Symbol:
Six4
Name:
SIX homeobox 4
RGD ID:
1306726
Description:
Predicted to enable DNA-binding transcription activator activity, RNA polymerase II-specific and RNA polymerase II cis-regulatory region sequence-specific DNA binding activity. Predicted to be involved in several processes, including positive regulation of morphogenesis of an epithelium; regulation of DNA-templated transcription; and striated muscle cell differentiation. Predicted to act upstream of or within several processes, including embryonic organ morphogenesis; myoblast migration; and thymus development. Predicted to be located in cytoplasm. Predicted to be part of transcription regulator complex. Predicted to be active in nucleus. Orthologous to human SIX4 (SIX homeobox 4); INTERACTS WITH 1,2-dimethylhydrazine; 2,3,7,8-tetrachlorodibenzodioxine; 2,3,7,8-Tetrachlorodibenzofuran.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
homeobox protein SIX4; LOC299138; sine oculis-related homeobox 4 homolog; sine oculis-related homeobox 4 homolog (Drosophila)
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
SIX4 (SIX homeobox 4) HGNC
Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther
Mus musculus (house mouse):
Six4 (sine oculis-related homeobox 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Six4 (SIX homeobox 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
LOC100981746 (homeobox protein SIX4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
SIX4 (SIX homeobox 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Six4 (SIX homeobox 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
SIX4 (SIX homeobox 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
SIX4 (SIX homeobox 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Six4 (SIX homeobox 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
VN1R4 (vomeronasal 1 receptor 4) HGNC
OMA
Homo sapiens (human):
VN1R2 (vomeronasal 1 receptor 2) HGNC
OMA
Alliance orthologs 3
Homo sapiens (human):
SIX4 (SIX homeobox 4)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Six4 (sine oculis-related homeobox 4)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
six4b (SIX homeobox 4b)
Alliance
DIOPT (Ensembl Compara|Hieranoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB)
Danio rerio (zebrafish):
six4a (SIX homeobox 4a)
Alliance
DIOPT (Ensembl Compara|InParanoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
Six4
Alliance
DIOPT (Ensembl Compara|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB)
Caenorhabditis elegans (roundworm):
unc-39
Alliance
DIOPT (Ensembl Compara|PANTHER)
Xenopus tropicalis (tropical clawed frog):
six4
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 6 97,538,202 - 97,551,872 (-) NCBI GRCr8 mRatBN7.2 6 91,802,328 - 91,816,002 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 6 91,802,329 - 91,815,992 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 6 92,192,313 - 92,205,976 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 6 92,491,810 - 92,505,473 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 6 91,919,712 - 91,933,375 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 6 95,984,868 - 95,999,709 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 6 95,984,868 - 95,998,529 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 6 105,420,180 - 105,433,894 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 6 95,526,293 - 95,539,953 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 6 95,533,549 - 95,543,176 (-) NCBI Celera 6 90,265,300 - 90,278,960 (-) NCBI Celera Cytogenetic Map 6 q24 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Six4 Rat (-)-epigallocatechin 3-gallate multiple interactions ISO SIX4 (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in increased expression of SIX4 mRNA CTD PMID:22079256 Six4 