Symbol:
Grap
Name:
GRB2-related adaptor protein
RGD ID:
1306884
Description:
Predicted to enable epidermal growth factor receptor binding activity and phosphotyrosine residue binding activity. Predicted to be involved in regulation of MAPK cascade; sensory perception of sound; and signal transduction. Predicted to be part of COP9 signalosome. Predicted to be active in cytoplasm; nucleoplasm; and plasma membrane. Human ortholog(s) of this gene implicated in autosomal recessive nonsyndromic deafness 114. Orthologous to human GRAP (GRB2 related adaptor protein); INTERACTS WITH 17beta-estradiol; 17beta-estradiol 3-benzoate; 2,3,7,8-tetrachlorodibenzodioxine.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
GRB2-related adapter protein; LOC363616; MGC112733
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
GRAP (GRB2 related adaptor protein)
HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, OMA, OrthoDB, OrthoMCL, PhylomeDB, Treefam
Mus musculus (house mouse):
Grap (GRB2-related adaptor protein)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Grap (GRB2 related adaptor protein)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
GRAP (GRB2 related adaptor protein)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
GRAP (GRB2 related adaptor protein)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Grap (GRB2 related adaptor protein)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
GRAP (GRB2 related adaptor protein)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
GRAP (GRB2 related adaptor protein)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Grap (GRB2 related adaptor protein)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
GRAPL (GRB2 related adaptor protein like)
HGNC
Ensembl, PhylomeDB, Treefam
Alliance orthologs 3
Mus musculus (house mouse):
Grap (GRB2-related adaptor protein)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
GRAP (GRB2 related adaptor protein)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
grapb (GRB2 related adaptor protein b)
Alliance
DIOPT (Ensembl Compara|Hieranoid|OMA|OrthoFinder|PANTHER|PhylomeDB)
Danio rerio (zebrafish):
grapa (GRB2 related adaptor protein a)
Alliance
DIOPT (Ensembl Compara|Hieranoid|OMA|OrthoFinder|PANTHER)
Drosophila melanogaster (fruit fly):
drk
Alliance
DIOPT (Hieranoid|OrthoFinder|PANTHER)
Caenorhabditis elegans (roundworm):
sem-5
Alliance
DIOPT (Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
grap
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 10 46,798,423 - 46,851,524 (+) NCBI GRCr8 mRatBN7.2 10 46,298,965 - 46,352,057 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 10 46,332,909 - 46,352,056 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 10 51,036,400 - 51,055,558 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 10 50,526,935 - 50,546,093 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 10 46,030,344 - 46,049,504 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 10 47,930,633 - 47,949,774 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 10 47,930,633 - 47,949,773 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 10 47,723,737 - 47,742,916 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 10 47,812,362 - 47,831,473 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 10 47,825,984 - 47,845,096 (+) NCBI Celera 10 45,584,426 - 45,600,140 (+) NCBI Celera Cytogenetic Map 10 q22 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Grap Rat 1,2-dichloroethane decreases expression ISO Grap (Mus musculus) 6480464 ethylene dichloride results in decreased expression of GRAP mRNA CTD PMID:28960355 Grap Rat 1,2-dimethylhydrazine increases expression ISO Grap (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in increased expression of GRAP mRNA CTD PMID:22206623 Grap Rat 17alpha-ethynylestradiol affects expression ISO Grap (Mus musculus) 6480464 Ethinyl Estradiol affects the expression of GRAP mRNA CTD PMID:17555576 Grap Rat 17alpha-ethynylestradiol multiple interactions ISO Grap (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of GRAP mRNA CTD PMID:17942748 Grap Rat 17alpha-ethynylestradiol increases expression ISO