Advanced Search (OLGA)

Gene: Hddc2 (HD domain containing 2) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Hddc2

Name:

HD domain containing 2

RGD ID:

1307562

Description:

Predicted to enable 5'-deoxynucleotidase activity. Orthologous to human HDDC2 (HD domain containing 2); INTERACTS WITH 2,6-dinitrotoluene; acetamide; bisphenol A.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

5'-deoxynucleotidase HDDC2; HD domain-containing protein 2; LOC361462; RGD1307562; similar to CGI-130 protein

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	HDDC2 (HD domain containing 2)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):	Hddc2 (HD domain containing 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Hddc2 (HD domain containing 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	HDDC2 (HD domain containing 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	HDDC2 (HD domain containing 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Hddc2 (HD domain containing 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	HDDC2 (HD domain containing 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	HDDC2 (HD domain containing 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Hddc2 (HD domain containing 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	HDDC2 (HD domain containing 2)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Hddc2 (HD domain containing 2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	hddc2 (HD domain containing 2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG11050	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	F45F2.9	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	YBR242W	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	YGK1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	hddc2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	28,100,669 - 28,133,008 (-)	NCBI		GRCr8
mRatBN7.2	1	26,294,030 - 26,313,914 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	26,294,030 - 26,313,935 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	26,047,974 - 26,067,861 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	32,047,800 - 32,067,686 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	26,248,587 - 26,268,474 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	28,567,447 - 28,600,116 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	28,579,990 - 28,600,586 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	30,022,220 - 30,054,922 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	26,955,259 - 26,975,139 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	1	26,958,509 - 26,978,046 (-)	NCBI
Celera	1	24,988,009 - 25,007,891 (-)	NCBI		Celera
Cytogenetic Map	1	p11	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Hddc2	Rat	(1->4)-beta-D-glucan	multiple interactions	ISO	Hddc2 (Mus musculus)	6480464	[perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of HDDC2 mRNA	CTD	PMID:36331819
Hddc2	Rat	(S)-nicotine	increases expression	ISO	HDDC2 (Homo sapiens)	6480464	Nicotine results in increased expression of HDDC2 mRNA	CTD	PMID:23825647
Hddc2	Rat	2,2',4,4'-Tetrabromodiphenyl ether	affects expression	ISO	Hddc2 (Mus musculus)	6480464	2 more ...	CTD	PMID:30294300
Hddc2	Rat	2,6-dinitrotoluene	affects expression	EXP		6480464	2 and 6-dinitrotoluene affects the expression of HDDC2 mRNA	CTD	PMID:21346803
Hddc2	Rat	acetamide	decreases expression	EXP		6480464	acetamide results in decreased expression of HDDC2 mRNA	CTD	PMID:31881176
Hddc2	Rat	acrolein	multiple interactions	ISO	HDDC2 (Homo sapiens)	6480464	[Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased expression of HDDC2 mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in increased expression of HDDC2 mRNA	CTD	PMID:32699268
Hddc2	Rat	all-trans-retinoic acid	decreases expression	ISO	HDDC2 (Homo sapiens)	6480464	Tretinoin results in decreased expression of HDDC2 mRNA	CTD	PMID:23724009 and PMID:33167477
Hddc2	Rat	alpha-pinene	multiple interactions	ISO	HDDC2 (Homo sapiens)	6480464	[Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased expression of HDDC2 mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in increased expression of HDDC2 mRNA	CTD	PMID:32699268
