Symbol:
Eml1
Name:
EMAP like 1
RGD ID:
1306374
Description:
Predicted to enable microtubule binding activity. Predicted to be involved in brain development; mitotic spindle organization; and neuroblast proliferation. Predicted to act upstream of or within hematopoietic progenitor cell differentiation. Predicted to be located in cytosol and microtubule cytoskeleton. Predicted to colocalize with mitotic spindle. Used to study epilepsy and subcortical band heterotopia. Human ortholog(s) of this gene implicated in skin melanoma and subcortical band heterotopia. Orthologous to human EML1 (EMAP like 1); INTERACTS WITH acetamide; atrazine; bisphenol A.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
echinoderm microtubule associated protein like 1; echinoderm microtubule-associated protein-like 1; EMAP-1; LOC362783; MGC114510
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
EML1 (EMAP like 1) HGNC
Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther
Mus musculus (house mouse):
Eml1 (echinoderm microtubule associated protein like 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Eml1 (EMAP like 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
EML1 (EMAP like 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
EML1 (EMAP like 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Eml1 (EMAP like 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
EML1 (EMAP like 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
EML1 (EMAP like 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Eml1 (EMAP like 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Mus musculus (house mouse):
Eml1 (echinoderm microtubule associated protein like 1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
EML1 (EMAP like 1)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
eml1 (EMAP like 1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
DCX-EMAP
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoInspector|PANTHER|SonicParanoid)
Caenorhabditis elegans (roundworm):
elp-1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
eml2
Alliance
DIOPT (OrthoFinder|PANTHER|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):
eml1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoInspector|SonicParanoid)
Allele / Splice:
Eml1tish
Genetic Models:
SD-Eml1tish /Scrb
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 6 133,048,271 - 133,221,642 (+) NCBI GRCr8 mRatBN7.2 6 127,283,968 - 127,457,246 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 6 127,284,029 - 127,457,246 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 6 127,408,913 - 127,581,347 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 6 127,703,970 - 127,876,401 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 6 127,061,846 - 127,234,628 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 6 132,367,342 - 132,450,488 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 6 132,383,337 - 132,450,393 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 6 141,536,753 - 141,619,726 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 6 132,825,590 - 132,880,169 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 6 132,831,776 - 132,886,352 (+) NCBI Celera 6 124,926,667 - 125,013,010 (+) NCBI Celera Cytogenetic Map 6 q32 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Eml1 Rat 1,2-dichloroethane decreases expression ISO Eml1 (Mus musculus) 6480464 ethylene dichloride results in decreased expression of EML1 mRNA CTD PMID:28960355 Eml1 Rat 1,2-dimethylhydrazine increases expression ISO Eml1 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in increased expression of EML1 mRNA CTD PMID:22206623 Eml1 Rat 17beta-estradiol multiple interactions ISO EML1 (Homo sapiens) 6480464 [Estradiol co-treated with TGFB1 protein] results in increased expression of EML1 mRNA CTD PMID:30165855 Eml1 Rat 17beta-hydroxy-5alpha-androstan-3-one increases expression ISO EML1 (Homo sapiens) 6480464 Dihydrotestosterone results in increased expression of EML1 mRNA CTD PMID:29581250 Eml1 Rat 2,2',4,4'-Tetrabromodiphenyl ether increases expression ISO EML1 (Homo sapiens) 6480464 2 more ... CTD PMID:31675489 Eml1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Eml1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of EML1 mRNA CTD PMID:21570461 Eml1 