Grap (Mus musculus) 6480464 Ethinyl Estradiol results in increased expression of GRAP mRNA CTD PMID:17942748 Grap Rat 17beta-estradiol multiple interactions EXP 6480464 [estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of GRAP mRNA CTD PMID:32741896 Grap Rat 17beta-estradiol decreases expression ISO GRAP (Homo sapiens) 6480464 Estradiol results in decreased expression of GRAP mRNA CTD PMID:31614463 Grap Rat 17beta-estradiol 3-benzoate multiple interactions EXP 6480464 [estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of GRAP mRNA CTD PMID:32741896 Grap Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Grap (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of GRAP mRNA CTD PMID:17942748 Grap Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of GRAP mRNA CTD PMID:33387578 Grap Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of GRAP mRNA CTD PMID:34747641 Grap Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of GRAP mRNA CTD PMID:32109520 Grap Rat 4,4'-sulfonyldiphenol increases expression ISO Grap (Mus musculus) 6480464 bisphenol S results in increased expression of GRAP mRNA CTD PMID:30951980 Grap Rat 4,4'-sulfonyldiphenol decreases methylation ISO Grap (Mus musculus) 6480464 bisphenol S results in decreased methylation of GRAP exon CTD PMID:33297965 Grap Rat alpha-Zearalanol increases expression EXP 6480464 Zeranol results in increased expression of GRAP mRNA CTD PMID:35163327 Grap Rat amphetamine decreases expression EXP 6480464 Amphetamine results in decreased expression of GRAP mRNA CTD PMID:30779732 Grap Rat benzo[a]pyrene decreases expression ISO GRAP (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of GRAP mRNA CTD PMID:32234424 Grap Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of GRAP mRNA CTD PMID:25181051 Grap Rat bisphenol A increases expression ISO Grap (Mus musculus) 6480464 bisphenol A results in increased expression of GRAP mRNA CTD PMID:32156529 Grap Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of GRAP mRNA CTD PMID:34947998 Grap Rat bisphenol F increases expression ISO Grap (Mus musculus) 6480464 bisphenol F results in increased expression of GRAP mRNA CTD PMID:30951980 Grap Rat chlorpyrifos increases expression ISO Grap (Mus musculus) 6480464 Chlorpyrifos results in increased expression of GRAP mRNA CTD PMID:37019170 Grap Rat cobalt dichloride decreases expression ISO GRAP (Homo sapiens) 6480464 cobaltous chloride results in decreased expression of GRAP mRNA CTD PMID:19320972 Grap Rat copper(II) sulfate increases expression ISO GRAP (Homo sapiens) 6480464 Copper Sulfate results in increased expression of GRAP mRNA CTD PMID:19549813 Grap Rat crocidolite asbestos affects expression ISO GRAP (Homo sapiens) 6480464 Asbestos and Crocidolite affects the expression of GRAP mRNA CTD PMID:17331233 Grap Rat Dibutyl phosphate affects expression ISO GRAP (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of GRAP mRNA CTD PMID:37042841 Grap Rat dimethylarsinic acid multiple interactions ISO Grap (Mus musculus) 6480464 [sodium arsenate co-treated with sodium arsenite co-treated with monomethylarsonic acid co-treated with Cacodylic Acid] results in increased expression of GRAP mRNA CTD PMID:34876320 Grap Rat ethylparaben increases expression ISO GRAP (Homo sapiens) 6480464 ethyl-p-hydroxybenzoate results in increased expression of GRAP mRNA CTD PMID:37690743 Grap Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of GRAP mRNA CTD PMID:22061828 Grap Rat hydralazine multiple interactions ISO GRAP (Homo sapiens) 6480464 [Hydralazine co-treated with Valproic Acid] results in increased expression of GRAP mRNA CTD PMID:17183730 Grap Rat methylarsonic acid multiple interactions ISO Grap (Mus musculus) 6480464 [sodium arsenate co-treated with sodium arsenite co-treated with monomethylarsonic acid co-treated with Cacodylic Acid] results in increased expression of GRAP mRNA CTD PMID:34876320 Grap Rat N-Nitrosopyrrolidine decreases expression ISO GRAP (Homo sapiens) 6480464 N-Nitrosopyrrolidine results in decreased expression of GRAP mRNA CTD PMID:32234424 Grap Rat nitrates multiple interactions ISO Grap (Mus musculus) 