Hddc2	Rat	arsane	affects methylation	ISO	HDDC2 (Homo sapiens)	6480464	Arsenic affects the methylation of HDDC2 gene	CTD	PMID:25304211
Hddc2	Rat	arsane	multiple interactions	ISO	HDDC2 (Homo sapiens)	6480464	[sodium arsenite results in increased abundance of Arsenic] which results in increased expression of HDDC2 mRNA	CTD	PMID:39836092
Hddc2	Rat	arsenic atom	affects methylation	ISO	HDDC2 (Homo sapiens)	6480464	Arsenic affects the methylation of HDDC2 gene	CTD	PMID:25304211
Hddc2	Rat	arsenic atom	multiple interactions	ISO	HDDC2 (Homo sapiens)	6480464	[sodium arsenite results in increased abundance of Arsenic] which results in increased expression of HDDC2 mRNA	CTD	PMID:39836092
Hddc2	Rat	arsenite(3-)	multiple interactions	ISO	HDDC2 (Homo sapiens)	6480464	arsenite promotes the reaction [G3BP1 protein binds to HDDC2 mRNA]	CTD	PMID:32406909
Hddc2	Rat	benzo[a]pyrene	increases expression	ISO	Hddc2 (Mus musculus)	6480464	Benzo(a)pyrene results in increased expression of HDDC2 mRNA	CTD	PMID:22228805
Hddc2	Rat	beta-lapachone	increases expression	ISO	HDDC2 (Homo sapiens)	6480464	beta-lapachone results in increased expression of HDDC2 mRNA	CTD	PMID:38218311
Hddc2	Rat	bis(2-ethylhexyl) phthalate	decreases expression	ISO	Hddc2 (Mus musculus)	6480464	Diethylhexyl Phthalate results in decreased expression of HDDC2 mRNA	CTD	PMID:34319233
Hddc2	Rat	bisphenol A	decreases expression	ISO	HDDC2 (Homo sapiens)	6480464	bisphenol A results in decreased expression of HDDC2 mRNA	CTD	PMID:25047013
Hddc2	Rat	bisphenol A	increases expression	ISO	Hddc2 (Mus musculus)	6480464	bisphenol A results in increased expression of HDDC2 mRNA	CTD	PMID:32156529
Hddc2	Rat	bisphenol A	increases expression	EXP		6480464	bisphenol A results in increased expression of HDDC2 mRNA	CTD	PMID:30816183 and PMID:32528016
Hddc2	Rat	cadmium dichloride	decreases expression	ISO	HDDC2 (Homo sapiens)	6480464	Cadmium Chloride results in decreased expression of HDDC2 mRNA	CTD	PMID:38382870
Hddc2	Rat	caffeine	increases phosphorylation	ISO	HDDC2 (Homo sapiens)	6480464	Caffeine results in increased phosphorylation of HDDC2 protein	CTD	PMID:35688186
Hddc2	Rat	calcitriol	increases expression	ISO	HDDC2 (Homo sapiens)	6480464	Calcitriol results in increased expression of HDDC2 mRNA	CTD	PMID:21592394
Hddc2	Rat	calcitriol	multiple interactions	ISO	HDDC2 (Homo sapiens)	6480464	[Testosterone co-treated with Calcitriol] results in increased expression of HDDC2 mRNA	CTD	PMID:21592394
Hddc2	Rat	carbon nanotube	increases expression	ISO	Hddc2 (Mus musculus)	6480464	Nanotubes more ...	CTD	PMID:25620056
Hddc2	Rat	chloropicrin	increases expression	ISO	HDDC2 (Homo sapiens)	6480464	chloropicrin results in increased expression of HDDC2 mRNA	CTD	PMID:26352163
Hddc2	Rat	cyclosporin A	decreases expression	EXP		6480464	Cyclosporine results in decreased expression of HDDC2 mRNA	CTD	PMID:21865292
Hddc2	Rat	decabromodiphenyl ether	increases expression	EXP		6480464	decabromobiphenyl ether results in increased expression of HDDC2 mRNA	CTD	PMID:23640034
Hddc2	Rat	Dibutyl phosphate	affects expression	ISO	HDDC2 (Homo sapiens)	6480464	di-n-butylphosphoric acid affects the expression of HDDC2 mRNA	CTD	PMID:37042841
Hddc2	Rat	dibutyl phthalate	decreases expression	ISO	Hddc2 (Mus musculus)	6480464	Dibutyl Phthalate results in decreased expression of HDDC2 mRNA	CTD	PMID:21266533
Hddc2	Rat	dorsomorphin	multiple interactions	ISO	HDDC2 (Homo sapiens)	6480464	[NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of HDDC2 mRNA	CTD	PMID:27188386
Hddc2	Rat	doxorubicin	decreases expression	ISO	HDDC2 (Homo sapiens)	6480464	Doxorubicin results in decreased expression of HDDC2 mRNA	CTD	PMID:29803840
Hddc2	Rat	fluoranthene	multiple interactions	ISO	Hddc2 (Mus musculus)	6480464	[1-methylanthracene co-treated with fluoranthene] results in decreased expression of HDDC2 mRNA	CTD	PMID:28329830
Hddc2	Rat	gentamycin	decreases expression	EXP		6480464	Gentamicins results in decreased expression of HDDC2 mRNA	CTD	PMID:33387578
Hddc2	Rat	hydrogen peroxide	increases expression	ISO	HDDC2 (Homo sapiens)	6480464	Hydrogen Peroxide results in increased expression of HDDC2 mRNA	CTD	PMID:18951874
