Symbol:
Med4
Name:
mediator complex subunit 4
RGD ID:
1306671
Description:
Predicted to enable nuclear thyroid hormone receptor binding activity and transcription coactivator activity. Predicted to be involved in positive regulation of transcription initiation by RNA polymerase II and transcription by RNA polymerase II. Predicted to be located in nucleoplasm. Predicted to be part of core mediator complex and mediator complex. Orthologous to human MED4 (mediator complex subunit 4); PARTICIPATES IN RNA polymerase II transcription pathway; INTERACTS WITH 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine; 3-chloropropane-1,2-diol.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
LOC306030; mediator of RNA polymerase II transcription subunit 4; mediator of RNA polymerase II transcription, subunit 4 homolog; mediator of RNA polymerase II transcription, subunit 4 homolog (yeast); Vdrip; vitamin D receptor interacting protein
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
MED4 (mediator complex subunit 4) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Med4 (mediator complex subunit 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Med4 (mediator complex subunit 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
MED4 (mediator complex subunit 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
MED4 (mediator complex subunit 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Med4 (mediator complex subunit 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
MED4 (mediator complex subunit 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
MED4 (mediator complex subunit 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Med4 (mediator complex subunit 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Mus musculus (house mouse):
Med4 (mediator complex subunit 4)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
MED4 (mediator complex subunit 4)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
med4 (mediator complex subunit 4)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
mdt-4
Alliance
DIOPT (Ensembl Compara|InParanoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
MED4
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
med4
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 15 55,106,079 - 55,116,354 (+) NCBI GRCr8 mRatBN7.2 15 48,696,542 - 48,706,818 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 15 48,696,511 - 48,706,820 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 15 52,837,909 - 52,848,181 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 15 53,949,486 - 53,959,758 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 15 50,794,276 - 50,804,563 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 15 55,406,543 - 55,416,816 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 15 55,406,543 - 55,416,815 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 15 59,128,754 - 59,139,027 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 15 54,158,386 - 54,168,660 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 15 54,174,165 - 54,184,439 (+) NCBI Celera 15 48,344,958 - 48,355,232 (+) NCBI Celera Cytogenetic Map 15 q11 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Med4 Rat 1,2-dimethylhydrazine multiple interactions ISO Med4 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of MED4 mRNA CTD PMID:22206623 Med4 Rat 17alpha-ethynylestradiol increases expression ISO Med4 (Mus musculus) 6480464 Ethinyl Estradiol results in increased expression of MED4 mRNA CTD PMID:17942748 Med4 Rat 17alpha-ethynylestradiol multiple interactions ISO Med4 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of MED4 mRNA CTD PMID:17942748 Med4 Rat 17beta-estradiol multiple interactions EXP 6480464 [bisphenol A co-treated with Estradiol] results in increased expression of MED4 mRNA CTD PMID:26496021 Med4 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Med4 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of MED4 mRNA CTD PMID:17942748 Med4 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Med4 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of MED4 mRNA CTD PMID:21570461 Med4 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of MED4 mRNA CTD PMID:21215274 Med4 Rat 2-hydroxypropanoic acid decreases expression ISO MED4 (Homo sapiens) 6480464 Lactic Acid results in decreased expression of MED4 mRNA CTD PMID:30851411 Med4 Rat 3-chloropropane-1,2-diol increases expression EXP 6480464 alpha-Chlorohydrin results in increased expression of MED4 protein CTD PMID:34915118 Med4 Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO MED4 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of MED4 mRNA CTD PMID:28628672 Med4 Rat 3H-1,2-dithiole-3-thione decreases expression EXP 6480464 1 and 2-dithiol-3-thione results in decreased expression of MED4 mRNA CTD PMID:19162173 Med4 Rat 4,4'-diaminodiphenylmethane increases expression ISO Med4 (Mus musculus) 6480464 4 and 4'-diaminodiphenylmethane results in increased expression of MED4 mRNA CTD PMID:18648102 Med4 Rat acetamide decreases expression EXP 6480464 acetamide results in decreased expression of MED4 mRNA CTD