCBI
mRatBN7.2	20	18,024,744 - 18,065,822 (+)	NCBI

RefSeq Acc Id:

XM_063279186 ⟹ XP_063135256

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	20	18,033,754 - 18,064,562 (+)	NCBI


Protein RefSeqs	NP_001012076	(Get FASTA)	NCBI Sequence Viewer
	NP_001385913	(Get FASTA)	NCBI Sequence Viewer
	XP_063135256	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH78977	(Get FASTA)	NCBI Sequence Viewer
	EDL97270	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000054955
	ENSRNOP00000054955.2
	ENSRNOP00000089889
	ENSRNOP00000089889.1
GenBank Protein	Q6AYN4	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_001012076 ⟸ NM_001012076
- Peptide Label:	isoform 1
- UniProtKB:	A6JKQ2 (UniProtKB/TrEMBL)
- Sequence:	show sequence MEELPVPHNIKINNITCDSFKISWDMDSKSKDRITHYFIDLNKKENKNSNKFKHKDVPTKLVAKAVPLPMTVRGHWFLSPRTEYTVAVQTASKQVDGDYVVSEWSEIIEFCTADYSKVHLTQLLEKAD VIAGRMLKFSVFYRNQHKEYFDYVRDHYGNAMQPSIKDNSGSHGSPISGKLEGIFFSCSTEFNTGKPPQDSPYGRYRFEIAAEKLFNPNTNLYFGDFYCMYTAYHYVILVIAPVGSPGDEFCKQRLPQ LNSKDNKFLTCTEEDGRLLYHHAQDVILEVIYTDPVALSLGTVAEITGHQLMSLSTANAKKDPSCKTCNISVGR hide sequence

Ensembl Acc Id:

ENSRNOP00000000299 ⟸ ENSRNOT00000000299

Ensembl Acc Id:

ENSRNOP00000054955 ⟸ ENSRNOT00000058151

Ensembl Acc Id:

ENSRNOP00000089889 ⟸ ENSRNOT00000105062

RefSeq Acc Id:	NP_001385913 ⟸ NM_001398984
- Peptide Label:	isoform 2
- UniProtKB:	Q6AYN4 (UniProtKB/Swiss-Prot), A6JKQ4 (UniProtKB/TrEMBL), A6JKQ2 (UniProtKB/TrEMBL)

Protein Domains

Fibronectin type-III

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q6AYN4-F1-model_v2	AlphaFold	Q6AYN4	1-375	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

RGD ID:

13701555

Promoter ID:

EPDNEW_R12079

Type:

initiation region

Name:

Phyhipl_1

Description:

phytanoyl-CoA 2-hydroxylase interacting protein-like

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	20	19,325,145 - 19,325,205	EPDNEW

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-4022	BioCyc
Ensembl Genes	ENSRNOG00000000274	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000058151	ENTREZGENE
	ENSRNOT00000058151.3	UniProtKB/Swiss-Prot
	ENSRNOT00000105062	ENTREZGENE
	ENSRNOT00000105062.1	UniProtKB/Swiss-Prot
Gene3D-CATH	2.60.40.10	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7111966	IMAGE-MGC_LOAD
InterPro	FN3_dom	UniProtKB/Swiss-Prot
	FN3_sf	UniProtKB/Swiss-Prot
	Ig-like_fold	UniProtKB/Swiss-Prot
	PHYHIP/PHYHIPL	UniProtKB/Swiss-Prot
	PHYIP/PHIPL_C	UniProtKB/Swiss-Prot
KEGG Report	rno:309901	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:93860	IMAGE-MGC_LOAD
NCBI Gene	309901	ENTREZGENE
PANTHER	PHYTANOYL-COA HYDROXYLASE-INTERACTING PROTEIN-LIKE	UniProtKB/Swiss-Prot
	PTHR15698	UniProtKB/Swiss-Prot
Pfam	fn3	UniProtKB/Swiss-Prot
	PHYHIP_C	UniProtKB/Swiss-Prot
PhenoGen	Phyhipl	PhenoGen
PROSITE	FN3	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000000274	RatGTEx
Superfamily-SCOP	SSF49265	UniProtKB/Swiss-Prot
UniProt	A0A8L2PY67_RAT	UniProtKB/TrEMBL
	A6JKQ2	ENTREZGENE, UniProtKB/TrEMBL
	A6JKQ4	ENTREZGENE, UniProtKB/TrEMBL
	PHIPL_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-09-09	Phyhipl	phytanoyl-CoA 2-hydroxylase interacting protein-like	Phyhipl	phytanoyl-CoA hydroxylase interacting protein-like	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-12-06	Phyhipl	phytanoyl-CoA hydroxylase interacting protein-like	Phyhipl_predicted	phytanoyl-CoA hydroxylase interacting protein-like (predicted)	Symbol and Name updated	1559027	APPROVED
2005-01-12	Phyhipl_predicted	phytanoyl-CoA hydroxylase interacting protein-like (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Send us a Message