Hddc2	Rat	indole-3-methanol	affects expression	EXP		6480464	indole-3-carbinol affects the expression of HDDC2 mRNA	CTD	PMID:21396975
Hddc2	Rat	ivermectin	decreases expression	ISO	HDDC2 (Homo sapiens)	6480464	Ivermectin results in decreased expression of HDDC2 protein	CTD	PMID:32959892
Hddc2	Rat	methyl methanesulfonate	decreases expression	ISO	HDDC2 (Homo sapiens)	6480464	Methyl Methanesulfonate results in decreased expression of HDDC2 mRNA	CTD	PMID:23649840
Hddc2	Rat	mono(2-ethylhexyl) phthalate	decreases expression	ISO	HDDC2 (Homo sapiens)	6480464	mono-(2-ethylhexyl)phthalate results in decreased expression of HDDC2 mRNA	CTD	PMID:38685446
Hddc2	Rat	monosodium L-glutamate	decreases expression	ISO	Hddc2 (Mus musculus)	6480464	Sodium Glutamate results in decreased expression of HDDC2 mRNA	CTD	PMID:22078008
Hddc2	Rat	nicotine	increases expression	ISO	HDDC2 (Homo sapiens)	6480464	Nicotine results in increased expression of HDDC2 mRNA	CTD	PMID:23825647
Hddc2	Rat	oxaliplatin	multiple interactions	EXP		6480464	[oxaliplatin co-treated with Topotecan] results in decreased expression of HDDC2 mRNA	CTD	PMID:25729387
Hddc2	Rat	ozone	multiple interactions	ISO	HDDC2 (Homo sapiens)	6480464	[Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased expression of HDDC2 mRNA more ...	CTD	PMID:32699268
Hddc2	Rat	paracetamol	affects expression	ISO	Hddc2 (Mus musculus)	6480464	Acetaminophen affects the expression of HDDC2 mRNA	CTD	PMID:17562736
Hddc2	Rat	paracetamol	decreases expression	ISO	HDDC2 (Homo sapiens)	6480464	Acetaminophen results in decreased expression of HDDC2 mRNA	CTD	PMID:22230336 and PMID:26690555
Hddc2	Rat	perfluorooctane-1-sulfonic acid	multiple interactions	ISO	Hddc2 (Mus musculus)	6480464	[perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of HDDC2 mRNA	CTD	PMID:36331819
Hddc2	Rat	SB 431542	multiple interactions	ISO	HDDC2 (Homo sapiens)	6480464	[LDN 193189 co-treated with 4-(5-benzo(1 more ...	CTD	PMID:27188386 and PMID:37664457
Hddc2	Rat	sodium arsenite	increases expression	ISO	HDDC2 (Homo sapiens)	6480464	sodium arsenite results in increased expression of HDDC2 mRNA	CTD	PMID:17879257
Hddc2	Rat	sodium arsenite	multiple interactions	ISO	HDDC2 (Homo sapiens)	6480464	[sodium arsenite results in increased abundance of Arsenic] which results in increased expression of HDDC2 mRNA	CTD	PMID:39836092
Hddc2	Rat	sodium arsenite	decreases expression	ISO	HDDC2 (Homo sapiens)	6480464	sodium arsenite results in decreased expression of HDDC2 mRNA	CTD	PMID:38568856
Hddc2	Rat	testosterone	multiple interactions	ISO	HDDC2 (Homo sapiens)	6480464	[Testosterone co-treated with Calcitriol] results in increased expression of HDDC2 mRNA	CTD	PMID:21592394
Hddc2	Rat	testosterone	increases expression	ISO	HDDC2 (Homo sapiens)	6480464	Testosterone results in increased expression of HDDC2 mRNA	CTD	PMID:21592394
Hddc2	Rat	thioacetamide	decreases expression	EXP		6480464	Thioacetamide results in decreased expression of HDDC2 mRNA	CTD	PMID:34492290
Hddc2	Rat	titanium dioxide	decreases methylation	ISO	Hddc2 (Mus musculus)	6480464	titanium dioxide results in decreased methylation of HDDC2 gene	CTD	PMID:35295148
Hddc2	Rat	topotecan	multiple interactions	EXP		6480464	[oxaliplatin co-treated with Topotecan] results in decreased expression of HDDC2 mRNA	CTD	PMID:25729387
Hddc2	Rat	tungsten	increases expression	ISO	Hddc2 (Mus musculus)	6480464	Tungsten results in increased expression of HDDC2 mRNA	CTD	PMID:30912803
Hddc2	Rat	valproic acid	affects expression	ISO	HDDC2 (Homo sapiens)	6480464	Valproic Acid affects the expression of HDDC2 mRNA	CTD	PMID:25979313
Hddc2	Rat	valproic acid	increases expression	ISO	HDDC2 (Homo sapiens)	6480464	Valproic Acid results in increased expression of HDDC2 mRNA	CTD	PMID:23179753 and PMID:26272509
Hddc2	Rat	valproic acid	multiple interactions	ISO	HDDC2 (Homo sapiens)	6480464	[NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of HDDC2 mRNA	CTD	PMID:27188386
Hddc2	Rat	vorinostat	increases expression	ISO	HDDC2 (Homo sapiens)	6480464	vorinostat results in increased expression of HDDC2 mRNA	CTD	PMID:27188386

