Symbol:
Efna4
Name:
ephrin A4
RGD ID:
1307808
Description:
Predicted to enable ephrin receptor binding activity. Predicted to be involved in axon guidance and ephrin receptor signaling pathway. Predicted to be located in side of membrane. Predicted to be active in plasma membrane. Orthologous to human EFNA4 (ephrin A4); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 6-propyl-2-thiouracil; alpha-Zearalanol.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
ephrin-A4; LOC310643
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
EFNA4 (ephrin A4) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther
Mus musculus (house mouse):
Efna4 (ephrin A4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Efna4 (ephrin A4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
EFNA4 (ephrin A4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
EFNA4 (ephrin A4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Efna4 (ephrin A4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
EFNA4 (ephrin A4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
EFNA4 (ephrin A4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Efna4 (ephrin A4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
GTPBP3 (GTP binding protein 3, mitochondrial) HGNC
OMA
Alliance orthologs 3
Homo sapiens (human):
EFNA4 (ephrin A4)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Efna4 (ephrin A4)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
si:dkey-246i14.3
Alliance
DIOPT (InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
efn-4
Alliance
DIOPT (Ensembl Compara|InParanoid|PANTHER|SonicParanoid)
Drosophila melanogaster (fruit fly):
Ephrin
Alliance
DIOPT (Ensembl Compara|PANTHER|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
efna4
Alliance
DIOPT (PANTHER|PhylomeDB)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 2 177,046,463 - 177,050,713 (-) NCBI GRCr8 mRatBN7.2 2 174,748,729 - 174,752,979 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 2 174,748,724 - 174,752,979 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 2 181,893,743 - 181,897,991 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 2 179,916,118 - 179,920,367 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 2 174,516,662 - 174,520,904 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 2 188,655,920 - 188,660,179 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 2 188,655,912 - 188,660,179 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 2 208,065,969 - 208,070,220 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 2 181,521,270 - 181,525,521 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 2 181,471,898 - 181,475,566 (-) NCBI Celera 2 168,690,302 - 168,694,545 (-) NCBI Celera Cytogenetic Map 2 q34 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Efna4 Rat (-)-epigallocatechin 3-gallate multiple interactions ISO EFNA4 (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of EFNA4 mRNA CTD PMID:22079256 Efna4 Rat 1,2-dimethylhydrazine increases expression ISO Efna4 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in increased expression of EFNA4 mRNA CTD PMID:22206623 Efna4 Rat 17beta-estradiol affects expression ISO EFNA4 (Homo sapiens) 6480464 Estradiol affects the expression of EFNA4 mRNA CTD PMID:22574217 Efna4 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Efna4 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of EFNA4 mRNA CTD PMID:21570461 Efna4 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of EFNA4 mRNA CTD PMID:33387578 Efna4 Rat 3,3',5,5'-tetrabromobisphenol A decreases expression ISO Efna4 (Mus musculus) 6480464 tetrabromobisphenol A results in decreased expression of EFNA4 mRNA CTD PMID:25172293 Efna4 Rat 4-hydroxynon-2-enal