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of GRAP mRNA CTD PMID:35964746 Grap Rat O-methyleugenol decreases expression ISO GRAP (Homo sapiens) 6480464 methyleugenol results in decreased expression of GRAP mRNA CTD PMID:32234424 Grap Rat ozone multiple interactions ISO Grap (Mus musculus) 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in decreased expression of GRAP mRNA and [Air Pollutants results in increased abundance of Ozone] which results in decreased expression of GRAP mRNA CTD PMID:27106289 and PMID:34911549 Grap Rat paracetamol affects expression ISO Grap (Mus musculus) 6480464 Acetaminophen affects the expression of GRAP mRNA CTD PMID:17562736 Grap Rat paracetamol increases expression ISO GRAP (Homo sapiens) 6480464 Acetaminophen results in increased expression of GRAP mRNA CTD PMID:22230336 Grap Rat pentanal decreases expression ISO GRAP (Homo sapiens) 6480464 pentanal results in decreased expression of GRAP mRNA CTD PMID:26079696 Grap Rat sodium arsenate multiple interactions ISO Grap (Mus musculus) 6480464 [sodium arsenate co-treated with sodium arsenite co-treated with monomethylarsonic acid co-treated with Cacodylic Acid] results in increased expression of GRAP mRNA CTD PMID:34876320 Grap Rat sodium arsenite decreases expression ISO GRAP (Homo sapiens) 6480464 sodium arsenite results in decreased expression of GRAP mRNA CTD PMID:29301061 Grap Rat sodium arsenite multiple interactions ISO Grap (Mus musculus) 6480464 [sodium arsenate co-treated with sodium arsenite co-treated with monomethylarsonic acid co-treated with Cacodylic Acid] results in increased expression of GRAP mRNA CTD PMID:34876320 Grap Rat succimer multiple interactions ISO Grap (Mus musculus) 6480464 [Succimer binds to Magnetite Nanoparticles] which results in increased expression of GRAP mRNA CTD PMID:21641980 Grap Rat tamoxifen affects expression ISO Grap (Mus musculus) 6480464 Tamoxifen affects the expression of GRAP mRNA CTD PMID:17555576 Grap Rat testosterone multiple interactions EXP 6480464 [estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of GRAP mRNA CTD PMID:32741896 Grap Rat tetrachloromethane affects expression ISO Grap (Mus musculus) 6480464 Carbon Tetrachloride affects the expression of GRAP mRNA CTD PMID:17484886 Grap Rat tetrachloromethane decreases expression EXP 6480464 Carbon Tetrachloride results in decreased expression of GRAP mRNA CTD PMID:31150632 Grap Rat titanium dioxide decreases expression ISO Grap (Mus musculus) 6480464 titanium dioxide results in decreased expression of GRAP mRNA CTD PMID:23557971 Grap Rat trichloroethene increases expression EXP 6480464 Trichloroethylene results in increased expression of GRAP mRNA CTD PMID:33387578 Grap Rat triptonide increases expression ISO Grap (Mus musculus) 6480464 triptonide results in increased expression of GRAP mRNA CTD PMID:33045310 Grap Rat urethane decreases expression ISO GRAP (Homo sapiens) 6480464 Urethane results in decreased expression of GRAP mRNA CTD PMID:28818685 Grap Rat valproic acid multiple interactions ISO GRAP (Homo sapiens) 6480464 [Hydralazine co-treated with Valproic Acid] results in increased expression of GRAP mRNA CTD PMID:17183730
1,2-dichloroethane (ISO) 1,2-dimethylhydrazine (ISO) 17alpha-ethynylestradiol (ISO) 17beta-estradiol (EXP,ISO) 17beta-estradiol 3-benzoate (EXP) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 4,4'-sulfonyldiphenol (ISO) alpha-Zearalanol (EXP) amphetamine (EXP) benzo[a]pyrene (ISO) bisphenol A (EXP,ISO) bisphenol F (ISO) chlorpyrifos (ISO) cobalt dichloride (ISO) copper(II) sulfate (ISO) crocidolite asbestos (ISO) Dibutyl phosphate (ISO) dimethylarsinic acid (ISO) ethylparaben (ISO) gentamycin (EXP) hydralazine (ISO) methylarsonic acid (ISO) N-Nitrosopyrrolidine (ISO) nitrates (ISO) O-methyleugenol (ISO) ozone (ISO) paracetamol (ISO) pentanal (ISO) sodium arsenate (ISO) sodium arsenite (ISO) succimer (ISO) tamoxifen (ISO) testosterone (EXP) tetrachloromethane (EXP,ISO) titanium dioxide (ISO) trichloroethene (EXP) triptonide (ISO) urethane (ISO) valproic acid (ISO)
Grap (Rattus norvegicus - Norway rat)