Rat 2,4,6-tribromophenol increases expression ISO EML1 (Homo sapiens) 6480464 2 more ... CTD PMID:31675489 Eml1 Rat 2-hydroxypropanoic acid decreases expression ISO EML1 (Homo sapiens) 6480464 Lactic Acid results in decreased expression of EML1 mRNA CTD PMID:30851411 Eml1 Rat 2-palmitoylglycerol increases expression ISO EML1 (Homo sapiens) 6480464 2-palmitoylglycerol results in increased expression of EML1 mRNA CTD PMID:37199045 Eml1 Rat 4,4'-sulfonyldiphenol increases methylation ISO Eml1 (Mus musculus) 6480464 bisphenol S results in increased methylation of EML1 exon CTD PMID:33297965 Eml1 Rat 4,4'-sulfonyldiphenol affects methylation ISO Eml1 (Mus musculus) 6480464 bisphenol S affects the methylation of EML1 gene CTD PMID:31683443 Eml1 Rat acetamide increases expression EXP 6480464 acetamide results in increased expression of EML1 mRNA CTD PMID:31881176 Eml1 Rat acrolein multiple interactions ISO EML1 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in decreased expression of EML1 mRNA more ... CTD PMID:32699268 and PMID:32845096 Eml1 Rat acrylamide decreases expression ISO EML1 (Homo sapiens) 6480464 Acrylamide results in decreased expression of EML1 mRNA CTD PMID:32763439 Eml1 Rat aflatoxin B1 decreases expression ISO EML1 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased expression of EML1 mRNA CTD PMID:21641981 and PMID:22100608 Eml1 Rat all-trans-retinoic acid decreases expression ISO EML1 (Homo sapiens) 6480464 Tretinoin results in decreased expression of EML1 mRNA CTD PMID:21934132 Eml1 Rat alpha-pinene multiple interactions ISO EML1 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in decreased expression of EML1 mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in decreased expression of EML1 mRNA CTD PMID:32699268 Eml1 Rat aristolochic acid A decreases expression ISO EML1 (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of EML1 mRNA CTD PMID:33212167 Eml1 Rat arsenite(3-) multiple interactions ISO EML1 (Homo sapiens) 6480464 arsenite inhibits the reaction [G3BP1 protein binds to EML1 mRNA] CTD PMID:32406909 Eml1 Rat arsenous acid increases expression ISO Eml1 (Mus musculus) 6480464 Arsenic Trioxide results in increased expression of EML1 mRNA CTD PMID:35676786 Eml1 Rat atrazine affects methylation EXP 6480464 Atrazine affects the methylation of EML1 gene CTD PMID:35440735 Eml1 Rat benzo[a]pyrene multiple interactions ISO Eml1 (Mus musculus) 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in increased expression of EML1 mRNA CTD PMID:27858113 Eml1 Rat benzo[a]pyrene decreases methylation ISO Eml1 (Mus musculus) 6480464 Benzo(a)pyrene results in decreased methylation of EML1 intron CTD PMID:27901495 Eml1 Rat benzo[a]pyrene affects methylation ISO EML1 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of EML1 promoter CTD PMID:27901495 Eml1 Rat benzo[b]fluoranthene multiple interactions ISO Eml1 (Mus musculus) 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in increased expression of EML1 mRNA CTD PMID:27858113 Eml1 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of EML1 mRNA CTD PMID:25181051 Eml1 Rat bisphenol A multiple interactions ISO EML1 (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] affects the methylation of EML1 gene CTD PMID:31601247 Eml1 Rat bisphenol A decreases methylation ISO EML1 (Homo sapiens) 6480464 bisphenol A results in decreased methylation of EML1 gene CTD PMID:31601247 Eml1 Rat bisphenol A increases expression ISO Eml1 (Mus musculus) 6480464 bisphenol A results in increased expression of EML1 mRNA CTD PMID:34585602 Eml1 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of EML1 mRNA CTD PMID:30816183 more ... Eml1 Rat C60 fullerene decreases expression EXP 6480464 fullerene C60 results in decreased expression of EML1 mRNA CTD PMID:19167457 Eml1 Rat cadmium atom multiple interactions ISO EML1 (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of EML1 mRNA CTD PMID:35301059 Eml1 Rat cadmium dichloride multiple interactions ISO EML1 (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of EML1 mRNA CTD PMID:35301059 Eml1 Rat cantharidin decreases expression ISO Eml1 (Mus musculus) 6480464 Cantharidin results in decreased expression of EML1 mRNA CTD PMID:36907384 Eml1 Rat carbon nanotube decreases expression ISO Eml1 (Mus