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Hddc2	Rat	5'-deoxynucleotidase activity	enables	IEA	InterPro:IPR039356	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Hddc2	Rat	5'-deoxynucleotidase activity	enables	IEA	EC:3.1.3.89	1600115	GO_REF:0000003	UniProt	GO_REF:0000003
Hddc2	Rat	5'-deoxynucleotidase activity	enables	IBA	PANTHER:PTN000217841 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Hddc2	Rat	metal ion binding	enables	IEA	UniProtKB-KW:KW-0479	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Hddc2	Rat	protein binding	enables	ISO	HDDC2 (Homo sapiens)	1624291	UniProtKB:P01189 more ...	RGD	PMID:22190034 and PMID:32296183

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

PMID:18614015	PMID:23376485

Hddc2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	28,100,669 - 28,133,008 (-)	NCBI		GRCr8
mRatBN7.2	1	26,294,030 - 26,313,914 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	26,294,030 - 26,313,935 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	26,047,974 - 26,067,861 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	32,047,800 - 32,067,686 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	26,248,587 - 26,268,474 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	28,567,447 - 28,600,116 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	28,579,990 - 28,600,586 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	30,022,220 - 30,054,922 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	26,955,259 - 26,975,139 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	1	26,958,509 - 26,978,046 (-)	NCBI
Celera	1	24,988,009 - 25,007,891 (-)	NCBI		Celera
Cytogenetic Map	1	p11	NCBI

HDDC2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	6	125,275,350 - 125,301,967 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	6	125,219,962 - 125,302,078 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	6	125,596,496 - 125,623,113 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	6	125,638,195 - 125,664,981 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	6	125,638,194 - 125,664,829	NCBI
Celera	6	126,341,534 - 126,368,320 (-)	NCBI		Celera
Cytogenetic Map	6	q22.31	NCBI
HuRef	6	123,173,271 - 123,200,058 (-)	NCBI		HuRef
CHM1_1	6	125,860,268 - 125,887,025 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	6	126,463,762 - 126,490,399 (-)	NCBI		T2T-CHM13v2.0

Hddc2
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	10	31,189,296 - 31,204,200 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	10	31,189,379 - 31,204,200 (+)	Ensembl		GRCm39 Ensembl
GRCm38	10	31,313,330 - 31,328,204 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	10	31,313,383 - 31,328,204 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	10	31,033,211 - 31,047,892 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	10	31,002,821 - 31,017,502 (+)	NCBI		MGSCv36	mm8
Celera	10	32,239,903 - 32,254,584 (+)	NCBI		Celera
Cytogenetic Map	10	A4	NCBI
cM Map	10	17.34	NCBI