decreases expression ISO EFNA4 (Homo sapiens) 6480464 4-hydroxy-2-nonenal results in decreased expression of EFNA4 mRNA CTD PMID:12419474 Efna4 Rat 4-hydroxyphenyl retinamide increases expression ISO Efna4 (Mus musculus) 6480464 Fenretinide results in increased expression of EFNA4 mRNA CTD PMID:28973697 Efna4 Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of EFNA4 mRNA CTD PMID:22504374 Efna4 Rat acrylamide decreases expression ISO EFNA4 (Homo sapiens) 6480464 Acrylamide results in decreased expression of EFNA4 mRNA CTD PMID:32763439 Efna4 Rat all-trans-retinoic acid decreases expression ISO EFNA4 (Homo sapiens) 6480464 Tretinoin results in decreased expression of EFNA4 mRNA CTD PMID:23724009 Efna4 Rat alpha-Zearalanol multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of EFNA4 mRNA CTD PMID:35163327 Efna4 Rat arsenite(3-) increases expression ISO Efna4 (Mus musculus) 6480464 arsenite results in increased expression of EFNA4 mRNA CTD PMID:18191166 Efna4 Rat atrazine increases expression ISO EFNA4 (Homo sapiens) 6480464 Atrazine results in increased expression of EFNA4 mRNA CTD PMID:22378314 Efna4 Rat benzo[a]pyrene increases methylation ISO EFNA4 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of EFNA4 promoter CTD PMID:27901495 Efna4 Rat benzo[a]pyrene diol epoxide I decreases expression ISO EFNA4 (Homo sapiens) 6480464 7 more ... CTD PMID:20382639 Efna4 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of EFNA4 mRNA CTD PMID:34947998 Efna4 Rat Butylparaben increases expression ISO EFNA4 (Homo sapiens) 6480464 butylparaben results in increased expression of EFNA4 mRNA CTD PMID:17121429 Efna4 Rat chlordecone decreases expression ISO Efna4 (Mus musculus) 6480464 Chlordecone results in decreased expression of EFNA4 mRNA CTD PMID:33711761 Efna4 Rat chlorpyrifos increases expression ISO Efna4 (Mus musculus) 6480464 Chlorpyrifos results in increased expression of EFNA4 mRNA CTD PMID:37019170 Efna4 Rat cisplatin increases expression ISO EFNA4 (Homo sapiens) 6480464 Cisplatin results in increased expression of EFNA4 mRNA CTD PMID:27392435 Efna4 Rat cisplatin multiple interactions ISO EFNA4 (Homo sapiens) 6480464 [Cisplatin co-treated with jinfukang] results in increased expression of EFNA4 mRNA CTD PMID:27392435 Efna4 Rat cobalt dichloride decreases expression EXP 6480464 cobaltous chloride results in decreased expression of EFNA4 mRNA CTD PMID:24386269 Efna4 Rat cocaine affects expression EXP 6480464 Cocaine affects the expression of EFNA4 mRNA CTD PMID:15691709 Efna4 Rat copper atom multiple interactions ISO EFNA4 (Homo sapiens) 6480464 [Chelating Agents binds to Copper] which results in increased expression of EFNA4 mRNA CTD PMID:30911355 Efna4 Rat copper(0) multiple interactions ISO EFNA4 (Homo sapiens) 6480464 [Chelating Agents binds to Copper] which results in increased expression of EFNA4 mRNA CTD PMID:30911355 Efna4 Rat copper(II) sulfate decreases expression ISO EFNA4 (Homo sapiens) 6480464 Copper Sulfate results in decreased expression of EFNA4 mRNA CTD PMID:19549813 Efna4 Rat cyclosporin A decreases expression ISO EFNA4 (Homo sapiens) 6480464 Cyclosporine results in decreased expression of EFNA4 mRNA CTD PMID:25562108 Efna4 Rat Dibutyl phosphate affects expression ISO EFNA4 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of EFNA4 mRNA CTD PMID:37042841 Efna4 Rat doxorubicin decreases expression ISO EFNA4 (Homo sapiens) 6480464 Doxorubicin results in decreased expression of EFNA4 mRNA CTD PMID:29803840 Efna4 Rat endosulfan decreases expression EXP 6480464 Endosulfan results in decreased expression of EFNA4 mRNA CTD PMID:29391264 Efna4 Rat formaldehyde decreases expression ISO EFNA4 (Homo sapiens) 6480464 