Symbol:
Trappc2
Name:
trafficking protein particle complex subunit 2
RGD ID:
1306925
Description:
Predicted to enable transcription corepressor binding activity; transcription regulator inhibitor activity; and transmembrane transporter binding activity. Predicted to be involved in endoplasmic reticulum to Golgi vesicle-mediated transport; positive regulation of gene expression; and skeletal system development. Predicted to be located in endoplasmic reticulum; nucleus; and perinuclear region of cytoplasm. Predicted to be part of TRAPP complex. Predicted to be active in cytoplasm and nucleus. Human ortholog(s) of this gene implicated in X-linked spondyloepiphyseal dysplasia tarda. Orthologous to human TRAPPC2 (trafficking protein particle complex subunit 2); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; furan; gentamycin.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
LOC287274; MGC109621; RGD1306925; sedlin; similar to RIKEN cDNA 0610009B22; trafficking protein particle complex 2; trafficking protein particle complex protein 2
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 X 31,617,107 - 31,647,035 (-) NCBI GRCr8 mRatBN7.2 X 28,004,051 - 28,015,336 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl X 27,994,054 - 28,015,346 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx X 29,038,597 - 29,049,838 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 X 32,473,731 - 32,484,938 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 X 28,653,239 - 28,664,478 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 X 29,550,871 - 29,562,135 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl X 29,550,873 - 29,556,610 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 X 29,944,161 - 29,955,426 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 X 48,690,381 - 48,701,588 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 X 48,743,851 - 48,755,057 (-) NCBI Celera X 28,376,813 - 28,388,017 (-) NCBI Celera Cytogenetic Map X q13 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Trappc2 Rat (1->4)-beta-D-glucan multiple interactions ISO RGD:1558022 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of TRAPPC2 mRNA CTD PMID:36331819 Trappc2 Rat 1,2-dimethylhydrazine decreases expression ISO RGD:1558022 6480464 1,2-Dimethylhydrazine results in decreased expression of TRAPPC2 mRNA CTD PMID:22206623 Trappc2 Rat 2,3',4,4',5-Pentachlorobiphenyl increases expression ISO RGD:1558022 6480464 2,3',4,4',5-pentachlorobiphenyl results in increased expression of TRAPPC2 mRNA CTD PMID:31388691 Trappc2 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO RGD:1558022 6480464 Tetrachlorodibenzodioxin affects the expression of TRAPPC2 mRNA CTD PMID:21570461|PMID:24680724 Trappc2 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of TRAPPC2 mRNA CTD PMID:33387578 Trappc2 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO RGD:1558022 6480464 [TIPARP gene mutant form results in increased susceptibility to Tetrachlorodibenzodioxin] which results in decreased expression more ... CTD PMID:25975270 Trappc2 Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO RGD:1350228 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] more ... CTD PMID:28628672 Trappc2 Rat 4,4'-diaminodiphenylmethane decreases expression ISO RGD:1558022 6480464 4,4'-diaminodiphenylmethane results in decreased expression of TRAPPC2 mRNA CTD PMID:18648102 Trappc2 Rat 4,4'-sulfonyldiphenol multiple interactions ISO RGD:1350228 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] more ... CTD PMID:28628672 Trappc2 Rat aristolochic acid A decreases expression ISO RGD:1350228 6480464 aristolochic acid I results in decreased expression of TRAPPC2 mRNA CTD PMID:33212167 Trappc2 Rat