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 10 46,798,423 - 46,851,524 (+) NCBI GRCr8 mRatBN7.2 10 46,298,965 - 46,352,057 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 10 46,332,909 - 46,352,056 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 10 51,036,400 - 51,055,558 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 10 50,526,935 - 50,546,093 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 10 46,030,344 - 46,049,504 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 10 47,930,633 - 47,949,774 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 10 47,930,633 - 47,949,773 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 10 47,723,737 - 47,742,916 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 10 47,812,362 - 47,831,473 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 10 47,825,984 - 47,845,096 (+) NCBI Celera 10 45,584,426 - 45,600,140 (+) NCBI Celera Cytogenetic Map 10 q22 NCBI
GRAP (Homo sapiens - human)
Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 17 19,020,656 - 19,051,373 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 17 19,020,656 - 19,047,011 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 17 18,923,969 - 18,950,270 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 17 18,864,715 - 18,891,061 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 17 18,864,714 - 18,891,061 NCBI Cytogenetic Map 17 p11.2 NCBI HuRef 17 18,491,292 - 18,506,704 (-) NCBI HuRef CHM1_1 17 18,932,781 - 18,959,175 (-) NCBI CHM1_1 T2T-CHM13v2.0 17 18,968,549 - 18,999,272 (-) NCBI T2T-CHM13v2.0
Grap (Mus musculus - house mouse)
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 11 61,544,081 - 61,563,610 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 11 61,544,091 - 61,563,610 (+) Ensembl GRCm39 Ensembl GRCm38 11 61,653,321 - 61,672,777 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 11 61,653,265 - 61,672,784 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 11 61,466,823 - 61,486,279 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 11 61,469,516 - 61,488,972 (+) NCBI MGSCv36 mm8 MGSCv36 11 62,082,523 - 62,101,842 (+) NCBI MGSCv36 mm8 Cytogenetic Map 11 B2 NCBI cM Map 11 37.96 NCBI
Grap (Chinchilla lanigera - long-tailed chinchilla)
Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955467 559,397 - 581,098 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955467 559,411 - 581,098 (+) NCBI ChiLan1.0 ChiLan1.0
GRAP (Pan paniscus - bonobo/pygmy chimpanzee)
Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 19 54,093,058 - 54,126,968 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 17 58,715,285 - 58,749,061 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 17 32,215,214 - 32,219,802 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3
GRAP (Canis lupus familiaris - dog)
Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 5 41,014,193 - 41,038,965 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 5 41,155,506 - 41,180,266 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 5 41,121,811 - 41,146,579 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 5 41,121,357 - 41,146,579 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 5 41,089,789 - 41,114,540 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 5 41,036,839 - 41,061,600 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 5 41,228,988 - 41,253,743 (+) NCBI UU_Cfam_GSD_1.0
Grap (Ictidomys tridecemlineatus - thirteen-lined ground squirrel)
GRAP (Sus scrofa - pig)
Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 12 60,260,981 - 60,281,884 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 12 60,261,560 - 60,281,886 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 12 62,817,467 - 62,974,589 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
GRAP (Chlorocebus sabaeus - green monkey)
Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 16 17,721,294 - 17,747,366 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 16 17,720,269 - 17,747,319 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666059 3,126,665 - 3,153,600 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Grap (Heterocephalus glaber - naked mole-rat)
.