Rat 1,1-dichloroethene decreases expression ISO Six4 (Mus musculus) 6480464 vinylidene chloride results in decreased expression of SIX4 mRNA CTD PMID:26682919 Six4 Rat 1,2-dimethylhydrazine multiple interactions EXP 6480464 [APC protein affects the susceptibility to 1 and 2-Dimethylhydrazine] which results in decreased expression of SIX4 mRNA CTD PMID:27840820 Six4 Rat 2,2',4,4',5,5'-hexachlorobiphenyl affects expression ISO SIX4 (Homo sapiens) 6480464 2 more ... CTD PMID:20638727 Six4 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Six4 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of SIX4 mRNA CTD PMID:24058054 Six4 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of SIX4 mRNA CTD PMID:33387578 Six4 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of SIX4 mRNA CTD PMID:32109520 Six4 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Six4 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of SIX4 mRNA CTD PMID:37172768 Six4 Rat 2,3,7,8-Tetrachlorodibenzofuran increases expression EXP 6480464 2 more ... CTD PMID:32109520 Six4 Rat 3,4-methylenedioxymethamphetamine decreases expression ISO Six4 (Mus musculus) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in decreased expression of SIX4 mRNA CTD PMID:20188158 Six4 Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of SIX4 mRNA CTD PMID:30047161 and PMID:33150595 Six4 Rat 6-propyl-2-thiouracil increases methylation EXP 6480464 Propylthiouracil results in increased methylation of SIX4 promoter CTD PMID:33150595 Six4 Rat acrolein decreases expression EXP 6480464 Acrolein results in decreased expression of SIX4 mRNA CTD PMID:38090360 Six4 Rat acrylamide increases expression ISO SIX4 (Homo sapiens) 6480464 Acrylamide results in increased expression of SIX4 mRNA CTD PMID:32763439 Six4 Rat alpha-Zearalanol multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of SIX4 mRNA CTD PMID:35163327 Six4 Rat alpha-Zearalanol decreases expression EXP 6480464 Zeranol results in decreased expression of SIX4 mRNA CTD PMID:35163327 Six4 Rat amitrole decreases expression EXP 6480464 Amitrole results in decreased expression of SIX4 mRNA CTD PMID:30047161 Six4 Rat antirheumatic drug increases expression ISO SIX4 (Homo sapiens) 6480464 Antirheumatic Agents results in increased expression of SIX4 mRNA CTD PMID:24449571 Six4 Rat arsane multiple interactions ISO SIX4 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of SIX4 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of SIX4 mRNA CTD PMID:39836092 Six4 Rat arsenic atom multiple interactions ISO SIX4 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of SIX4 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of SIX4 mRNA CTD PMID:39836092 Six4 Rat arsenite(3-) multiple interactions ISO SIX4 (Homo sapiens) 6480464 arsenite inhibits the reaction [G3BP1 protein binds to SIX4 mRNA] CTD PMID:32406909 Six4 Rat bis(2-chloroethyl) sulfide increases expression ISO Six4 (Mus musculus) 6480464 Mustard Gas results in increased expression of SIX4 mRNA CTD PMID:15674843 Six4 Rat bis(2-ethylhexyl) phthalate multiple interactions ISO Six4 (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of SIX4 mRNA CTD PMID:39150890 Six4 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of SIX4 mRNA CTD PMID:25181051 Six4 Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of SIX4 gene CTD PMID:28505145 Six4 Rat bisphenol A affects methylation ISO Six4 (Mus musculus) 6480464 bisphenol A affects the methylation of SIX4 promoter CTD PMID:27334623 Six4 Rat bisphenol F decreases expression ISO Six4 (Mus musculus) 6480464 bisphenol F results in decreased expression of SIX4 mRNA CTD PMID:38685157 Six4 Rat Butylbenzyl phthalate multiple interactions ISO Six4 (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of SIX4 mRNA CTD