benzo[a]pyrene increases expression ISO RGD:1558022 6480464 Benzo(a)pyrene results in increased expression of TRAPPC2 mRNA CTD PMID:22228805 Trappc2 Rat benzo[a]pyrene affects methylation ISO RGD:1350228 6480464 Benzo(a)pyrene affects the methylation of TRAPPC2 5' UTR CTD PMID:27901495 Trappc2 Rat bis(2-ethylhexyl) phthalate increases expression ISO RGD:1558022 6480464 Diethylhexyl Phthalate results in increased expression of TRAPPC2 mRNA CTD PMID:33754040 Trappc2 Rat bisphenol F multiple interactions ISO RGD:1350228 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] more ... CTD PMID:28628672 Trappc2 Rat copper(II) sulfate increases expression ISO RGD:1350228 6480464 Copper Sulfate results in increased expression of TRAPPC2 mRNA CTD PMID:19549813 Trappc2 Rat corosolic acid increases expression ISO RGD:1350228 6480464 corosolic acid results in increased expression of TRAPPC2 mRNA CTD PMID:37939859 Trappc2 Rat coumestrol decreases expression ISO RGD:1350228 6480464 Coumestrol results in decreased expression of TRAPPC2 mRNA CTD PMID:19167446 Trappc2 Rat dexamethasone multiple interactions ISO RGD:1350228 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] more ... CTD PMID:28628672 Trappc2 Rat Dibutyl phosphate affects expression ISO RGD:1350228 6480464 di-n-butylphosphoric acid affects the expression of TRAPPC2 mRNA CTD PMID:37042841 Trappc2 Rat diethylstilbestrol increases expression ISO RGD:1350228 6480464 Diethylstilbestrol results in increased expression of TRAPPC2 mRNA CTD PMID:36621641 Trappc2 Rat epoxiconazole increases expression ISO RGD:1558022 6480464 epoxiconazole results in increased expression of TRAPPC2 mRNA CTD PMID:35436446 Trappc2 Rat ethanol increases expression ISO RGD:1558022 6480464 Ethanol results in increased expression of TRAPPC2 mRNA CTD PMID:30319688 Trappc2 Rat ethyl methanesulfonate increases expression ISO RGD:1350228 6480464 Ethyl Methanesulfonate results in increased expression of TRAPPC2 mRNA CTD PMID:23649840 Trappc2 Rat folic acid decreases expression ISO RGD:1558022 6480464 Folic Acid results in decreased expression of TRAPPC2 mRNA CTD PMID:25629700 Trappc2 Rat furan increases methylation EXP 6480464 furan results in increased methylation of TRAPPC2 gene CTD PMID:22079235 Trappc2 Rat gentamycin decreases expression EXP 6480464 Gentamicins results in decreased expression of TRAPPC2 mRNA CTD PMID:33387578 Trappc2 Rat indole-3-methanol affects expression EXP 6480464 indole-3-carbinol affects the expression of TRAPPC2 mRNA CTD PMID:21396975 Trappc2 Rat indometacin multiple interactions ISO RGD:1350228 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] more ... CTD PMID:28628672 Trappc2 Rat methyl methanesulfonate increases expression ISO RGD:1350228 6480464 Methyl Methanesulfonate results in increased expression of TRAPPC2 mRNA CTD PMID:23649840 Trappc2 Rat nitrates multiple interactions ISO RGD:1558022 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of TRAPPC2 more ... CTD PMID:35964746 Trappc2 Rat paracetamol affects expression ISO RGD:1558022 6480464 Acetaminophen affects the expression of TRAPPC2 mRNA CTD PMID:17562736 Trappc2 Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of TRAPPC2 mRNA CTD PMID:33387578 Trappc2 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO RGD:1558022 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of TRAPPC2 mRNA CTD PMID:36331819 Trappc2 Rat quercetin increases expression ISO RGD:1350228 6480464 Quercetin results in increased expression of TRAPPC2 mRNA CTD PMID:21632981 Trappc2 Rat sodium arsenite decreases expression ISO RGD:1350228 6480464 sodium arsenite results in decreased expression of TRAPPC2 mRNA CTD PMID:22714537|PMID:29301061|PMID:38568856 Trappc2 Rat thioacetamide decreases