Predicted Target Of
Count of predictions: 140 Count of miRNA genes: 98 Interacting mature miRNAs: 126 Transcripts: ENSRNOT00000003515 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
61441 Btemp1 Thermal response to stress QTL 1 4 body temperature trait (VT:0005535) core body temperature (CMO:0001036) 10 35392457 63642539 Rat 9589136 Insul27 Insulin level QTL 27 10.46 0.001 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 10 11474010 56474010 Rat 152025229 Scl83 Serum cholesterol level QTL 83 4.33 blood cholesterol amount (VT:0000180) 10 35710580 68663659 Rat 1578779 Tcas10 Tongue tumor susceptibility QTL 10 3.12 tongue integrity trait (VT:0010553) number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950) 10 31297439 76297439 Rat 631564 Apr3 Acute phase response QTL 3 3.9 blood interleukin-6 amount (VT:0008595) plasma interleukin-6 level (CMO:0001927) 10 15275955 60275955 Rat 1298069 Bp168 Blood pressure QTL 168 5.5 blood pressure trait (VT:0000183) systolic blood pressure (CMO:0000004) 10 26521957 98003205 Rat 631552 Vetf2 Vascular elastic tissue fragility QTL 2 4.5 0.0002 aorta elastic tissue integrity trait (VT:0010556) artery internal elastic lamina non-tumorous lesion count (CMO:0001913) 10 41142633 86142633 Rat 631554 Bp133 Blood pressure QTL 133 0.005 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 743364 63851208 Rat 631557 Bp136 Blood pressure QTL 136 0.003 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 30632053 75632053 Rat 61325 Aia5 Adjuvant induced arthritis QTL 5 0.01 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 23444813 104060283 Rat 1298078 Stresp5 Stress response QTL 5 2.99 0.00025 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 10 42045676 104670812 Rat 1578761 Stresp21 Stress response QTL 21 3.3 thymus mass (VT:0004954) thymus wet weight (CMO:0000855) 10 6375746 51375746 Rat 2298544 Neuinf9 Neuroinflammation QTL 9 4.6 nervous system integrity trait (VT:0010566) spinal cord complement component 1, q subcomponent, B chain mRNA level (CMO:0002126) 10 5801990 62146030 Rat 61463 Bp12 Blood pressure QTL 12 6.3 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 41333258 86333258 Rat 8694173 Bw149 Body weight QTL 149 4.38 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 10 44441699 89441699 Rat 2300218 Hpcl2 Hepatic cholesterol level QTL 2 liver cholesterol amount (VT:0010498) liver cholesterol level (CMO:0001597) 10 45029650 95600334 Rat 1554317 Bmd4 Bone mineral density QTL 4 9.4 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 10 19816042 99406971 Rat 1598852 Anxrr19 Anxiety related response QTL 19 5.07 body movement coordination trait (VT:0005424) number of rearing movements in an experimental apparatus (CMO:0001752) 10 18167841 63167841 Rat 1581497 Esta1 Estrogen-induced thymic atrophy QTL 1 thymus mass (VT:0004954) thymus wet weight (CMO:0000855) 10 21329805 61345413 Rat 2313095 Bss62 Bone structure and strength QTL 62 1.5 0.0001 tibia size trait (VT:0100001) tibia midshaft cross-sectional area (CMO:0001717) 10 5387014 50387014 Rat 724527 Bp148 Blood pressure QTL 148 0.0001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 28453136 73453136 Rat 1358897 Stresp6 Stress response QTL 6 4.17 0.022 blood norepinephrine amount (VT:0005663) plasma norepinephrine level (CMO:0001010) 10 35392267 64155584 Rat 1331762 Rf40 Renal function QTL 40 