PMID:31881176 Med4 Rat acetylsalicylic acid increases expression ISO MED4 (Homo sapiens) 6480464 Aspirin results in increased expression of MED4 mRNA CTD PMID:15928584 Med4 Rat Aroclor 1254 decreases expression ISO Med4 (Mus musculus) 6480464 Chlorodiphenyl (54% Chlorine) results in decreased expression of MED4 mRNA CTD PMID:23650126 Med4 Rat atrazine decreases expression ISO MED4 (Homo sapiens) 6480464 Atrazine results in decreased expression of MED4 mRNA CTD PMID:22378314 Med4 Rat benzo[a]pyrene increases expression ISO Med4 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of MED4 mRNA CTD PMID:19770486 and PMID:22228805 Med4 Rat benzo[a]pyrene increases methylation ISO MED4 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of MED4 promoter CTD PMID:27901495 Med4 Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with Estradiol] results in increased expression of MED4 mRNA CTD PMID:26496021 Med4 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of MED4 mRNA CTD PMID:25181051 more ... Med4 Rat bisphenol F multiple interactions ISO MED4 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of MED4 mRNA CTD PMID:28628672 Med4 Rat cadmium dichloride decreases expression ISO MED4 (Homo sapiens) 6480464 Cadmium Chloride results in decreased expression of MED4 mRNA CTD PMID:38568856 Med4 Rat crocidolite asbestos decreases expression ISO Med4 (Mus musculus) 6480464 Asbestos and Crocidolite results in decreased expression of MED4 mRNA CTD PMID:29279043 Med4 Rat cyclosporin A decreases expression ISO MED4 (Homo sapiens) 6480464 Cyclosporine results in decreased expression of MED4 mRNA CTD PMID:25562108 Med4 Rat dexamethasone multiple interactions ISO MED4 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of MED4 mRNA CTD PMID:28628672 Med4 Rat dicrotophos decreases expression ISO MED4 (Homo sapiens) 6480464 dicrotophos results in decreased expression of MED4 mRNA CTD PMID:28302478 Med4 Rat disodium selenite increases expression ISO MED4 (Homo sapiens) 6480464 Sodium Selenite results in increased expression of MED4 mRNA CTD PMID:18175754 Med4 Rat epoxiconazole decreases expression ISO Med4 (Mus musculus) 6480464 epoxiconazole results in decreased expression of MED4 mRNA CTD PMID:35436446 Med4 Rat ethanol affects splicing ISO Med4 (Mus musculus) 6480464 Ethanol affects the splicing of MED4 mRNA CTD PMID:30319688 Med4 Rat ethanol increases expression ISO Med4 (Mus musculus) 6480464 Ethanol results in increased expression of MED4 mRNA CTD PMID:30319688 Med4 Rat finasteride increases expression EXP 6480464 Finasteride results in increased expression of MED4 mRNA CTD PMID:24136188 Med4 Rat fipronil decreases expression EXP 6480464 fipronil results in decreased expression of MED4 mRNA CTD PMID:34044035 Med4 Rat folic acid multiple interactions ISO Med4 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of MED4 mRNA CTD PMID:22206623 Med4 Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of MED4 mRNA CTD PMID:22061828 Med4 Rat indometacin multiple interactions ISO MED4 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of MED4 mRNA CTD PMID:28628672 Med4 Rat methapyrilene increases expression EXP 6480464 Methapyrilene results in increased expression of MED4 mRNA CTD PMID:30467583 Med4 Rat mono(2-ethylhexyl) phthalate decreases expression ISO MED4 (Homo sapiens) 6480464 mono-(2-ethylhexyl)phthalate results in decreased expression of MED4 mRNA CTD PMID:38685446 Med4 Rat nickel sulfate decreases expression ISO MED4 (Homo sapiens) 6480464 nickel sulfate results in decreased expression of MED4 mRNA CTD PMID:22714537 Med4 Rat paclitaxel affects response to substance ISO MED4 (Homo sapiens) 6480464 MED4 protein affects the susceptibility to Paclitaxel CTD PMID:16217747 Med4 Rat paracetamol affects expression ISO Med4 (Mus musculus) 6480464 Acetaminophen affects the expression of MED4 mRNA CTD PMID:17562736 Med4 Rat potassium dichromate decreases expression ISO MED4 (Homo sapiens) 6480464 Potassium Dichromate results in decreased expression of MED4 protein CTD PMID:23718831 Med4 Rat pregnenolone 16alpha-carbonitrile decreases expression EXP 6480464 Pregnenolone Carbonitrile results in decreased expression of MED4 mRNA CTD PMID:19162173 Med4 Rat rac-lactic acid decreases expression ISO MED4 (Homo sapiens) 6480464 Lactic Acid results in decreased expression of MED4 mRNA CTD PMID:30851411 Med4 Rat resveratrol multiple interactions ISO MED4 (Homo sapiens) 6480464 [Plant Extracts co-treated with Resveratrol] results in increased expression of MED4 mRNA CTD PMID:23557933 Med4 Rat sodium arsenite multiple interactions ISO MED4 (Homo sapiens) 6480464 sodium arsenite promotes the reaction [MED4 protein binds to CAPRIN1 protein] CTD PMID:33939924 Med4 Rat temozolomide increases expression ISO MED4 (Homo sapiens) 6480464 Temozolomide results in increased expression of MED4 mRNA CTD PMID:31758290 Med4 Rat tetrachloromethane decreases expression EXP 6480464 Carbon Tetrachloride results in decreased expression of MED4 mRNA CTD PMID:31150632 Med4 Rat thioacetamide decreases expression EXP 6480464 Thioacetamide results in decreased expression of MED4 mRNA CTD PMID:34492290 Med4 Rat titanium dioxide decreases methylation ISO Med4 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of MED4 gene CTD PMID:35295148 Med4 Rat triphenyl phosphate affects expression ISO MED4 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of MED4 mRNA CTD PMID:37042841 Med4 Rat vinclozolin increases expression EXP 6480464 vinclozolin results in increased expression of MED4 mRNA CTD PMID:23869203 Med4 Rat zinc atom decreases expression ISO MED4 (Homo sapiens) 6480464 Zinc deficiency results in decreased expression of MED4 mRNA CTD PMID:22171008 Med4 Rat zinc(0) decreases expression ISO MED4 (Homo sapiens) 6480464 Zinc deficiency results in decreased expression of MED4 mRNA CTD PMID:22171008