Formaldehyde results in decreased expression of EFNA4 mRNA CTD PMID:20655997 Efna4 Rat gentamycin decreases expression EXP 6480464 Gentamicins results in decreased expression of EFNA4 mRNA CTD PMID:33387578 Efna4 Rat hydrogen chloride increases expression ISO EFNA4 (Homo sapiens) 6480464 Hydrochloric Acid results in increased expression of EFNA4 mRNA CTD PMID:15046208 Efna4 Rat hydrogen peroxide affects expression ISO EFNA4 (Homo sapiens) 6480464 Hydrogen Peroxide affects the expression of EFNA4 mRNA CTD PMID:20044591 Efna4 Rat lead(0) affects expression ISO EFNA4 (Homo sapiens) 6480464 Lead affects the expression of EFNA4 mRNA CTD PMID:22313790 Efna4 Rat leflunomide decreases expression ISO EFNA4 (Homo sapiens) 6480464 leflunomide results in decreased expression of EFNA4 mRNA CTD PMID:28988120 Efna4 Rat methimazole increases expression EXP 6480464 Methimazole results in increased expression of EFNA4 mRNA CTD PMID:22504374 Efna4 Rat methylparaben increases expression ISO EFNA4 (Homo sapiens) 6480464 methylparaben results in increased expression of EFNA4 mRNA CTD PMID:17121429 Efna4 Rat ozone multiple interactions ISO Efna4 (Mus musculus) 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in increased expression of EFNA4 mRNA and [Air Pollutants results in increased abundance of Ozone] which results in increased expression of EFNA4 mRNA CTD PMID:34911549 Efna4 Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of EFNA4 mRNA CTD PMID:33387578 Efna4 Rat perfluorohexanesulfonic acid decreases expression ISO EFNA4 (Homo sapiens) 6480464 perfluorohexanesulfonic acid results in decreased expression of EFNA4 mRNA CTD PMID:25812627 Efna4 Rat perfluorononanoic acid decreases expression ISO EFNA4 (Homo sapiens) 6480464 perfluoro-n-nonanoic acid results in decreased expression of EFNA4 mRNA CTD PMID:25812627 Efna4 Rat perfluorooctane-1-sulfonic acid decreases expression ISO EFNA4 (Homo sapiens) 6480464 perfluorooctane sulfonic acid results in decreased expression of EFNA4 mRNA CTD PMID:25812627 Efna4 Rat perfluorooctanoic acid multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of EFNA4 mRNA CTD PMID:35163327 Efna4 Rat perfluorooctanoic acid decreases expression ISO EFNA4 (Homo sapiens) 6480464 perfluorooctanoic acid results in decreased expression of EFNA4 mRNA CTD PMID:25812627 Efna4 Rat phorbol 13-acetate 12-myristate multiple interactions ISO EFNA4 (Homo sapiens) 6480464 [Zinc co-treated with Tetradecanoylphorbol Acetate] affects the expression of EFNA4 mRNA CTD PMID:16979875 Efna4 Rat potassium chromate decreases expression ISO EFNA4 (Homo sapiens) 6480464 potassium chromate(VI) results in decreased expression of EFNA4 mRNA CTD PMID:22079256 Efna4 Rat potassium chromate multiple interactions ISO EFNA4 (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of EFNA4 mRNA CTD PMID:22079256 Efna4 Rat potassium dichromate increases expression ISO Efna4 (Mus musculus) 6480464 Potassium Dichromate results in increased expression of EFNA4 mRNA CTD PMID:23608068 Efna4 Rat quercetin decreases expression ISO EFNA4 (Homo sapiens) 6480464 Quercetin results in decreased expression of EFNA4 mRNA CTD PMID:21632981 Efna4 Rat sarin decreases expression ISO EFNA4 (Homo sapiens) 6480464 Sarin results in decreased expression of EFNA4 mRNA CTD PMID:19522546 Efna4 Rat silver atom decreases expression ISO EFNA4 (Homo sapiens) 6480464 Silver results in decreased expression of EFNA4 mRNA CTD PMID:26014281 and PMID:26551752 Efna4 Rat silver(0) decreases expression ISO EFNA4 (Homo sapiens) 6480464 Silver results in decreased expression of EFNA4 mRNA CTD PMID:26014281 and PMID:26551752 Efna4 Rat sodium arsenite decreases expression ISO EFNA4 