expression EXP 6480464 Thioacetamide results in decreased expression of TRAPPC2 mRNA CTD PMID:34492290 Trappc2 Rat titanium dioxide decreases expression ISO RGD:1558022 6480464 titanium dioxide results in decreased expression of TRAPPC2 mRNA CTD PMID:29264374 Trappc2 Rat trichloroethene decreases expression EXP 6480464 Trichloroethylene results in decreased expression of TRAPPC2 mRNA CTD PMID:33387578 Trappc2 Rat Triptolide increases expression ISO RGD:1558022 6480464 triptolide results in increased expression of TRAPPC2 mRNA CTD PMID:32835833 Trappc2 Rat Triptolide increases expression EXP 6480464 triptolide results in increased expression of TRAPPC2 protein CTD PMID:32519852 Trappc2 Rat triptonide increases expression ISO RGD:1558022 6480464 triptonide results in increased expression of TRAPPC2 mRNA CTD PMID:33045310 Trappc2 Rat tungsten increases expression ISO RGD:1558022 6480464 Tungsten results in increased expression of TRAPPC2 mRNA CTD PMID:30912803 Trappc2 Rat valproic acid increases expression ISO RGD:1350228 6480464 Valproic Acid results in increased expression of TRAPPC2 mRNA CTD PMID:23179753 Trappc2 Rat valproic acid affects splicing EXP 6480464 Valproic Acid affects the splicing of TRAPPC2 mRNA CTD PMID:29427782 Trappc2 Rat valproic acid affects expression ISO RGD:1558022 6480464 Valproic Acid affects the expression of TRAPPC2 mRNA CTD PMID:17963808 Trappc2 Rat valproic acid decreases methylation ISO RGD:1350228 6480464 Valproic Acid results in decreased methylation of TRAPPC2 gene CTD PMID:29154799 Trappc2 Rat vinclozolin increases expression EXP 6480464 vinclozolin results in increased expression of TRAPPC2 mRNA CTD PMID:23869203
(1->4)-beta-D-glucan (ISO) 1,2-dimethylhydrazine (ISO) 2,3',4,4',5-Pentachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 3-isobutyl-1-methyl-7H-xanthine (ISO) 4,4'-diaminodiphenylmethane (ISO) 4,4'-sulfonyldiphenol (ISO) aristolochic acid A (ISO) benzo[a]pyrene (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol F (ISO) copper(II) sulfate (ISO) corosolic acid (ISO) coumestrol (ISO) dexamethasone (ISO) Dibutyl phosphate (ISO) diethylstilbestrol (ISO) epoxiconazole (ISO) ethanol (ISO) ethyl methanesulfonate (ISO) folic acid (ISO) furan (EXP) gentamycin (EXP) indole-3-methanol (EXP) indometacin (ISO) methyl methanesulfonate (ISO) nitrates (ISO) paracetamol (EXP,ISO) perfluorooctane-1-sulfonic acid (ISO) quercetin (ISO) sodium arsenite (ISO) thioacetamide (EXP) titanium dioxide (ISO) trichloroethene (EXP) Triptolide (EXP,ISO) triptonide (ISO) tungsten (ISO) valproic acid (EXP,ISO) vinclozolin (EXP)
Trappc2 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 X 31,617,107 - 31,647,035 (-) NCBI GRCr8 mRatBN7.2 X 28,004,051 - 28,015,336 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl X 27,994,054 - 28,015,346 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx X 29,038,597 - 29,049,838 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 X 32,473,731 - 32,484,938 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 X 28,653,239 - 28,664,478 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 X 29,550,871 - 29,562,135 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl X 29,550,873 - 29,556,610 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 X 29,944,161 - 29,955,426 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 X 48,690,381 - 48,701,588 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 X 48,743,851 - 48,755,057 (-) NCBI Celera X 28,376,813 - 28,388,017 (-) NCBI Celera Cytogenetic Map X q13 NCBI