PMID:39150890 Six4 Rat caffeine increases phosphorylation ISO SIX4 (Homo sapiens) 6480464 Caffeine results in increased phosphorylation of SIX4 protein CTD PMID:35688186 Six4 Rat carbamazepine affects expression ISO SIX4 (Homo sapiens) 6480464 Carbamazepine affects the expression of SIX4 mRNA CTD PMID:25979313 Six4 Rat carbon nanotube decreases expression ISO Six4 (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 Six4 Rat CGP 52608 multiple interactions ISO SIX4 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to SIX4 gene] CTD PMID:28238834 Six4 Rat chloroprene increases expression ISO Six4 (Mus musculus) 6480464 Chloroprene results in increased expression of SIX4 mRNA CTD PMID:23125180 Six4 Rat choline multiple interactions ISO Six4 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation of SIX4 gene CTD PMID:20938992 Six4 Rat chromium(6+) increases expression ISO SIX4 (Homo sapiens) 6480464 chromium hexavalent ion results in increased expression of SIX4 mRNA CTD PMID:30690063 Six4 Rat cisplatin multiple interactions ISO SIX4 (Homo sapiens) 6480464 [Cisplatin co-treated with jinfukang] results in decreased expression of SIX4 mRNA CTD PMID:27392435 Six4 Rat clofibrate decreases expression ISO Six4 (Mus musculus) 6480464 Clofibrate results in decreased expression of SIX4 mRNA CTD PMID:17585979 Six4 Rat coumarin affects phosphorylation ISO SIX4 (Homo sapiens) 6480464 coumarin affects the phosphorylation of SIX4 protein CTD PMID:35688186 Six4 Rat dibutyl phthalate multiple interactions ISO Six4 (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of SIX4 mRNA CTD PMID:39150890 Six4 Rat diethyl maleate increases expression ISO Six4 (Mus musculus) 6480464 diethyl maleate results in increased expression of SIX4 mRNA CTD PMID:25270620 Six4 Rat diethyl phthalate multiple interactions ISO Six4 (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of SIX4 mRNA CTD PMID:39150890 Six4 Rat diisobutyl phthalate multiple interactions ISO Six4 (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of SIX4 mRNA CTD PMID:39150890 Six4 Rat diisononyl phthalate multiple interactions ISO Six4 (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of SIX4 mRNA CTD PMID:39150890 Six4 Rat diuron decreases expression ISO SIX4 (Homo sapiens) 6480464 Diuron results in decreased expression of SIX4 mRNA CTD PMID:35967413 Six4 Rat doxorubicin decreases expression ISO SIX4 (Homo sapiens) 6480464 Doxorubicin results in decreased expression of SIX4 mRNA CTD PMID:29803840 Six4 Rat enzyme inhibitor multiple interactions ISO SIX4 (Homo sapiens) 6480464 [Enzyme Inhibitors results in decreased activity of OGA protein] which results in increased O-linked glycosylation of SIX4 protein CTD PMID:23301498 Six4 Rat fenvalerate increases expression EXP 6480464 fenvalerate results in increased expression of SIX4 mRNA CTD PMID:30307764 Six4 Rat folic acid multiple interactions ISO Six4 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation of SIX4 gene CTD PMID:20938992 Six4 Rat FR900359 increases phosphorylation ISO SIX4 (Homo sapiens) 6480464 FR900359 results in increased phosphorylation of SIX4 protein CTD PMID:37730182 Six4 Rat genistein increases expression ISO Six4 (Mus musculus) 6480464 Genistein results in increased expression of SIX4 mRNA CTD PMID:32186404 Six4 Rat glycidol increases methylation EXP 6480464 glycidol results in increased methylation of SIX4 promoter CTD PMID:33150595 Six4 Rat glycidol decreases expression EXP 6480464 glycidol results in decreased expression of SIX4 mRNA CTD PMID:33150645 Six4 Rat isoprenaline increases expression ISO Six4 (Mus musculus) 6480464 Isoproterenol results in increased expression of SIX4 mRNA CTD PMID:20003209 Six4 Rat L-methionine multiple interactions ISO Six4 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation of SIX4 gene CTD PMID:20938992 Six4 Rat leflunomide increases expression ISO SIX4 (Homo sapiens) 6480464 leflunomide results in increased expression of SIX4 mRNA CTD PMID:28988120 Six4 Rat lipopolysaccharide increases expression ISO SIX4 (Homo sapiens) 6480464 Lipopolysaccharides results in increased expression of SIX4 mRNA CTD PMID:35811015 Six4 Rat lipopolysaccharide multiple interactions ISO SIX4 (Homo sapiens) 6480464 [S-(1 more ... CTD PMID:35811015 Six4 Rat manganese atom multiple interactions ISO SIX4 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of SIX4 mRNA and [manganese chloride results in increased abundance of Manganese] which results in increased expression of SIX4 mRNA CTD PMID:39836092 Six4 Rat manganese(0) multiple interactions ISO SIX4 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of SIX4 mRNA and [manganese chloride results in increased abundance of Manganese] which results in increased expression of SIX4 mRNA CTD PMID:39836092 Six4 Rat manganese(II) chloride multiple interactions ISO SIX4 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of SIX4 mRNA and [manganese chloride results in increased abundance of Manganese] which results in increased expression of SIX4 mRNA CTD PMID:39836092 Six4 Rat methamphetamine multiple interactions EXP 6480464 [Methamphetamine co-treated with SCH 23390] results in decreased expression of SIX4 mRNA CTD PMID:19564919 Six4 Rat methamphetamine decreases expression EXP 6480464 Methamphetamine results in decreased expression of SIX4 mRNA CTD PMID:19564919 Six4 Rat methimazole decreases expression EXP 6480464 Methimazole results in decreased expression of SIX4 mRNA CTD PMID:30047161 Six4 Rat methylisothiazolinone increases expression ISO SIX4 (Homo sapiens) 6480464 2-methyl-4-isothiazolin-3-one results in increased expression of SIX4 mRNA CTD PMID:31629900 Six4 Rat perfluorooctanoic acid multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of SIX4 mRNA CTD PMID:35163327 Six4 Rat phenobarbital increases expression ISO Six4 (Mus musculus) 6480464 Phenobarbital results in increased expression of SIX4 mRNA CTD PMID:25270620 Six4 Rat potassium chromate multiple interactions ISO SIX4 (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in increased expression of SIX4 mRNA CTD PMID:22079256 Six4 Rat potassium chromate increases expression ISO SIX4 (Homo sapiens) 6480464 potassium chromate(VI) results in increased expression of SIX4 mRNA CTD PMID:22079256 and PMID:22714537 Six4 Rat resveratrol multiple interactions ISO SIX4 (Homo sapiens) 6480464 [Plant Extracts co-treated with Resveratrol] results in decreased expression of SIX4 mRNA CTD PMID:23557933 Six4 Rat S-(1,2-dichlorovinyl)-L-cysteine multiple interactions ISO SIX4 (Homo sapiens) 6480464 [S-(1 more ... CTD PMID:35811015 Six4 Rat SCH 23390 decreases expression EXP 6480464 SCH 23390 results in decreased expression of SIX4 mRNA CTD PMID:19564919 Six4 Rat SCH 23390 multiple interactions EXP 6480464 [Methamphetamine co-treated with SCH 23390] results in decreased expression of SIX4 mRNA CTD PMID:19564919 Six4 Rat sodium arsenate increases expression ISO Six4 (Mus musculus) 6480464 sodium arsenate results in increased expression of SIX4 mRNA CTD PMID:21795629 Six4 Rat sodium arsenite affects methylation ISO SIX4 (Homo sapiens) 6480464 sodium arsenite affects the methylation of SIX4 gene CTD PMID:28589171 Six4 Rat sodium arsenite decreases expression ISO Six4 (Mus musculus) 6480464 sodium arsenite results in decreased expression of SIX4 mRNA CTD PMID:36209798 Six4 Rat sodium arsenite multiple interactions ISO SIX4 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of SIX4 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of SIX4 mRNA CTD PMID:39836092 Six4 Rat sodium arsenite increases