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of EFNA4 mRNA CTD PMID:12760830 and PMID:38568856 Efna4 Rat sunitinib increases expression ISO EFNA4 (Homo sapiens) 6480464 Sunitinib results in increased expression of EFNA4 mRNA CTD PMID:31533062 Efna4 Rat tert-butyl hydroperoxide decreases expression ISO EFNA4 (Homo sapiens) 6480464 tert-Butylhydroperoxide results in decreased expression of EFNA4 mRNA CTD PMID:12419474 Efna4 Rat thiram decreases expression ISO EFNA4 (Homo sapiens) 6480464 Thiram results in decreased expression of EFNA4 mRNA CTD PMID:38568856 Efna4 Rat titanium dioxide decreases methylation ISO Efna4 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of EFNA4 gene CTD PMID:35295148 Efna4 Rat triphenyl phosphate affects expression ISO EFNA4 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of EFNA4 mRNA CTD PMID:37042841 Efna4 Rat triptonide decreases expression ISO Efna4 (Mus musculus) 6480464 triptonide results in decreased expression of EFNA4 mRNA CTD PMID:33045310 Efna4 Rat valproic acid increases methylation ISO EFNA4 (Homo sapiens) 6480464 Valproic Acid results in increased methylation of EFNA4 gene CTD PMID:29154799 Efna4 Rat valproic acid affects expression ISO EFNA4 (Homo sapiens) 6480464 Valproic Acid affects the expression of EFNA4 mRNA CTD PMID:25979313 Efna4 Rat vincristine decreases expression ISO EFNA4 (Homo sapiens) 6480464 Vincristine results in decreased expression of EFNA4 mRNA CTD PMID:23649840 Efna4 Rat zinc atom multiple interactions ISO EFNA4 (Homo sapiens) 6480464 [Zinc co-treated with Tetradecanoylphorbol Acetate] affects the expression of EFNA4 mRNA CTD PMID:16979875 Efna4 Rat zinc(0) multiple interactions ISO EFNA4 (Homo sapiens) 6480464 [Zinc co-treated with Tetradecanoylphorbol Acetate] affects the expression of EFNA4 mRNA CTD PMID:16979875
Efna4 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 2 177,046,463 - 177,050,713 (-) NCBI GRCr8 mRatBN7.2 2 174,748,729 - 174,752,979 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 2 174,748,724 - 174,752,979 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 2 181,893,743 - 181,897,991 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 2 179,916,118 - 179,920,367 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 2 174,516,662 - 174,520,904 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 2 188,655,920 - 188,660,179 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 2 188,655,912 - 188,660,179 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 2 208,065,969 - 208,070,220 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 2 181,521,270 - 181,525,521 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 2 181,471,898 - 181,475,566 (-) NCBI Celera 2 168,690,302 - 168,694,545 (-) NCBI Celera Cytogenetic Map 2 q34 NCBI
EFNA4 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 1 155,063,740 - 155,069,553 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 1 155,063,737 - 155,069,553 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 1 155,036,216 - 155,042,029 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 1 153,302,837 - 153,308,653 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 1 128,107,735 - 128,113,551 (+) NCBI Celera Cytogenetic Map 1 q21.3 NCBI HuRef 1 126,398,217 - 126,404,030 (+) NCBI HuRef CHM1_1 1 156,432,037 - 156,437,827 (+) NCBI CHM1_1 T2T-CHM13v2.0 1 154,203,127 - 154,208,932 (+) NCBI T2T-CHM13v2.0
Efna4 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 3 89,240,700 - 89,245,335 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 3 89,240,697 - 89,245,335 (-) Ensembl GRCm39 Ensembl GRCm38 3 89,333,393 - 89,338,028 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 3 89,333,390 - 89,338,028 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 3 89,137,315 - 89,141,950 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 3 89,420,102 - 89,423,882 (-) NCBI MGSCv36 mm8 Celera 3 89,368,432 - 89,373,070 (-) NCBI Celera Cytogenetic Map 3 F1 NCBI cM Map 3 39.07 NCBI