TRAPPC2 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 X 13,712,245 - 13,734,620 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl X 13,712,244 - 13,734,635 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 X 13,730,364 - 13,752,739 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 X 13,640,282 - 13,662,648 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 X 13,490,017 - 13,512,384 NCBI Celera X 17,847,442 - 17,869,835 (-) NCBI Celera Cytogenetic Map X p22.2 NCBI HuRef X 11,488,878 - 11,510,859 (-) NCBI HuRef CHM1_1 X 13,761,181 - 13,783,572 (-) NCBI CHM1_1 T2T-CHM13v2.0 X 13,293,643 - 13,316,052 (-) NCBI T2T-CHM13v2.0
Trappc2 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 X 165,223,747 - 165,236,136 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl X 165,223,570 - 165,236,136 (+) Ensembl GRCm39 Ensembl GRCm38 X 166,440,702 - 166,453,140 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl X 166,440,574 - 166,453,140 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 X 162,878,757 - 162,890,475 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 X 161,784,906 - 161,797,243 (+) NCBI MGSCv36 mm8 Celera X 149,620,616 - 149,632,365 (+) NCBI Celera Cytogenetic Map X F5 NCBI cM Map X 77.43 NCBI
Trappc2 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 NW_004955519 4,470,906 - 4,485,969 (+) NCBI ChiLan1.0 ChiLan1.0
TRAPPC2 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 X 15,491,829 - 15,513,861 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 X 15,495,495 - 15,517,527 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 X 6,321,264 - 6,341,650 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 X 13,609,852 - 13,629,926 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl X 13,609,852 - 13,629,916 (-) Ensembl panpan1.1 panPan2
LOC480840 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 X 10,128,169 - 10,140,386 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl X 10,128,849 - 10,140,351 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha X 10,104,804 - 10,108,924 (-) NCBI Dog10K_Boxer_Tasha
Trappc2
TRAPPC2 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl X 10,353,419 - 10,366,106 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 X 10,353,417 - 10,366,095 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 X 11,307,155 - 11,319,835 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
TRAPPC2 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 X 12,206,192 - 12,222,303 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl X 12,206,289 - 12,211,834 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666056 14,020,889 - 14,039,703 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Trappc2
.
Predicted Target Of
Count of predictions: 941 Count of miRNA genes: 322 Interacting mature miRNAs: 431 Transcripts: ENSRNOT00000006006, ENSRNOT00000068113, ENSRNOT00000073738 Prediction methods: Microtar, Miranda, Pita, Rnahybrid, Targetscan Result types: miRGate_prediction
1598873 Memor2 Memory QTL 2 2.5 exploratory behavior trait (VT:0010471) average horizontal distance between subject and target during voluntary locomotion in an experimental apparatus (CMO:0002674) X 20990947 41052531 Rat 70165 Bp64 Blood pressure QTL 64 5.2 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) X 1448129 31706553 Rat 1298071 Edpm12 Estrogen-dependent pituitary mass QTL 12 3.2 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) X 2927898 47927898 Rat 2290375 Gluco34 Glucose level QTL 34 2.75 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) X 20990947 41203591 Rat 731181 Uae27 Urinary albumin excretion QTL 27 2.7 0.0059 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) X 1 43491017 Rat 61430 Cia18 Collagen induced arthritis QTL 18 3.1 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) X 14843113 120568734 Rat 10755455 Coatc13 Coat color QTL 13 0 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 7 4406000 49406000 Rat 631666 Iddm5 Insulin dependent diabetes mellitus QTL 5 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) X 4494549 49494549 Rat 71116 Niddm16 Non-insulin dependent diabetes mellitus QTL 16 7.81 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) X 15297802 60297802 Rat