Hddc2
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955436	6,675,892 - 6,694,086 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955436	6,675,892 - 6,694,086 (-)	NCBI	ChiLan1.0	ChiLan1.0

HDDC2
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	5	145,268,465 - 145,293,790 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	6	143,172,278 - 143,197,594 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	6	123,062,566 - 123,087,717 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	6	127,181,179 - 127,206,843 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	6	127,181,791 - 127,205,326 (-)	Ensembl	panpan1.1		panPan2

HDDC2
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	1	64,222,510 - 64,250,854 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	1	64,222,666 - 64,247,818 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	1	65,032,692 - 65,058,244 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	1	64,430,367 - 64,456,256 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	1	64,430,523 - 64,456,268 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	1	64,361,577 - 64,387,104 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	1	64,148,226 - 64,174,108 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	1	64,799,771 - 64,825,388 (-)	NCBI		UU_Cfam_GSD_1.0

Hddc2
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404946	114,286,343 - 114,293,476 (-)	NCBI		HiC_Itri_2
SpeTri2.0	NW_004936639	4,125,022 - 4,132,816 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

HDDC2
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	1	37,640,656 - 37,662,778 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	1	37,640,628 - 37,660,751 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	1	41,395,551 - 41,415,603 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

HDDC2
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	13	48,411,144 - 48,437,764 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	13	48,410,938 - 48,437,930 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666040	20,722,284 - 20,748,915 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Hddc2
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624798	6,262,990 - 6,276,293 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624798	6,262,045 - 6,282,570 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Hddc2
86 total Variants

Assembly: RGSC_v3.4

Chromosome	Start Pos	End Pos	Reference Nucleotide	Variant Nucleotide	Variant Type	Strain	Variant Page
1	26975034	26975035	T	A	snv	FHL/EurMcwi (MCW)	View more Information