expression ISO SIX4 (Homo sapiens) 6480464 sodium arsenite results in increased expression of SIX4 mRNA CTD PMID:38568856 Six4 Rat sulfadimethoxine decreases expression EXP 6480464 Sulfadimethoxine results in decreased expression of SIX4 mRNA CTD PMID:30047161 Six4 Rat titanium dioxide decreases expression ISO Six4 (Mus musculus) 6480464 titanium dioxide results in decreased expression of SIX4 mRNA CTD PMID:29264374 Six4 Rat titanium dioxide decreases methylation ISO Six4 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of SIX4 gene CTD PMID:35295148 Six4 Rat titanium dioxide increases expression ISO Six4 (Mus musculus) 6480464 titanium dioxide results in increased expression of SIX4 mRNA CTD PMID:35295148 Six4 Rat tunicamycin decreases expression ISO SIX4 (Homo sapiens) 6480464 Tunicamycin results in decreased expression of SIX4 mRNA CTD PMID:29453283 Six4 Rat urethane increases expression ISO SIX4 (Homo sapiens) 6480464 Urethane results in increased expression of SIX4 mRNA CTD PMID:28818685 Six4 Rat valproic acid decreases expression ISO SIX4 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of SIX4 mRNA CTD PMID:23179753 and PMID:28001369 Six4 Rat valproic acid affects expression ISO SIX4 (Homo sapiens) 6480464 Valproic Acid affects the expression of SIX4 mRNA CTD PMID:25979313 Six4 Rat valproic acid increases methylation EXP 6480464 Valproic Acid results in increased methylation of SIX4 promoter CTD PMID:33150595 Six4 Rat valproic acid decreases expression EXP 6480464 Valproic Acid results in decreased expression of SIX4 mRNA CTD PMID:33150595
(-)-epigallocatechin 3-gallate (ISO) 1,1-dichloroethene (ISO) 1,2-dimethylhydrazine (EXP) 2,2',4,4',5,5'-hexachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,3,7,8-Tetrachlorodibenzofuran (EXP) 3,4-methylenedioxymethamphetamine (ISO) 6-propyl-2-thiouracil (EXP) acrolein (EXP) acrylamide (ISO) alpha-Zearalanol (EXP) amitrole (EXP) antirheumatic drug (ISO) arsane (ISO) arsenic atom (ISO) arsenite(3-) (ISO) bis(2-chloroethyl) sulfide (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol F (ISO) Butylbenzyl phthalate (ISO) caffeine (ISO) carbamazepine (ISO) carbon nanotube (ISO) CGP 52608 (ISO) chloroprene (ISO) choline (ISO) chromium(6+) (ISO) cisplatin (ISO) clofibrate (ISO) coumarin (ISO) dibutyl phthalate (ISO) diethyl maleate (ISO) diethyl phthalate (ISO) diisobutyl phthalate (ISO) diisononyl phthalate (ISO) diuron (ISO) doxorubicin (ISO) enzyme inhibitor (ISO) fenvalerate (EXP) folic acid (ISO) FR900359 (ISO) genistein (ISO) glycidol (EXP) isoprenaline (ISO) L-methionine (ISO) leflunomide (ISO) lipopolysaccharide (ISO) manganese atom (ISO) manganese(0) (ISO) manganese(II) chloride (ISO) methamphetamine (EXP) methimazole (EXP) methylisothiazolinone (ISO) perfluorooctanoic acid (EXP) phenobarbital (ISO) potassium chromate (ISO) resveratrol (ISO) S-(1,2-dichlorovinyl)-L-cysteine (ISO) SCH 23390 (EXP) sodium arsenate (ISO) sodium arsenite (ISO) sulfadimethoxine (EXP) titanium dioxide (ISO) tunicamycin (ISO) urethane (ISO) valproic acid (EXP,ISO)
Six4 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 6 97,538,202 - 97,551,872 (-) NCBI GRCr8 mRatBN7.2 6 91,802,328 - 91,816,002 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 6 91,802,329 - 91,815,992 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 6 92,192,313 - 92,205,976 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 6 92,491,810 - 92,505,473 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 6 91,919,712 - 91,933,375 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 6 95,984,868 - 95,999,709 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 6 95,984,868 - 95,998,529 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 6 105,420,180 - 105,433,894 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 6 95,526,293 - 95,539,953 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 6 95,533,549 - 95,543,176 (-) NCBI Celera 6 90,265,300 - 90,278,960 (-) NCBI Celera Cytogenetic Map 6 q24 NCBI