RH128656
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 X 28,004,243 - 28,004,452 (+) MAPPER mRatBN7.2 Rnor_6.0 X 29,551,064 - 29,551,272 NCBI Rnor6.0 Rnor_5.0 X 29,944,357 - 29,944,565 UniSTS Rnor5.0 RGSC_v3.4 X 48,690,574 - 48,690,782 UniSTS RGSC3.4 Celera X 28,377,006 - 28,377,214 UniSTS RH 3.4 Map X 360.3 UniSTS Cytogenetic Map X q21 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000068113 ⟹ ENSRNOP00000062350
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl X 28,004,054 - 28,015,346 (-) Ensembl Rnor_6.0 Ensembl X 29,550,873 - 29,556,610 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000102365 ⟹ ENSRNOP00000086382
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl X 27,994,054 - 28,015,299 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000102526 ⟹ ENSRNOP00000090564
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl X 28,005,063 - 28,015,346 (-) Ensembl
RefSeq Acc Id:
NM_001024965 ⟹ NP_001020136
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 X 31,635,704 - 31,646,913 (-) NCBI mRatBN7.2 X 28,004,051 - 28,015,260 (-) NCBI Rnor_6.0 X 29,550,871 - 29,562,078 (-) NCBI Rnor_5.0 X 29,944,161 - 29,955,426 (-) NCBI RGSC_v3.4 X 48,690,381 - 48,701,588 (-) RGD Celera X 28,376,813 - 28,388,017 (-) RGD
Sequence:
CGCAGGTTCGCGAGGAAACACATTCCAGATTTCTTTGGATGTCATTGATTTTCCTGTGAATCAGCAGAAGACCTAGAGGGGCTTGGAGCTACATATTGAAGACAATGTCTGGAAGCTTCTACTTTGTA
hide sequence
RefSeq Acc Id:
XM_063280240 ⟹ XP_063136310
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 X 31,635,704 - 31,647,035 (-) NCBI
RefSeq Acc Id:
XM_063280241 ⟹ XP_063136311
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 X 31,635,704 - 31,646,989 (-) NCBI
RefSeq Acc Id:
XR_010061223
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 X 31,617,107 - 31,647,035 (-) NCBI
RefSeq Acc Id:
NP_001020136 ⟸ NM_001024965
- UniProtKB:
Q5BJL8 (UniProtKB/TrEMBL), A6K2H9 (UniProtKB/TrEMBL), A6K2I0 (UniProtKB/TrEMBL)
- Sequence:
MSGSFYFVIVGHHDNPVFEMEFLPPGKAESKDDHRHLNQFIAHAALDLVDENMWLSNNMYLKTVDKFNEWFVSAFVTAGHMRFIMLHDVRQEDGIKNFFTDVYDLYIKFAMNPFYEPNSPIRSSAFDR
hide sequence
Ensembl Acc Id:
ENSRNOP00000062350 ⟸ ENSRNOT00000068113
Ensembl Acc Id:
ENSRNOP00000090564 ⟸ ENSRNOT00000102526
Ensembl Acc Id:
ENSRNOP00000086382 ⟸ ENSRNOT00000102365
RefSeq Acc Id:
XP_063136310 ⟸ XM_063280240
- Peptide Label:
isoform X1
- UniProtKB:
A6K2H9 (UniProtKB/TrEMBL), A6K2I0 (UniProtKB/TrEMBL), Q5BJL8 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063136311 ⟸ XM_063280241
- Peptide Label:
isoform X1
- UniProtKB:
A6K2H9 (UniProtKB/TrEMBL), A6K2I0 (UniProtKB/TrEMBL), Q5BJL8 (UniProtKB/TrEMBL)
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2021-02-18
Trappc2
trafficking protein particle complex subunit 2
Trappc2
trafficking protein particle complex 2
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-03-07
Trappc2
trafficking protein particle complex 2
RGD1306925
similar to RIKEN cDNA 0610009B22
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2005-12-06
RGD1306925
similar to RIKEN cDNA 0610009B22
RGD1306925_predicted
similar to RIKEN cDNA 0610009B22 (predicted)
Symbol and Name updated
1559027 APPROVED
2005-01-20
RGD1306925_predicted
similar to RIKEN cDNA 0610009B22 (predicted)
LOC287274_predicted
Symbol and Name status set to approved
1331353 APPROVED
2005-01-12
LOC287274_predicted
similar to RIKEN cDNA 0610009B22 (predicted)
Symbol and Name status set to provisional
70820 PROVISIONAL