3.873 kidney blood vessel physiology trait (VT:0100012) absolute change in renal vascular resistance (CMO:0001900) 10 29299504 64155584 Rat 2300171 Bmd58 Bone mineral density QTL 58 4.9 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 10 26944628 71944628 Rat 61354 Pia10 Pristane induced arthritis QTL 10 0.01 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 23444813 104060283 Rat 2301967 Cm73 Cardiac mass QTL 73 4.55 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 10 14487011 89062041 Rat 2303118 Mamtr7 Mammary tumor resistance QTL 7 0.003 mammary gland integrity trait (VT:0010552) mammary tumor growth rate (CMO:0000344) 10 9658275 104670812 Rat 70188 BpQTLcluster1 Blood pressure QTL cluster 1 4.864 arterial blood pressure trait (VT:2000000) pulse pressure (CMO:0000292) 1 42323132 87323132 Rat 2313104 Bss61 Bone structure and strength QTL 61 0.9 0.0001 tibia area (VT:1000281) tibia midshaft cross-sectional area (CMO:0001717) 10 5387014 50387014 Rat 9590310 Scort19 Serum corticosterone level QTL 19 6.3 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 10 11474010 56474010 Rat 9589030 Epfw9 Epididymal fat weight QTL 9 19.24 0.001 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 10 44441699 89441699 Rat 10402859 Bp381 Blood pressure QTL 381 0.002 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 27606468 72606468 Rat 2316949 Gluco60 Glucose level QTL 60 3.7 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 10 14487011 107057807 Rat 70198 BpQTLcluster9 Blood pressure QTL cluster 9 2.94 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 42323132 87323132 Rat 6893352 Bw100 Body weight QTL 100 0.33 0.6 body mass (VT:0001259) body weight (CMO:0000012) 1 15906665 60906665 Rat 724556 Pur2 Proteinuria QTL 2 5.5 urine protein amount (VT:0005160) urine protein level (CMO:0000591) 10 22427500 90627625 Rat 8662860 Vetf10 Vascular elastic tissue fragility QTL 10 artery integrity trait (VT:0010639) number of ruptures of the internal elastic lamina of the abdominal aorta and iliac arteries (CMO:0002562) 10 6154182 73453136 Rat 2313066 Bss63 Bone structure and strength QTL 63 1.4 0.0001 tibia strength trait (VT:1000284) bone polar moment of inertia (CMO:0001558) 10 5387014 50387014 Rat 2313064 Bmd71 Bone mineral density QTL 71 0.9 0.0001 tibia mineral mass (VT:1000283) compact volumetric bone mineral density (CMO:0001730) 10 5387014 50387014 Rat 70223 Bp57 Blood pressure QTL 57 5 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 1 80676123 Rat 1354587 Kidm21 Kidney mass QTL 21 3.3 kidney mass (VT:0002707) right kidney wet weight (CMO:0000082) 10 15028513 60430477 Rat 6893350 Bw99 Body weight QTL 99 0.87 0.16 body mass (VT:0001259) body weight (CMO:0000012) 1 15906665 60906665 Rat 2317043 Aia7 Adjuvant induced arthritis QTL 7 3.82 joint integrity trait (VT:0010548) left rear ankle joint diameter (CMO:0002149) 10 37565079 82565079 Rat 70224 Eae3 Experimental allergic encephalomyelitis QTL 3 4.1 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046) 10 26521957 61345413 Rat 2317042 Aia20 Adjuvant induced arthritis QTL 20 3.38 joint integrity trait (VT:0010548) right rear ankle joint diameter (CMO:0002150) 10 37565079 82565079 Rat 2313081 Bss64 Bone structure and strength QTL 64 1.3 0.0001 tibia strength trait (VT:1000284) tibia total energy absorbed before break (CMO:0001736) 10 5387014 