Med4 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 15 55,106,079 - 55,116,354 (+) NCBI GRCr8 mRatBN7.2 15 48,696,542 - 48,706,818 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 15 48,696,511 - 48,706,820 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 15 52,837,909 - 52,848,181 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 15 53,949,486 - 53,959,758 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 15 50,794,276 - 50,804,563 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 15 55,406,543 - 55,416,816 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 15 55,406,543 - 55,416,815 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 15 59,128,754 - 59,139,027 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 15 54,158,386 - 54,168,660 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 15 54,174,165 - 54,184,439 (+) NCBI Celera 15 48,344,958 - 48,355,232 (+) NCBI Celera Cytogenetic Map 15 q11 NCBI
MED4 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 13 48,075,724 - 48,095,104 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 13 48,053,323 - 48,095,131 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 13 48,649,860 - 48,669,240 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 13 47,548,093 - 47,567,241 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 13 47,548,092 - 47,567,241 NCBI Celera 13 29,704,843 - 29,723,982 (-) NCBI Celera Cytogenetic Map 13 q14.2 NCBI HuRef 13 29,441,920 - 29,461,323 (-) NCBI HuRef CHM1_1 13 48,617,590 - 48,636,992 (-) NCBI CHM1_1 T2T-CHM13v2.0 13 47,296,104 - 47,315,464 (-) NCBI T2T-CHM13v2.0
Med4 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 14 73,747,489 - 73,755,985 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 14 73,747,465 - 73,756,289 (+) Ensembl GRCm39 Ensembl GRCm38 14 73,510,049 - 73,518,545 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 14 73,510,025 - 73,518,849 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 14 73,909,856 - 73,918,352 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 14 72,244,204 - 72,252,700 (+) NCBI MGSCv36 mm8 Celera 14 71,030,090 - 71,038,619 (+) NCBI Celera Cytogenetic Map 14 D3 NCBI cM Map 14 39.05 NCBI
Med4 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955431 1,794,115 - 1,812,889 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955431 1,794,863 - 1,812,641 (-) NCBI ChiLan1.0 ChiLan1.0
MED4 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 14 49,501,810 - 49,549,339 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 13 48,153,026 - 48,200,552 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 13 29,227,620 - 29,247,082 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 13 47,929,918 - 47,948,836 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 13 47,929,918 - 47,948,836 (-) Ensembl panpan1.1 panPan2
MED4 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 22 3,396,276 - 3,411,037 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 22 3,396,267 - 3,410,608 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 22 3,382,963 - 3,439,510 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 22 3,468,131 - 3,524,954 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 22 3,509,920 - 3,524,949 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 22 3,253,448 - 3,309,631 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 22 3,316,446 - 3,372,886 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 22 3,321,556 - 3,377,754 (+) NCBI UU_Cfam_GSD_1.0
Med4 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404945 157,913,380 - 157,930,626 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936565 1,396,088 - 1,415,248 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936565 1,397,434 - 1,414,674 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
MED4 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 11 19,551,863 - 19,566,926 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 11 19,551,858 - 19,566,915 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 11 20,010,002 - 20,019,435 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
MED4 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 3 25,990,203 - 26,009,472 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 3 25,990,159 - 26,009,438 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666057 17,900,930 - 17,920,167 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Med4
.