Efna4 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955545 1,556,584 - 1,561,354 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955545 1,557,107 - 1,561,234 (+) NCBI ChiLan1.0 ChiLan1.0
EFNA4 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 1 94,771,410 - 94,777,128 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 1 94,503,455 - 94,509,279 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 1 130,410,991 - 130,417,593 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 1 134,021,400 - 134,027,212 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 1 134,021,405 - 134,027,212 (+) Ensembl panpan1.1 panPan2
EFNA4 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 7 42,427,539 - 42,431,788 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 7 42,428,113 - 42,443,429 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 7 41,917,714 - 41,921,969 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 7 42,296,528 - 42,300,780 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 7 42,297,100 - 42,300,693 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 7 42,076,255 - 42,080,508 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 7 42,130,128 - 42,134,383 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 7 42,413,643 - 42,417,904 (-) NCBI UU_Cfam_GSD_1.0
Efna4 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405058 25,568,038 - 25,573,911 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936580 4,599,136 - 4,604,257 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936580 4,598,748 - 4,604,293 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
EFNA4 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 4 94,730,792 - 94,735,559 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 4 94,730,790 - 94,735,578 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 4 103,512,402 - 103,517,185 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
EFNA4 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 20 8,758,126 - 8,767,750 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 20 8,761,883 - 8,766,830 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666038 8,095,819 - 8,102,087 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Efna4
.
Predicted Target Of
Count of predictions: 404 Count of miRNA genes: 220 Interacting mature miRNAs: 269 Transcripts: ENSRNOT00000027935 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1578648 Bss11 Bone structure and strength QTL 11 4.7 femur morphology trait (VT:0000559) femoral neck cortical cross-sectional area (CMO:0001702) 2 114837527 211674221 Rat 1358356 Srcrt1 Stress Responsive Cort QTL1 3.66 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 2 161699179 222436696 Rat 1331734 Bp204 Blood pressure QTL 204 3.61192 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 168358098 223265385 Rat 1298074 Bp164 Blood pressure QTL 164 0.003 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 42804607 202447032 Rat 1354648 Bp239 Blood pressure QTL 239 0.001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 66118463 226797303 Rat 1354649 Kidm17 Kidney mass QTL 17 2.9 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 2 81754530 227146641 Rat 10755499 Bp389 Blood pressure QTL 389 2.61 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 2 18960362 228801039 Rat 1298076 Bp166 Blood pressure QTL 166 0.0009 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 136445150 202447032 Rat 61457 