50387014 Rat 1331791 Cm31 Cardiac mass QTL 31 3.84606 heart mass (VT:0007028) heart wet weight (CMO:0000069) 10 29299504 107211142 Rat 2313087 Bmd80 Bone mineral density QTL 80 3.2 0.0001 tibia mineral mass (VT:1000283) total volumetric bone mineral density (CMO:0001728) 10 19606483 64606483 Rat 1354614 Hpcl1 Hepatic cholesterol level QTL 1 3.3 liver cholesterol amount (VT:0010498) liver cholesterol level (CMO:0001597) 10 35392267 51793994 Rat 631532 Cm50 Cardiac mass QTL 50 6.6 heart mass (VT:0007028) calculated heart weight (CMO:0000073) 10 17907113 51786432 Rat 1576319 Cia29 Collagen induced arthritis QTL 29 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 33973921 78973921 Rat 8552805 Bw145 Body weight QTL 145 2.2 body mass (VT:0001259) change in body weight to body weight ratio (CMO:0002216) 10 41944526 78307017 Rat 631267 Cia20 Collagen induced arthritis QTL 20 3.2 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 23444813 104060283 Rat 1600371 Mcs21 Mammary carcinoma susceptibility QTL 21 3 mammary gland integrity trait (VT:0010552) mammary tumor growth rate (CMO:0000344) 10 28875650 52200160 Rat 1576308 Schws1 Schwannoma susceptibility QTL 1 0.0041 nervous system integrity trait (VT:0010566) percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017) 10 40035094 102359817 Rat 631269 Cia22 Collagen induced arthritis QTL 22 8.9 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 40035094 104060283 Rat 631268 Cia21 Collagen induced arthritis QTL 21 3.1 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 14487011 104060283 Rat 9590268 Scort13 Serum corticosterone level QTL 13 3.26 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 10 11474010 56474010 Rat 1576311 Pia26 Pristane induced arthritis QTL 26 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 31224026 75632053 Rat 631270 Cia23 Collagen induced arthritis QTL 23 3.9 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 40035094 104060283 Rat 7411614 Foco18 Food consumption QTL 18 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 10 44441699 89441699 Rat 61427 Cia16 Collagen induced arthritis QTL 16 3.2 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 6357896 96121100 Rat 6893342 Cm78 Cardiac mass QTL 78 0.1 0.88 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 10 42876766 79813922 Rat 2292441 Bp308 Blood pressure QTL 308 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 27606468 72606468 Rat 2313055 Bw96 Body weight QTL 96 3.6 0.0001 body mass (VT:0001259) body weight (CMO:0000012) 10 19606483 64606483 Rat 631542 Bp82 Blood pressure QTL 82 6.8 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 26521957 98952741 Rat
BF398725
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 10 46,351,825 - 46,352,020 (+) MAPPER mRatBN7.2 Rnor_6.0 10 47,949,543 - 47,949,737 NCBI Rnor6.0 Rnor_5.0 10 47,742,685 - 47,742,879 UniSTS Rnor5.0 RGSC_v3.4 10 47,831,242 - 47,831,436 UniSTS RGSC3.4 Celera 10 45,599,909 - 45,600,103 UniSTS RH 3.4 Map 10 531.09 UniSTS Cytogenetic Map 10 q23 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000003515 ⟹ ENSRNOP00000003515
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 10 46,332,909 - 46,352,056 (+) Ensembl Rnor_6.0 Ensembl 10 47,930,633 - 47,949,773 (+) Ensembl
RefSeq Acc Id:
NM_001025749 ⟹ NP_001020920