Predicted Target Of
Count of predictions: 322 Count of miRNA genes: 217 Interacting mature miRNAs: 256 Transcripts: ENSRNOT00000023195 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
631273 Lecl2 Lens clarity QTL 2 0.001 lens clarity trait (VT:0001304) age of onset/diagnosis of cataract (CMO:0001584) 15 10596089 55596089 Rat 1300144 Rf23 Renal function QTL 23 3.61 renal blood flow trait (VT:2000006) absolute change in renal vascular resistance (CMO:0001900) 15 40631268 98288169 Rat 2300167 Bmd63 Bone mineral density QTL 63 5.9 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 15 11111142 56111142 Rat 1331729 Rf42 Renal function QTL 42 3.071 kidney blood vessel physiology trait (VT:0100012) absolute change in renal blood flow rate (CMO:0001168) 15 17362897 73690657 Rat 152025253 Hrtrt24 Heart rate QTL 24 3.82 heart pumping trait (VT:2000009) 15 27885774 86257085 Rat 10054130 Srcrt8 Stress Responsive Cort QTL 8 2.18 0.0085 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 15 22117933 67117933 Rat 1582227 Gluco30 Glucose level QTL 30 3.6 0.0003 blood glucose amount (VT:0000188) absolute change in blood glucose level area under curve (CMO:0002034) 15 28030665 82262678 Rat 1582228 Epfw3 Epididymal fat weight QTL 3 4.1 0.0002 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 15 28030665 82262678 Rat 2300173 Bmd62 Bone mineral density QTL 62 12.8 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 15 11111142 56111142 Rat 1578646 Bmd18 Bone mineral density QTL 18 5.2 femur mineral mass (VT:0010011) trabecular volumetric bone mineral density (CMO:0001729) 15 22806240 98288169 Rat 1578647 Bmd17 Bone mineral density QTL 17 4 femur mineral mass (VT:0010011) total volumetric bone mineral density (CMO:0001728) 15 22806240 98288169 Rat 61424 Scl1 Serum cholesterol level QTL 1 7.7 0.001 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 15 16725528 80672115 Rat 1582251 Gluco24 Glucose level QTL 24 3.2 0.0008 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 15 5530756 50530756 Rat 2293686 Bmd36 Bone mineral density QTL 36 7.4 0.0001 femur strength trait (VT:0010010) femoral neck ultimate force (CMO:0001703) 15 33611058 71477291 Rat 1598828 Glom14 Glomerulus QTL 14 2.5 kidney glomerulus morphology trait (VT:0005325) index of glomerular damage (CMO:0001135) 15 34054139 79054139 Rat 2317750 Glom26 Glomerulus QTL 26 4.3 urine protein amount (VT:0005160) urine protein level (CMO:0000591) 15 12496141 65205939 Rat 2298549 Neuinf12 Neuroinflammation QTL 12 3.5 nervous system integrity trait (VT:0010566) spinal cord beta-2 microglobulin mRNA level (CMO:0002125) 15 1 55302115 Rat 2293691 Bmd37 Bone mineral density QTL 37 6.6 0.0001 femur strength trait (VT:0010010) femur total energy absorbed before break (CMO:0001677) 15 33611058 71477291 Rat 2293688 Bss29 Bone structure and strength QTL 29 5.31 0.0001 femur morphology trait (VT:0000559) femur midshaft cortical cross-sectional area (CMO:0001663) 15 11111142 56111142 Rat 1582242 Gluco28 Glucose level QTL 28 3.3 0.0008 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 15 28030665 82262678 Rat 1578660 Bss19 Bone structure and strength QTL 19 