Niddm8 Non-insulin dependent diabetes mellitus QTL 8 4.1 0.01 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 2 174543008 175950118 Rat 152025245 Scl81 Serum cholesterol level QTL 81 3.49 blood cholesterol amount (VT:0000180) 2 122609194 206936711 Rat 70162 Bp63 Blood pressure QTL 63 5.64 arterial blood pressure trait (VT:2000000) blood pressure measurement (CMO:0000003) 2 169745596 214745596 Rat 1554319 Bmd2 Bone mineral density QTL 2 13.4 0.0001 lumbar vertebra area (VT:0010570) lumbar vertebra cross-sectional area (CMO:0001689) 2 114837675 212549332 Rat 12879836 Kidm61 Kidney mass QTL 61 0.001 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 2 152413072 185122374 Rat 1581569 Uae32 Urinary albumin excretion QTL 32 0.0001 urine protein amount (VT:0005160) urine albumin excretion rate (CMO:0000757) 2 78665619 219826953 Rat 10043136 Iddm54 Insulin dependent diabetes mellitus QTL 54 3.4 0.0001 blood glucose amount (VT:0000188) age at onset/diagnosis of type 1 diabetes mellitus (CMO:0001140) 2 143657411 190602963 Rat 12879837 Am2 Aortic mass QTL 2 0.001 aorta mass (VT:0002845) aorta weight to aorta length to body weight ratio (CMO:0002722) 2 152413072 185122374 Rat 12879838 Cm86 Cardiac mass QTL 86 0.002 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 2 152413072 185122374 Rat 1302793 Bw16 Body weight QTL 16 5 0.0001 body mass (VT:0001259) body weight (CMO:0000012) 2 157142209 202446871 Rat 61467 Bp14 Blood pressure QTL 14 2.2 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 43154682 202446871 Rat 12879839 Cm85 Cardiac mass QTL 85 0.001 heart mass (VT:0007028) heart wet weight to body weight ratio (CMO:0002408) 2 152413072 185122374 Rat 61469 Bp16 Blood pressure QTL 16 5.64 arterial blood pressure trait (VT:2000000) blood pressure measurement (CMO:0000003) 2 169745596 214745596 Rat 70175 BpQTLCluster3 Blood pressure QTL cluster 3 4.128 arterial blood pressure trait (VT:2000000) absolute change in systolic blood pressure (CMO:0000607) 2 135552573 202446871 Rat 1549833 Bp257 Blood pressure QTL 257 0.003 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 168354880 185122374 Rat 1358900 Bw48 Body weight QTL 48 4.88 body mass (VT:0001259) body weight (CMO:0000012) 2 157142078 211086598 Rat 12879845 Cm89 Cardiac mass QTL 89 0.008 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 2 152413072 175950118 Rat 61473 Bp19 Blood pressure QTL 19 6.3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 172710921 175950118 Rat 1359030 Bp277 Blood pressure QTL 277 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 2 114837527 185876470 Rat 12879846 Cm90 Cardiac mass QTL 90 0.011 heart right ventricle mass (VT:0007033) heart right ventricle weight to body weight ratio (CMO:0000914) 2 152413072 175950118 Rat 12879847 Am4 Aortic mass QTL 4 0.001 aorta mass (VT:0002845) aorta weight to aorta length to body weight ratio (CMO:0002722) 2 152413072 175950118 Rat 1331760 Bp206 Blood pressure QTL 206 3.62454 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 56043031 202447032 Rat 12879840 Bw179 Body weight QTL 179 0.005 body mass (VT:0001259) body weight (CMO:0000012) 2 152413072 185122374 Rat 1581502 Esta3 Estrogen-induced thymic atrophy QTL 3 thymus mass (VT:0004954) thymus wet weight (CMO:0000855) 2 136916935 189599348 Rat 1359032 Hrtrt18 Heart rate QTL 18 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 2 157142078 192625452 Rat 2301966 Bp322 Blood pressure QTL 322 3.58 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 150540301 202447032 Rat 1298080 Bp163 Blood pressure QTL 163 0.02 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 66118275 202447032 Rat 8662832 Vetf7 Vascular elastic tissue fragility QTL 7 3.5 aorta