musculus) 6480464 Nanotubes and Carbon analog results in decreased expression of EML1 mRNA CTD PMID:25554681 Eml1 Rat chlorpyrifos decreases expression ISO Eml1 (Mus musculus) 6480464 Chlorpyrifos results in decreased expression of EML1 mRNA CTD PMID:37019170 Eml1 Rat choline multiple interactions ISO Eml1 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of EML1 mRNA CTD PMID:20938992 Eml1 Rat chrysene multiple interactions ISO Eml1 (Mus musculus) 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in increased expression of EML1 mRNA CTD PMID:27858113 Eml1 Rat cisplatin multiple interactions ISO EML1 (Homo sapiens) 6480464 [Cisplatin co-treated with jinfukang] results in decreased expression of EML1 mRNA CTD PMID:27392435 Eml1 Rat cobalt dichloride decreases expression ISO EML1 (Homo sapiens) 6480464 cobaltous chloride results in decreased expression of EML1 mRNA CTD PMID:19320972 Eml1 Rat copper(II) sulfate decreases expression ISO EML1 (Homo sapiens) 6480464 Copper Sulfate results in decreased expression of EML1 mRNA CTD PMID:19549813 Eml1 Rat crocidolite asbestos decreases expression ISO Eml1 (Mus musculus) 6480464 Asbestos and Crocidolite results in decreased expression of EML1 mRNA CTD PMID:29279043 Eml1 Rat Cuprizon decreases expression EXP 6480464 Cuprizone results in decreased expression of EML1 mRNA CTD PMID:26577399 Eml1 Rat decabromodiphenyl ether decreases expression ISO EML1 (Homo sapiens) 6480464 decabromobiphenyl ether results in decreased expression of EML1 protein CTD PMID:31675489 Eml1 Rat diarsenic trioxide increases expression ISO Eml1 (Mus musculus) 6480464 Arsenic Trioxide results in increased expression of EML1 mRNA CTD PMID:35676786 Eml1 Rat diuron decreases expression EXP 6480464 Diuron results in decreased expression of EML1 mRNA CTD PMID:25152437 Eml1 Rat doxorubicin decreases expression ISO EML1 (Homo sapiens) 6480464 Doxorubicin results in decreased expression of EML1 mRNA CTD PMID:29803840 Eml1 Rat ethanol multiple interactions ISO Eml1 (Mus musculus) 6480464 Ethanol affects the expression of and affects the splicing of EML1 mRNA CTD PMID:30319688 Eml1 Rat folic acid multiple interactions ISO Eml1 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of EML1 mRNA CTD PMID:20938992 Eml1 Rat FR900359 increases phosphorylation ISO EML1 (Homo sapiens) 6480464 FR900359 results in increased phosphorylation of EML1 protein CTD PMID:37730182 Eml1 Rat fulvestrant multiple interactions ISO EML1 (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] affects the methylation of EML1 gene CTD PMID:31601247 Eml1 Rat ivermectin decreases expression ISO EML1 (Homo sapiens) 6480464 Ivermectin results in decreased expression of EML1 protein CTD PMID:32959892 Eml1 Rat L-methionine multiple interactions ISO Eml1 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of EML1 mRNA CTD PMID:20938992 Eml1 Rat Mesaconitine decreases expression EXP 6480464 mesaconitine results in decreased expression of EML1 protein CTD PMID:37182599 Eml1 Rat methamphetamine increases expression EXP 6480464 Methamphetamine results in increased expression of EML1 mRNA CTD PMID:32035215 Eml1 Rat methylmercury chloride increases expression ISO EML1 (Homo sapiens) 6480464 methylmercuric chloride results in increased expression of EML1 mRNA CTD PMID:23179753 Eml1 Rat N,N-diethyl-m-toluamide multiple interactions EXP 6480464 [Permethrin co-treated with DEET] results in increased methylation of EML1 gene CTD PMID:33148267 Eml1 Rat nickel sulfate increases expression ISO EML1 (Homo sapiens) 6480464 nickel sulfate results in increased expression of EML1 mRNA CTD PMID:22714537 Eml1 Rat ozone multiple interactions ISO EML1 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in decreased expression of EML1 mRNA more ... CTD PMID:32699268 and PMID:32845096 Eml1 Rat ozone multiple interactions ISO Eml1 (Mus musculus) 6480464 [Air Pollutants results in increased abundance of Ozone] which results in decreased expression of EML1 mRNA CTD PMID:34911549 Eml1 Rat paracetamol affects expression ISO Eml1 (Mus musculus) 6480464 Acetaminophen affects the expression of EML1 mRNA CTD PMID:17562736 Eml1 Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of EML1 mRNA CTD PMID:33387578 Eml1 Rat paracetamol increases expression ISO EML1 (Homo