SIX4 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 14 60,709,539 - 60,724,351 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 14 60,709,539 - 60,724,351 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 14 61,176,257 - 61,191,069 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 14 60,246,009 - 60,260,545 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 14 60,249,877 - 60,260,482 NCBI Celera 14 41,226,507 - 41,241,110 (-) NCBI Celera Cytogenetic Map 14 q23.1 NCBI HuRef 14 41,338,950 - 41,376,872 (-) NCBI HuRef CHM1_1 14 61,115,577 - 61,130,176 (-) NCBI CHM1_1 T2T-CHM13v2.0 14 54,916,015 - 54,930,882 (-) NCBI T2T-CHM13v2.0
Six4 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 12 73,146,383 - 73,160,201 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 12 73,146,383 - 73,160,230 (-) Ensembl GRCm39 Ensembl GRCm38 12 73,099,609 - 73,114,031 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 12 73,099,609 - 73,113,456 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 12 74,201,246 - 74,214,232 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 12 74,019,097 - 74,032,083 (-) NCBI MGSCv36 mm8 Celera 12 74,211,796 - 74,224,743 (-) NCBI Celera Cytogenetic Map 12 C3 NCBI cM Map 12 30.36 NCBI
Six4 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955466 8,902,517 - 8,915,723 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955466 8,902,728 - 8,915,685 (+) NCBI ChiLan1.0 ChiLan1.0
LOC100981746 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 15 61,847,361 - 61,862,181 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 14 61,063,874 - 61,078,684 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 14 41,316,169 - 41,332,160 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 14 59,580,587 - 59,592,654 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 14 59,580,587 - 59,594,014 (-) Ensembl panpan1.1 panPan2
SIX4 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 8 35,735,893 - 35,748,976 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 8 35,737,058 - 35,748,893 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 8 35,489,928 - 35,502,823 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 8 35,969,183 - 35,982,082 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 8 35,970,354 - 35,982,196 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 8 35,581,305 - 35,594,193 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 8 35,658,978 - 35,671,679 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 8 36,020,222 - 36,033,117 (-) NCBI UU_Cfam_GSD_1.0
Six4 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024408640 69,291,248 - 69,302,270 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936495 4,887,718 - 4,900,198 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936495 4,887,718 - 4,900,198 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
SIX4 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 1 189,670,390 - 189,682,577 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 1 189,670,390 - 189,682,378 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 1 210,780,397 - 210,792,387 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
SIX4 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 24 37,899,463 - 37,911,875 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 24 37,900,909 - 37,911,612 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666053 26,152,002 - 26,164,077 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Six4
.
Predicted Target Of