elastin amount (VT:0003905) aorta wall extracellular elastin dry weight to aorta wall dry weight ratio (CMO:0002002) 2 81689826 221035911 Rat 1298085 Bp165 Blood pressure QTL 165 0.0006 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 42804607 202447032 Rat 1359022 Ppulsi1 Prepulse inhibition QTL 1 3.63 prepulse inhibition trait (VT:0003088) acoustic startle response measurement (CMO:0001519) 2 136916935 213594495 Rat 1641891 Alcrsp17 Alcohol response QTL 17 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 2 149559561 249053267 Rat 724534 Uae6 Urinary albumin excretion QTL 6 10 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 2 78665619 249053267 Rat 61374 Edpm2 Estrogen-dependent pituitary mass QTL 2 4.42 0.86 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 2 76539322 202447032 Rat 8662843 Vetf9 Vascular elastic tissue fragility QTL 9 2.05 thoracic aorta molecular composition trait (VT:0010568) aorta wall extracellular elastin dry weight to aorta wall extracellular collagen weight ratio (CMO:0002003) 2 157142078 226277316 Rat 631501 Bp101 Blood pressure QTL 101 2.4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 150341684 202446871 Rat 2301415 Cm67 Cardiac mass QTL 67 0.003 heart mass (VT:0007028) heart wet weight to body weight ratio (CMO:0002408) 2 152413072 175950118 Rat 2307174 Activ3 Activity QTL 3 4.83 0.000058 locomotor behavior trait (VT:0001392) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 2 168594495 213594495 Rat 1331794 Bp202 Blood pressure QTL 202 3.66819 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 141194931 223265385 Rat 71113 Cari2 Carrageenan-induced inflammation QTL 2 2.7 0.009 hypodermis integrity trait (VT:0010550) inflammatory exudate volume (CMO:0001429) 2 141596551 202447032 Rat 1331805 Cm29 Cardiac mass QTL 29 3.50746 heart mass (VT:0007028) heart wet weight (CMO:0000069) 2 141194931 223265385 Rat 11565180 Kidm56 Kidney mass QTL 56 0.003 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 2 152413072 175950118 Rat 634308 Sach6 Saccharin preference QTL 6 4.9 taste sensitivity trait (VT:0001986) saccharin intake volume to total fluid intake volume ratio (CMO:0001601) 2 112456140 212696837 Rat 1598805 Memor8 Memory QTL 8 3 exploratory behavior trait (VT:0010471) average horizontal distance between subject and target during voluntary locomotion in an experimental apparatus (CMO:0002674) 2 150341585 189039377 Rat 11565181 Bw176 Body weight QTL 176 0.002 body mass (VT:0001259) body weight (CMO:0000012) 2 152413072 175950118 Rat 1358917 Cm42 Cardiac mass QTL 42 2.82 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 2 25413423 203928301 Rat 724568 Uae13 Urinary albumin excretion QTL 13 4.4 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 2 143157029 210020885 Rat 1358913 Cm41 Cardiac mass QTL 41 2.73 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 2 25413423 203928301 Rat 1300165 Rf9 Renal function QTL 9 3.28 kidney glomerulus integrity trait (VT:0010546) index of glomerular damage (CMO:0001135) 2 133914684 202447032 Rat 61401 Niddm2 Non-insulin dependent diabetes mellitus QTL 2 4.54 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 2 144599348 189599348 Rat 631507 Bp105 Blood pressure QTL 105 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 112456140 212696837 Rat 1641925 Alcrsp2 Alcohol response QTL 2 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 2 149559561 221167075 Rat 1354609 Niddm62 Non-insulin dependent diabetes mellitus QTL 62 4.72 0.000006 insulin secretion trait (VT:0003564) plasma insulin level (CMO:0000342) 2 150540301 202447032 Rat 1598833 Bp295 Blood pressure QTL 295 3.5 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 147798556 