sapiens) 6480464 Acetaminophen results in increased expression of EML1 mRNA CTD PMID:29067470 Eml1 Rat permethrin multiple interactions EXP 6480464 [Permethrin co-treated with DEET] results in increased methylation of EML1 gene CTD PMID:33148267 Eml1 Rat potassium chromate decreases expression ISO EML1 (Homo sapiens) 6480464 potassium chromate(VI) results in decreased expression of EML1 mRNA CTD PMID:22714537 Eml1 Rat rac-lactic acid decreases expression ISO EML1 (Homo sapiens) 6480464 Lactic Acid results in decreased expression of EML1 mRNA CTD PMID:30851411 Eml1 Rat scopolamine decreases expression EXP 6480464 Scopolamine results in decreased expression of EML1 mRNA CTD PMID:17540011 Eml1 Rat sodium arsenite increases expression ISO EML1 (Homo sapiens) 6480464 sodium arsenite results in increased expression of EML1 mRNA CTD PMID:22714537 Eml1 Rat sunitinib decreases expression ISO EML1 (Homo sapiens) 6480464 Sunitinib results in decreased expression of EML1 mRNA CTD PMID:31533062 Eml1 Rat temozolomide increases expression ISO EML1 (Homo sapiens) 6480464 Temozolomide results in increased expression of EML1 mRNA CTD PMID:31758290 Eml1 Rat tert-butyl hydroperoxide increases expression ISO EML1 (Homo sapiens) 6480464 tert-Butylhydroperoxide results in increased expression of EML1 mRNA CTD PMID:15336504 Eml1 Rat tetraphene multiple interactions ISO Eml1 (Mus musculus) 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in increased expression of EML1 mRNA CTD PMID:27858113 Eml1 Rat triptonide decreases expression ISO Eml1 (Mus musculus) 6480464 triptonide results in decreased expression of EML1 mRNA CTD PMID:33045310 Eml1 Rat valproic acid affects expression ISO EML1 (Homo sapiens) 6480464 Valproic Acid affects the expression of EML1 mRNA CTD PMID:25979313 Eml1 Rat valproic acid increases expression ISO EML1 (Homo sapiens) 6480464 Valproic Acid results in increased expression of EML1 mRNA CTD PMID:23179753 more ... Eml1 Rat vinclozolin affects expression EXP 6480464 vinclozolin affects the expression of EML1 mRNA CTD PMID:19015723
1,2-dichloroethane (ISO) 1,2-dimethylhydrazine (ISO) 17beta-estradiol (ISO) 17beta-hydroxy-5alpha-androstan-3-one (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3,7,8-tetrachlorodibenzodioxine (ISO) 2,4,6-tribromophenol (ISO) 2-hydroxypropanoic acid (ISO) 2-palmitoylglycerol (ISO) 4,4'-sulfonyldiphenol (ISO) acetamide (EXP) acrolein (ISO) acrylamide (ISO) aflatoxin B1 (ISO) all-trans-retinoic acid (ISO) alpha-pinene (ISO) aristolochic acid A (ISO) arsenite(3-) (ISO) arsenous acid (ISO) atrazine (EXP) benzo[a]pyrene (ISO) benzo[b]fluoranthene (ISO) bisphenol A (EXP,ISO) C60 fullerene (EXP) cadmium atom (ISO) cadmium dichloride (ISO) cantharidin (ISO) carbon nanotube (ISO) chlorpyrifos (ISO) choline (ISO) chrysene (ISO) cisplatin (ISO) cobalt dichloride (ISO) copper(II) sulfate (ISO) crocidolite asbestos (ISO) Cuprizon (EXP) decabromodiphenyl ether (ISO) diarsenic trioxide (ISO) diuron (EXP) doxorubicin (ISO) ethanol (ISO) folic acid (ISO) FR900359 (ISO) fulvestrant (ISO) ivermectin (ISO) L-methionine (ISO) Mesaconitine (EXP) methamphetamine (EXP) methylmercury chloride (ISO) N,N-diethyl-m-toluamide (EXP) nickel sulfate (ISO) ozone (ISO) paracetamol (EXP,ISO) permethrin (EXP) potassium chromate (ISO) rac-lactic acid (ISO) scopolamine (EXP) sodium arsenite (ISO) sunitinib (ISO) temozolomide (ISO) tert-butyl hydroperoxide (ISO) tetraphene (ISO) triptonide (ISO) valproic acid (ISO) vinclozolin (EXP)
Biological Process
brain development (IEA,ISO,ISS) hematopoietic progenitor cell differentiation (IEA,ISO) microtubule cytoskeleton organization (IBA,IEA,ISO,ISS) mitotic spindle organization (IEA,ISO,ISS) neuroblast proliferation (IEA,ISO,ISS)
1.
The neuroanatomy of Eml1 knockout mice, a model of subcortical heterotopia.
Collins SC, etal., J Anat. 2019 Sep;235(3):637-650. doi: 10.1111/joa.13013. Epub 2019 Jun 7.
2.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.
A deletion in Eml1 leads to bilateral subcortical heterotopia in the tish rat.
Grosenbaugh DK, etal., Neurobiol Dis. 2020 Jul;140:104836. doi: 10.1016/j.nbd.2020.104836. Epub 2020 Mar 13.
4.
Genetic variants of EML1 and HIST1H4E in myeloid cell-related pathway genes independently predict cutaneous melanoma-specific survival.