Count of predictions: 550 Count of miRNA genes: 269 Interacting mature miRNAs: 367 Transcripts: ENSRNOT00000050138 Prediction methods: Miranda, Targetscan Result types: miRGate_prediction
1331799 Bp211 Blood pressure QTL 211 3.66407 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 6 72202632 130919985 Rat 634330 Pia16 Pristane induced arthritis QTL 16 3.9 joint integrity trait (VT:0010548) arthritic paw count (CMO:0001460) 6 45790088 104200226 Rat 1331789 Rf37 Renal function QTL 37 3.224 kidney blood vessel physiology trait (VT:0100012) absolute change in renal vascular resistance (CMO:0001900) 6 72202632 115200186 Rat 1331722 Thshl1 Thyroid stimulating hormone level QTL 1 11.7 0.0001 blood thyroid-stimulating hormone amount (VT:0005119) serum thyroid stimulating hormone level (CMO:0001248) 6 89762877 106752806 Rat 4145119 Mcs25 Mammary carcinoma susceptibility QTL 25 0.0001 mammary gland integrity trait (VT:0010552) ratio of deaths to total study population during a period of time (CMO:0001023) 6 10894415 110548006 Rat 70176 Mcsm1 Mammary carcinoma susceptibility modifier QTL 1 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 6 58632962 103632962 Rat 1581563 Uae33 Urinary albumin excretion QTL 33 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 6 72227641 130729205 Rat 10054138 Gmadr3 Adrenal mass QTL 3 3.68 0.00045 adrenal gland mass (VT:0010420) both adrenal glands wet weight (CMO:0000164) 6 85140138 130140138 Rat 1558641 Cm47 Cardiac mass QTL 47 2.9 0.001 heart mass (VT:0007028) heart wet weight (CMO:0000069) 6 57730540 104085867 Rat 724524 Uae2 Urinary albumin excretion QTL 2 2.7 0.0005 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 6 73463459 109394713 Rat 737827 Hcar11 Hepatocarcinoma resistance QTL 11 4.4 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 6 82523650 110548006 Rat 1641904 Alcrsp4 Alcohol response QTL 4 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 6 67262953 112262953 Rat 724513 Uae14 Urinary albumin excretion QTL 14 6.5 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 6 85311061 133478515 Rat 2303624 Vencon5 Ventilatory control QTL 5 4.45 respiration trait (VT:0001943) minute ventilation (CMO:0000132) 6 88047916 133047916 Rat 1576309 Emca7 Estrogen-induced mammary cancer QTL 7 4 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 6 15107216 107351382 Rat 731173 Uae22 Urinary albumin excretion QTL 22 10.1 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 6 65531555 140994061 Rat 2293837 Kiddil1 Kidney dilation QTL 1 3.7 kidney pelvis morphology trait (VT:0004194) hydronephrosis severity score (CMO:0001208) 6 81132889 104393926 Rat 2293842 Kiddil3 Kidney dilation QTL 3 4.3 kidney pelvis morphology trait (VT:0004194) hydronephrosis severity score (CMO:0001208) 6 81132889 104393926 Rat 10054123 Srcrt6 Stress Responsive Cort QTL 6 2.5 0.0043 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 6 85140138 130140138 Rat 724536 Uae7 Urinary albumin excretion QTL 7 3.5 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 6 72202632 130729475 Rat 70196 BpQTLcluster7 Blood pressure QTL cluster 7 6.82 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 6 72202632 117202632 Rat 1581550 Pur8 Proteinuria QTL 8 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 6 72227641 130729205 Rat 1576302 Schws4 Schwannoma susceptibility QTL 4 0.0078 nervous system integrity trait (VT:0010566) percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017) 6 83190345 106747639 Rat 1300075 Glom7 Glomerulus QTL 7 5.6 0.0000002 kidney glomerulus morphology trait (VT:0005325) count of superficial glomeruli not directly contacting the kidney surface (CMO:0001002) 6 71201409 116201409 Rat 738034 Anxrr5 Anxiety related response QTL 5 5.9 exploratory behavior trait (VT:0010471) percentage of entries into a discrete space in an experimental apparatus (CMO:0000961) 6 84130881 129130881 Rat 2290393 Uae37 Urinary albumin excretion QTL 37 0.0001 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 6 65531555 140994061 Rat 12801471 Schws9 Schwannoma susceptibility QTL 9 nervous system integrity trait (VT:0010566) percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017) 6 61747639 106747639 Rat 6893332 Cm74 Cardiac mass QTL 74 0.4 0.64 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 6 57730540 104085867 Rat 1300076 Glom8 Glomerulus QTL 8 7 9e-09 kidney glomerulus morphology trait (VT:0005325) count of superficial glomeruli directly contacting the kidney surface (CMO:0001001) 6 86894788 131894788 Rat
RH129748
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 6 91,802,403 - 91,802,570 (+) MAPPER mRatBN7.2 Rnor_6.0 6 95,984,943 - 95,985,109 NCBI Rnor6.0 Rnor_5.0 6 105,420,255 - 105,420,421 UniSTS Rnor5.0 RGSC_v3.4 6 95,526,368 - 95,526,534 UniSTS RGSC3.4 Celera 6 90,265,375 - 90,265,541 UniSTS RH 3.4 Map 6 660.2 UniSTS Cytogenetic Map 6 q24 UniSTS
D50417
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 6 91,811,705 - 91,811,865 (+) MAPPER mRatBN7.2 Rnor_6.0 6 95,994,242 - 95,994,401 NCBI Rnor6.0 Rnor_5.0 6 105,429,554 - 105,429,713 UniSTS Rnor5.0 RGSC_v3.4 6 95,535,667 - 95,535,826 UniSTS RGSC3.4 Celera 6 90,274,674 - 90,274,833 UniSTS Cytogenetic Map 6 q24 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
71
70
39
24
39
6
197
96
93
45
57
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000050138 ⟹ ENSRNOP00000050667
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 6 91,802,329 - 91,815,992 (-) Ensembl Rnor_6.0 Ensembl 6 95,984,868 - 95,998,529 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000117601 ⟹ ENSRNOP00000089936
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 6 91,802,329 - 91,815,992 (-) Ensembl
RefSeq Acc Id:
NM_001106739 ⟹ NP_001100209
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 97,538,202 - 97,551,872 (-) NCBI mRatBN7.2 6 91,802,329 - 91,816,002 (-) NCBI Rnor_6.0 6 95,984,868 - 95,998,529 (-) NCBI Rnor_5.0 6 105,420,180 - 105,433,894 (-) NCBI RGSC_v3.4 6 95,526,293 - 95,539,953 (-) RGD Celera 6 90,265,300 - 90,278,960 (-) RGD
Sequence:
CGGCAGAAAGCAGCTATCCGTTTACACTACTTTGCTCTAGCAGCTATCTTAATGATTGCAAGTGCGGCGGACATCAAGCAGGAGAATGGGATGGAAAGCGCCTCGGAAGGACAGGAGGCGCACCGAGA
hide sequence
RefSeq Acc Id:
NM_001414919 ⟹ NP_001401848
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 97,538,202 - 97,551,872 (-) NCBI mRatBN7.2 6 91,802,329 - 91,816,002 (-) NCBI
RefSeq Acc Id:
NM_001414920 ⟹ NP_001401849
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 97,538,202 - 97,551,872 (-) NCBI mRatBN7.2 6 91,802,329 - 91,816,002 (-) NCBI
RefSeq Acc Id:
NP_001100209 ⟸ NM_001106739
- Peptide Label:
isoform 3
- UniProtKB:
D3ZAJ7 (UniProtKB/TrEMBL), A6HC53 (UniProtKB/TrEMBL)
- Sequence:
MIASAADIKQENGMESASEGQEAHREPPLAFSPDHVACVCEALQQGGNLDRLARFLWSLPQSDLLRGNESLLKARALVAFHQGIYPELYSILESHSFESANHPLLQQLWYKARYTEAERARGRPLGAV
hide sequence
Ensembl Acc Id:
ENSRNOP00000050667 ⟸ ENSRNOT00000050138
Ensembl Acc Id:
ENSRNOP00000089936 ⟸ ENSRNOT00000117601
RefSeq Acc Id:
NP_001401849 ⟸ NM_001414920
- Peptide Label:
isoform 2
- UniProtKB:
A0A8I6AM05 (UniProtKB/TrEMBL)
RefSeq Acc Id:
NP_001401848 ⟸ NM_001414919
- Peptide Label:
isoform 1
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2008-10-23
Six4
SIX homeobox 4
Six4
sine oculis-related homeobox 4 homolog (Drosophila)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-04-30
Six4
sine oculis-related homeobox 4 homolog (Drosophila)
Six4_predicted
sine oculis-related homeobox 4 homolog (Drosophila) (predicted)
'predicted' is removed
2292626 APPROVED
2005-01-12
Six4_predicted
sine oculis-related homeobox 4 homolog (Drosophila) (predicted)
Symbol and Name status set to approved
70820 APPROVED