4.3 femur morphology trait (VT:0000559) bone trabecular cross-sectional area (CMO:0002311) 15 22806240 98288169 Rat 1582244 Bw79 Body weight QTL 79 4 0.0002 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 15 28030665 82262678 Rat 7411725 Strs7 Sensitivity to stroke QTL 7 3.8 cerebrum integrity trait (VT:0010549) percentage of study population developing cerebrovascular lesions during a period of time (CMO:0000932) 15 40289901 49308583 Rat 1582214 Stl21 Serum triglyceride level QTL 21 3.1 0.022 blood triglyceride amount (VT:0002644) serum triglyceride level (CMO:0000360) 15 28030665 82262678 Rat
RH134687
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 15 48,706,506 - 48,706,693 (+) MAPPER mRatBN7.2 Rnor_6.0 15 55,416,505 - 55,416,691 NCBI Rnor6.0 Rnor_5.0 15 59,138,716 - 59,138,902 UniSTS Rnor5.0 RGSC_v3.4 15 54,168,349 - 54,168,535 UniSTS RGSC3.4 Celera 15 48,354,921 - 48,355,107 UniSTS Cytogenetic Map 15 p11 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000023195 ⟹ ENSRNOP00000023195
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 15 48,696,511 - 48,706,820 (+) Ensembl Rnor_6.0 Ensembl 15 55,406,543 - 55,416,815 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000113571 ⟹ ENSRNOP00000077263
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 15 48,696,529 - 48,706,673 (+) Ensembl
RefSeq Acc Id:
NM_001024256 ⟹ NP_001019427
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 15 55,106,079 - 55,116,354 (+) NCBI mRatBN7.2 15 48,696,542 - 48,706,818 (+) NCBI Rnor_6.0 15 55,406,543 - 55,416,816 (+) NCBI Rnor_5.0 15 59,128,754 - 59,139,027 (+) NCBI RGSC_v3.4 15 54,158,386 - 54,168,660 (+) RGD Celera 15 48,344,958 - 48,355,232 (+) RGD
Sequence:
GGCAGTGGGACGATGGCGGCTTCTTCAAGTGGTGAGAAGGAAAAGGAGCGGATGGGAGGCGTTTCAGGAATGACAGGCCTTGGCAGTACGCGAGAGCGGCTTCTGTCTGCGCTGGAAGATCTGGAGGT
hide sequence
RefSeq Acc Id:
NP_001019427 ⟸ NM_001024256
- UniProtKB:
Q561Q8 (UniProtKB/Swiss-Prot), A0A8L2QD52 (UniProtKB/TrEMBL), A6HTQ7 (UniProtKB/TrEMBL)
- Sequence:
MAASSSGEKEKERMGGVSGMTGLGSTRERLLSALEDLEVLSRELIEMLAISRNQKLLQLEEENQVLELLIHRDGDFQELMKLALNQGKVHHEMQALEKEVEKRDSDIQQLQKQLKEAEQILATAVYQA
hide sequence
Ensembl Acc Id:
ENSRNOP00000023195 ⟸ ENSRNOT00000023195
Ensembl Acc Id:
ENSRNOP00000077263 ⟸ ENSRNOT00000113571
RGD ID: 13699824 Promoter ID: EPDNEW_R10348 Type: multiple initiation site Name: Med4_1 Description: mediator complex subunit 4 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 15 55,406,528 - 55,406,588 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2008-10-23
Med4
mediator complex subunit 4
Med4
mediator of RNA polymerase II transcription, subunit 4 homolog (yeast)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2006-03-30
Med4
mediator of RNA polymerase II transcription, subunit 4 homolog (yeast)
Vdrip
vitamin D receptor interacting protein
Symbol and Name updated
1299863 APPROVED
2005-12-06
Vdrip
vitamin D receptor interacting protein
Vdrip_predicted
vitamin D receptor interacting protein (predicted)
Symbol and Name updated
1559027 APPROVED
2005-01-12
Vdrip_predicted
vitamin D receptor interacting protein (predicted)
Symbol and Name status set to approved
70820 APPROVED