Predicted Target Of

	Summary Value
Count of predictions:	190
Count of miRNA genes:	138
Interacting mature miRNAs:	154
Transcripts:	ENSRNOT00000029444
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
631688	Hcas2	Hepatocarcinoma susceptibility QTL 2	3	0.0001	liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	1	5925874	115540829	Rat
1357397	Bw41	Body weight QTL 41	4.19	0.0001	body mass (VT:0001259)	body weight (CMO:0000012)	1	22340647	49361612	Rat
1578650	Bmd6	Bone mineral density QTL 6	12.2		femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	1	509108	43284926	Rat
1578651	Bmd7	Bone mineral density QTL 7	14.2		femur mineral mass (VT:0010011)	compact volumetric bone mineral density (CMO:0001730)	1	509108	43284926	Rat
2313062	Bmd73	Bone mineral density QTL 73	3.9	0.0001	tibia mineral mass (VT:1000283)	compact volumetric bone mineral density (CMO:0001730)	1	11481312	82174945	Rat
1554320	Bmd1	Bone mineral density QTL 1	12.2	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	1	509108	86060548	Rat
2313065	Bss67	Bone structure and strength QTL 67	3.1	0.0001	tibia area (VT:1000281)	tibia total energy absorbed before break (CMO:0001736)	1	11481312	82174945	Rat
7421626	Bp360	Blood pressure QTL 360		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	4393289	49393289	Rat
1357400	Bw62	Body weight QTL62	4.05		inguinal fat pad mass (VT:0010424)	inguinal fat pad weight to body weight ratio (CMO:0001253)	1	22340647	67340647	Rat
2313070	Bss52	Bone structure and strength QTL 52	4.4	0.0001	body length (VT:0001256)	body length (CMO:0000013)	1	1	32356093	Rat
1357401	Bw43	Body weight QTL 43	3.75		body mass (VT:0001259)	body weight (CMO:0000012)	1	22340647	49361612	Rat
2313069	Bss68	Bone structure and strength QTL 68	2.9	0.0001	tibia size trait (VT:0100001)	tibia total energy absorbed before break (CMO:0001736)	1	11481312	82174945	Rat
631495	Bp96	Blood pressure QTL 96	4.52		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	22340647	102268831	Rat
631494	Bp95	Blood pressure QTL 95	40	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	16206210	49268520	Rat
2313075	Bss66	Bone structure and strength QTL 66	3.4	0.0001	tibia length (VT:0004357)	tibia length (CMO:0000450)	1	11481312	82174945	Rat
5684998	Bss101	Bone structure and strength QTL 101	3.6		tibia strength trait (VT:1000284)	tibia ultimate force (CMO:0001734)	1	15431621	49361612	Rat
2298546	Neuinf4	Neuroinflammation QTL 4	5.1		nervous system integrity trait (VT:0010566)	spinal cord RT1-B protein level (CMO:0002132)	1	1	28736750	Rat
5684999	Bss102	Bone structure and strength QTL 102	5.5	7e-07	tibia strength trait (VT:1000284)	tibia stiffness (CMO:0001735)	1	15431621	49361612	Rat
1300167	Hrtrt2	Heart rate QTL 2	4.35		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	1	11481312	75088344	Rat
2313077	Bss69	Bone structure and strength QTL 69	3.5	0.0001	tibia strength trait (VT:1000284)	bone polar moment of inertia (CMO:0001558)	1	11481312	82174945	Rat
2317755	Glom22	Glomerulus QTL 22	3.8		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	1	11481482	32355910	Rat
1578756	Iddm22	Insulin dependent diabetes mellitus QTL 22	2.7		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	11835181	56835181	Rat
631508	Sald1	Serum aldosterone level QTL 1	3.7		blood aldosterone amount (VT:0005346)	serum aldosterone level (CMO:0000487)	1	9856001	54856001	Rat
2313090	Bmd69	Bone mineral density QTL 69	4.4	0.0001	tibia mineral mass (VT:1000283)	compact volumetric bone mineral density (CMO:0001730)	1	1	32356093	Rat
724520	Bp145	Blood pressure QTL 145	2.1	0.0024	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	20784828	65784828	Rat
1558642	Prcr2	Prostate cancer resistance QTL 2	4.3		prostate integrity trait (VT:0010571)	area of ventral prostate occupied by tumorous lesions to total ventral prostate area ratio (CMO:0000899)	1	20763158	44095856	Rat
2313092	Bmd72	Bone mineral density QTL 72	2.5	0.0001	tibia mineral mass (VT:1000283)	total volumetric bone mineral density (CMO:0001728)	1	11481312	82174945	Rat
2313097	Bss70	Bone structure and strength QTL 70	3.5	0.0001	tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	1	11481312	82174945	Rat
738020	Pia8	Pristane induced arthritis QTL 8	4.7		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	1	1	65833076	Rat
1600360	Mcs16	Mammary carcinoma susceptibility QTL 16	2.4		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	1	2244390	43433040	Rat
1578669	Bss9	Bone structure and strength QTL 9	6.3		femur morphology trait (VT:0000559)	bone trabecular cross-sectional area (CMO:0002311)	1	509108	43284926	Rat
2302038	Pia31	Pristane induced arthritis QTL 31	5.5	0.001	blood autoantibody amount (VT:0003725)	serum immunoglobulin M-type rheumatoid factor level relative to an arbitrary reference serum (CMO:0002111)	1	10992065	55992065	Rat
634353	Rends2	Renal damage susceptibility QTL 2		0.05	kidney blood vessel morphology trait (VT:0000530)	organ lesion measurement (CMO:0000677)	1	19333571	56983283	Rat
2313053	Bss51	Bone structure and strength QTL 51	3.8	0.0001	tibia length (VT:0004357)	tibia length (CMO:0000450)	1	1	32356093	Rat

D1Got32

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	26,295,345 - 26,295,481 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	28,581,196 - 28,581,331	NCBI	Rnor6.0
Rnor_5.0	1	30,036,006 - 30,036,141	UniSTS	Rnor5.0
RGSC_v3.4	1	26,956,571 - 26,956,707	RGD	RGSC3.4
RGSC_v3.4	1	26,956,572 - 26,956,707	UniSTS	RGSC3.4
RGSC_v3.1	1	26,959,517 - 26,959,652	RGD
Celera	1	24,989,322 - 24,989,459	UniSTS
RH 3.4 Map	1	283.2	RGD
RH 3.4 Map	1	283.2	UniSTS
Cytogenetic Map	1	p11	UniSTS