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 46,832,383 - 46,851,524 (+) NCBI mRatBN7.2 10 46,332,909 - 46,352,057 (+) NCBI Rnor_6.0 10 47,930,633 - 47,949,774 (+) NCBI Rnor_5.0 10 47,723,737 - 47,742,916 (+) NCBI RGSC_v3.4 10 47,812,362 - 47,831,473 (+) RGD Celera 10 45,584,426 - 45,600,140 (+) RGD
Sequence:
CTCAACTGCAGGAAGCAGGAAGCTGTAGCTGCTGGGTCCTCGGCTGAAGCCCAGGGGCAGTGGGATGGAGTCCGTGGCCCTCTACAACTTCCAGGCCACCGAGAGTGATGAGCTGGCCTTCAACAAGG GGGACACGCTTAAGATCCTAAACATGGACGATGATCAGAATTGGTACAAGGCCGAGCTCCGAGGAGCCGAGGGTTTTGTTCCCAAGAACTACATCCGTGTAAAGCCACACCCGTGGTACTCAGGCAGG ATTTCCCGACAGCTGGCTGAAGAGACTCTGATGAAACGCAACCACCTAGGAGCCTTCCTGATCCGGGAAAGCGAGAGTTCCCCTGGCGAGTTCTCAGTTTCTGTGAACTATGGCGACCAGGTGCAGCA CTTCAAAGTGCTTCGAGAGGCCTCGGGGAAGTACTTCCTGTGGGAGGAGAAGTTCAACTCCCTCAACGAGCTGGTTGACTTCTACCGAACCACCACCATCGCTAAGAGGCGGCAGATCTTCCTGTGTG ATGAGCAGCCGCTGATCAAGCCGCCCCGGGCTTGCTTTGCCCAGGCTCAGTTTGACTTCTCGGCACAGGACCCATCTCAGCTCAGCCTCCGCCGAGGTGACATTGTCGAAATTGTGGAGTGTGAGGAC CCACACTGGTGGCGGGGCCGGGCAGGCGGGCGCCTGGGCTTCTTCCCACGGAGCTATGTGCAACCGGTACACTTGTGACCCCACAAGACCAGAGGAGCGATGCTCTGGGCTCAGATTCTTCACACTAA CCAGGACCGATGTTGGTCACCACCAGGCTGGGAGCAGAGGCTTCTGGCCTGACTGCTTCCCATTGGTCTCTGGGTTTGTGCTATCACCTGCCATTGACAAGGCCCATCCTCTCCAGACTTGAGGACCA ACTGCTAATGGCTTGGGCCCAGCTCAGAAAGTGCTTCCCTTGAGCAGCCATCTGCTGCCCATCTTCCAAAGGCCTTTCAGGTTGTGCAAGTTACTGGGAACTGGCTTAGCCCTGAGCAATGTCAACTT CCATAAGAGTACAAAGTTCCTCCCACTCCAACAGCTTGGGGCCTCCTGGCCTTGCCCACCAGCATTGGAATGAGGTTATATAGAGGTGAATCCTGTTGGAAGAGGCCTGATAGGCATGGAAGCAATGC AGTGGGTCCCTTCCTGTTGGCTACAGGCAGAGCCCAGCTTGGAGGCCTTGGCTATGCAGGTTCAGGAGGAACAGCCAGACAGCTGGCATCAAGTGAATGTACAGTGCAAGGGGGTGGTGCCTGGCCAT GGAGGAATCCTGAGCTGCTGCTACCCAGAGTCAGAGCACCTTCAGATTGGGAATACTGAGTCAGACTTGGCAAGGCCTGGTGGGCTTTGGGGAAGACAGACAGACAGACAGACAGACAGAGAAAGAAA GAGAGACAGAGAGAGAACTTCTGTGGTGAGTCCAGGGCTGTTCTAAGACCCTCCAAGCTATGAGCCTGGCATACCCTAAGCTCCCAACCTGTACCTGCCATATTCAAAATAAAACATTTACCAGTGGA AAAAAAAAAAAAAAAAAAAAAAAA
hide sequence
RefSeq Acc Id:
XM_039086467 ⟹ XP_038942395
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 46,798,426 - 46,851,524 (+) NCBI mRatBN7.2 10 46,298,965 - 46,352,057 (+) NCBI
RefSeq Acc Id:
XM_063269509 ⟹ XP_063125579
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 46,798,423 - 46,851,524 (+) NCBI
RefSeq Acc Id:
NP_001020920 ⟸ NM_001025749
- UniProtKB:
Q4KM68 (UniProtKB/TrEMBL)
- Sequence:
MESVALYNFQATESDELAFNKGDTLKILNMDDDQNWYKAELRGAEGFVPKNYIRVKPHPWYSGRISRQLAEETLMKRNHLGAFLIRESESSPGEFSVSVNYGDQVQHFKVLREASGKYFLWEEKFNSL NELVDFYRTTTIAKRRQIFLCDEQPLIKPPRACFAQAQFDFSAQDPSQLSLRRGDIVEIVECEDPHWWRGRAGGRLGFFPRSYVQPVHL
hide sequence
Ensembl Acc Id:
ENSRNOP00000003515 ⟸ ENSRNOT00000003515
RefSeq Acc Id:
XP_038942395 ⟸ XM_039086467
- Peptide Label:
isoform X2
- UniProtKB:
Q4KM68 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063125579 ⟸ XM_063269509
- Peptide Label:
isoform X1
RGD ID: 13697263
Promoter ID: EPDNEW_R7788
Type: multiple initiation site
Name: Grap_1
Description: GRB2-related adaptor protein
SO ACC ID: SO:0000170
Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ )
Experiment Methods: Single-end sequencing.
Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 10 47,930,657 - 47,930,717 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2005-12-06
Grap
GRB2-related adaptor protein
Grap_predicted
GRB2-related adaptor protein (predicted)
Symbol and Name updated
1559027
APPROVED
2005-01-12
Grap_predicted
GRB2-related adaptor protein (predicted)
Symbol and Name status set to approved
70820
APPROVED