192798556 Rat 1354622 Kidm16 Kidney mass QTL 16 3 kidney mass (VT:0002707) left kidney wet weight (CMO:0000083) 2 81754530 222436696 Rat 631266 Bp132 Blood pressure QTL 132 0.0005 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 46123260 202447032 Rat 631522 Bp74 Blood pressure QTL 74 0.05 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 172710921 184114403 Rat 7488927 Bp365 Blood pressure QTL 365 0.008 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 162765032 207765032 Rat 1598838 Bp290 Blood pressure QTL 290 1.9 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 166539266 211539266 Rat 7488925 Bp364 Blood pressure QTL 364 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 160564068 205564068 Rat 2293843 Kiddil6 Kidney dilation QTL 6 3.1 kidney pelvis morphology trait (VT:0004194) hydronephrosis severity score (CMO:0001208) 2 42804607 182042367 Rat 2306901 Bp337 Blood pressure QTL 337 0.01 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 164073756 227146641 Rat 1354605 Rf48 Renal function QTL 48 2.9 blood creatinine amount (VT:0005328) plasma creatinine level (CMO:0000537) 2 74786664 206665859 Rat 6903312 Bw112 Body weight QTL 112 3.2 0.0013 body mass (VT:0001259) body weight (CMO:0000012) 2 143657569 184114274 Rat 7488904 Bp363 Blood pressure QTL 363 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 172982062 175950118 Rat 1354601 Slep1 Serum leptin concentration QTL 1 5.39 blood leptin amount (VT:0005667) serum leptin level (CMO:0000780) 2 43171017 184114403 Rat
RH139781
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 2 174,754,659 - 174,754,849 (+) MAPPER mRatBN7.2 Rnor_6.0 2 188,661,860 - 188,662,049 NCBI Rnor6.0 Rnor_5.0 2 208,071,901 - 208,072,090 UniSTS Rnor5.0 RGSC_v3.4 2 181,527,202 - 181,527,391 UniSTS RGSC3.4 Celera 2 168,696,226 - 168,696,415 UniSTS RH 3.4 Map 2 1156.4 UniSTS Cytogenetic Map 2 q34 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000027935 ⟹ ENSRNOP00000027935
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 2 174,748,729 - 174,752,979 (-) Ensembl Rnor_6.0 Ensembl 2 188,655,928 - 188,660,179 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000086916 ⟹ ENSRNOP00000074145
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 2 174,748,724 - 174,752,572 (-) Ensembl Rnor_6.0 Ensembl 2 188,655,912 - 188,657,940 (-) Ensembl
RefSeq Acc Id:
NM_001107692 ⟹ NP_001101162
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 177,046,463 - 177,050,713 (-) NCBI mRatBN7.2 2 174,748,729 - 174,752,979 (-) NCBI Rnor_6.0 2 188,655,928 - 188,660,179 (-) NCBI Rnor_5.0 2 208,065,969 - 208,070,220 (-) NCBI RGSC_v3.4 2 181,521,270 - 181,525,521 (-) RGD Celera 2 168,690,302 - 168,694,545 (-) RGD
Sequence:
CGCCGGGACAGAGAAGTGGGCCGGGACCAGCCGGGCCAGACCAGACTGGACCCCAGGGGCGATGCGGCTGTTGCCCCTGCTGCGGACTGTGCTCTGGGCCGCGCTGCTCGGCTCGCGCCTGCGGGGGT
hide sequence
RefSeq Acc Id:
NP_001101162 ⟸ NM_001107692
- Peptide Label:
precursor
- UniProtKB:
D3ZEN1 (UniProtKB/TrEMBL), A6J6E9 (UniProtKB/TrEMBL)
- Sequence:
MRLLPLLRTVLWAALLGSRLRGCSSLRHSIYWNSTNPRLLRGDAVVELGLNDYLDIFCPHYESPGPPEGPETFALYIVDWSGYEACKAEGANAFQRWNCTLPFAPFVPVRFSEKIQRFTPFPLGFEFL
hide sequence
Ensembl Acc Id:
ENSRNOP00000027935 ⟸ ENSRNOT00000027935
Ensembl Acc Id:
ENSRNOP00000074145 ⟸ ENSRNOT00000086916
RGD ID: 13691470 Promoter ID: EPDNEW_R1995 Type: multiple initiation site Name: Efna4_1 Description: ephrin A4 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 2 188,660,189 - 188,660,249 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2008-04-30
Efna4
ephrin A4
Efna4_predicted
ephrin A4 (predicted)
'predicted' is removed
2292626 APPROVED
2005-01-12
Efna4_predicted
ephrin A4 (predicted)
Symbol and Name status set to approved
70820 APPROVED