BF409313

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	26,294,181 - 26,294,394 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	28,580,032 - 28,580,244	NCBI	Rnor6.0
Rnor_5.0	1	30,034,842 - 30,035,054	UniSTS	Rnor5.0
RGSC_v3.4	1	26,955,408 - 26,955,620	UniSTS	RGSC3.4
Celera	1	24,988,158 - 24,988,370	UniSTS
RH 3.4 Map	1	273.1	UniSTS
Cytogenetic Map	1	p11	UniSTS

RH132288

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	26,294,984 - 26,295,199 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	28,580,835 - 28,581,049	NCBI	Rnor6.0
Rnor_5.0	1	30,035,645 - 30,035,859	UniSTS	Rnor5.0
RGSC_v3.4	1	26,956,211 - 26,956,425	UniSTS	RGSC3.4
Celera	1	24,988,961 - 24,989,175	UniSTS
RH 3.4 Map	1	274.6	UniSTS
Cytogenetic Map	1	p11	UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31


RefSeq Transcripts	NM_001108460	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_008758672	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039081168	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063266054	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH474002	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000001	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000029444 ⟹ ENSRNOP00000034339

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	26,294,030 - 26,313,935 (-)	Ensembl
Rnor_6.0 Ensembl	1	28,579,990 - 28,600,586 (-)	Ensembl

RefSeq Acc Id:

NM_001108460 ⟹ NP_001101930

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	28,113,096 - 28,132,977 (-)	NCBI
mRatBN7.2	1	26,294,033 - 26,313,914 (-)	NCBI
Rnor_6.0	1	28,579,883 - 28,600,094 (-)	NCBI
Rnor_5.0	1	30,022,220 - 30,054,922 (-)	NCBI
RGSC_v3.4	1	26,955,259 - 26,975,139 (-)	RGD
Celera	1	24,988,009 - 25,007,891 (-)	RGD

Sequence:

show sequence

GCCTGAGGACGTCACCAACCAGCTCTTTACACTCCAGCATGGCTTCGGCCACATCCAACTGCCAGGCCGGGCTGTTGCGTTTTCTGCGTCTAGTCGGGCAGCTCAAGAGAGTCCCACGGACTGGCTGG
GTATATAGAAACGTTGAGAAGCCGGAAAGCGTGTCAGATCACATGTACCGGATGGCAGTTATGGCTATGGTGACCAGAGATGACCGTCTTAACAAGGATAGATGTATACGCCTAGCCCTGGTTCACGA
TATGGCAGAATGCATCGTTGGGGACATAGCACCTGCAGATAACATCCCTAAAGAAGAAAAGCACAGAAGAGAGGAGGAGGCCATGAAAGAGATAACCCAGCTGCTGCCAGAGGACCTCAGGAAGGAGC
TATATGAACTCTGGGAAGAGTATGAGACCCAGTCTAGTGAAGAAGCCAGGTTCGTGAAGCAGCTGGACCAGTGTGAAATGATCCTTCAGGCATCAGAGTATGAAGACATGGAGAACAAGCCTGGGAGG
CTTCAGGACTTCTATGATTCCACAGCAGGAAAATTCAGTCATCCTGAGATAGTCCAGCTTGTTTCTGAGCTGGAGACAGAGAGAAATGCCAGCATGGCCACAACCCCGTCAGAGCCGGGCTCCTGATG
GCCACAGCCCCGTCAGAGCCGGGCTCCTGATGGCCACAGCCTCGACAGAGCCGGGCTCCTGAGCTCACCTTGCTGCTCCACAGCGCTGCTTTGTTTGTTCCCTGGGGGTTTTCCCAAGATGAGCGTCT
GTTTTCTGTTGTCCGGACTTGAACAAGAAATGTGATGTAATCCAGGCCCTAAAAGAAGCCACCAAACCAGAAGTGGTCAGGAAGGTGCTGTGGATGAAGACTGGAGAAGAGAATGCTTTTTTGTGTGA
ATTAAAAAACAAAACAAAACAAAACAAAAAAAAACACCAAAAAACTCC

hide sequence

RefSeq Acc Id:

XM_039081168 ⟹ XP_038937096

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	28,113,093 - 28,132,810 (-)	NCBI
mRatBN7.2	1	26,294,030 - 26,313,791 (-)	NCBI

RefSeq Acc Id:

XM_063266054 ⟹ XP_063122124

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	28,100,669 - 28,133,008 (-)	NCBI


Protein RefSeqs	NP_001101930	(Get FASTA)	NCBI Sequence Viewer
	XP_038937096	(Get FASTA)	NCBI Sequence Viewer
	XP_063122124	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDL87710	(Get FASTA)	NCBI Sequence Viewer
	EDL87711	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000034339
	ENSRNOP00000034339.4
	ENSRNOP00000109074

RefSeq Acc Id:	NP_001101930 ⟸ NM_001108460
- UniProtKB:	D3ZKT8 (UniProtKB/TrEMBL), A6JUR8 (UniProtKB/TrEMBL)
- Sequence:	show sequence MASATSNCQAGLLRFLRLVGQLKRVPRTGWVYRNVEKPESVSDHMYRMAVMAMVTRDDRLNKDRCIRLALVHDMAECIVGDIAPADNIPKEEKHRREEEAMKEITQLLPEDLRKELYELWEEYETQSS EEARFVKQLDQCEMILQASEYEDMENKPGRLQDFYDSTAGKFSHPEIVQLVSELETERNASMATTPSEPGS hide sequence

Ensembl Acc Id:

ENSRNOP00000034339 ⟸ ENSRNOT00000029444

RefSeq Acc Id:	XP_038937096 ⟸ XM_039081168
- Peptide Label:	isoform X2

RefSeq Acc Id:	XP_063122124 ⟸ XM_063266054
- Peptide Label:	isoform X1

Protein Domains

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D3ZKT8-F1-model_v2	AlphaFold	D3ZKT8	1-199	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

RGD ID:

13689542

Promoter ID:

EPDNEW_R66

Type:

multiple initiation site

Name:

Hddc2_1

Description:

HD domain containing 2

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	1	28,600,066 - 28,600,126	EPDNEW

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-61984	BioCyc
Ensembl Genes	ENSRNOG00000021442	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000029444	ENTREZGENE
	ENSRNOT00000029444.7	UniProtKB/TrEMBL
	ENSRNOT00000139104	ENTREZGENE
Gene3D-CATH	Hypothetical protein af1432	UniProtKB/TrEMBL
InterPro	HD_domain	UniProtKB/TrEMBL
	Metal-dep_PHydrolase_HD_dom	UniProtKB/TrEMBL
	Nucleoside_monoPase	UniProtKB/TrEMBL
KEGG Report	rno:361462	UniProtKB/TrEMBL
NCBI Gene	361462	ENTREZGENE
PANTHER	5'-DEOXYNUCLEOTIDASE HDDC2	UniProtKB/TrEMBL
	PTHR11845	UniProtKB/TrEMBL
Pfam	HD_3	UniProtKB/TrEMBL
PhenoGen	Hddc2	PhenoGen
PROSITE	PS51831	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000021442	RatGTEx
SMART	HDc	UniProtKB/TrEMBL
Superfamily-SCOP	HD-domain/PDEase-like	UniProtKB/TrEMBL
UniProt	A6JUR8	ENTREZGENE, UniProtKB/TrEMBL
	D3ZKT8	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-04-30	Hddc2	HD domain containing 2	Hddc2_predicted	HD domain containing 2 (predicted)	'predicted' is removed	2292626	APPROVED
2006-03-30	Hddc2_predicted	HD domain containing 2 (predicted)	RGD1307562_predicted	similar to CGI-130 protein (predicted)	Symbol and Name updated	1299863	APPROVED
2005-01-20	RGD1307562_predicted	similar to CGI-130 protein (predicted)	LOC361462_predicted		Symbol and Name status set to approved	1331353	APPROVED
2005-01-12	LOC361462_predicted	similar to CGI-130 protein (predicted)			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Send us a Message