He Y, etal., Am J Cancer Res. 2021 Jun 15;11(6):3252-3262. eCollection 2021.
5.
Mutations in Eml1 lead to ectopic progenitors and neuronal heterotopia in mouse and human.
Kielar M, etal., Nat Neurosci. 2014 Jul;17(7):923-33. doi: 10.1038/nn.3729. Epub 2014 May 25.
6.
A genetic animal model of human neocortical heterotopia associated with seizures.
Lee KS, etal., J Neurosci. 1997 Aug 15;17(16):6236-42. doi: 10.1523/JNEUROSCI.17-16-06236.1997.
7.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
8.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
Eml1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 6 133,048,271 - 133,221,642 (+) NCBI GRCr8 mRatBN7.2 6 127,283,968 - 127,457,246 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 6 127,284,029 - 127,457,246 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 6 127,408,913 - 127,581,347 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 6 127,703,970 - 127,876,401 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 6 127,061,846 - 127,234,628 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 6 132,367,342 - 132,450,488 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 6 132,383,337 - 132,450,393 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 6 141,536,753 - 141,619,726 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 6 132,825,590 - 132,880,169 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 6 132,831,776 - 132,886,352 (+) NCBI Celera 6 124,926,667 - 125,013,010 (+) NCBI Celera Cytogenetic Map 6 q32 NCBI
EML1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 14 99,737,722 - 99,942,060 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 14 99,737,693 - 99,942,060 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 14 100,204,059 - 100,408,397 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 14 99,329,498 - 99,478,150 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 14 99,329,497 - 99,478,146 NCBI Celera 14 80,314,618 - 80,463,271 (+) NCBI Celera Cytogenetic Map 14 q32.2 NCBI HuRef 14 80,500,729 - 80,591,998 (+) NCBI HuRef CHM1_1 14 100,197,512 - 100,346,159 (+) NCBI CHM1_1 T2T-CHM13v2.0 14 93,969,151 - 94,174,609 (+) NCBI T2T-CHM13v2.0
Eml1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 12 108,337,265 - 108,505,835 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 12 108,337,216 - 108,505,876 (+) Ensembl GRCm39 Ensembl GRCm38 12 108,371,002 - 108,539,576 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 12 108,370,957 - 108,539,617 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 12 109,648,865 - 109,777,774 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 12 108,818,764 - 108,987,383 (+) NCBI MGSCv36 mm8 MGSCv36 12 102,632,098 - 102,805,540 (+) NCBI MGSCv36 mm8 Celera 12 109,653,344 - 109,775,028 (+) NCBI Celera Cytogenetic Map 12 F1 NCBI cM Map 12 59.46 NCBI
Eml1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955438 21,078,760 - 21,137,926 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955438 20,991,432 - 21,137,570 (+) NCBI ChiLan1.0 ChiLan1.0
EML1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 15 100,893,344 - 101,097,011 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 14 100,109,839 - 100,313,506 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 14 80,362,837 - 80,566,996 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 14 99,717,220 - 99,885,359 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 14 99,793,812 - 99,885,359 (+) Ensembl panpan1.1 panPan2
EML1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 8 68,139,741 - 68,295,363 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 8 68,216,857 - 68,294,080 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 8 67,628,246 - 67,816,902 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 8 68,391,782 - 68,580,690 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 8 68,391,815 - 68,580,640 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 8 68,052,800 - 68,241,854 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 8 68,119,216 - 68,308,068 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 8 68,516,950 - 68,705,827 (+) NCBI UU_Cfam_GSD_1.0
Eml1 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024408640 6,420,280 - 6,584,031 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936604 3,498,304 - 3,662,244 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936604 3,498,413 - 3,662,188 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
EML1
EML1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 24 77,694,931 - 77,907,574 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 24 77,694,971 - 77,907,909 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666053 64,834,630 - 65,042,702 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Eml1
.
Predicted Target Of
Count of predictions: 268 Count of miRNA genes: 91 Interacting mature miRNAs: 98 Transcripts: ENSRNOT00000066611, ENSRNOT00000071733, ENSRNOT00000071863 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
12801411 Schws8 Schwannoma susceptibility QTL 8 nervous system integrity trait (VT:0010566) percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017) 6 94968928 139968928 Rat 1331797 Bp213 Blood pressure QTL 213 3.291 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 6 104085867 128713626 Rat 1331799 Bp211 Blood pressure QTL 211 3.66407 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 6 72202632 130919985 Rat 71111 Iddm8 Insulin dependent diabetes mellitus QTL 8 1.9 0.002 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 6 105156861 140994061 Rat 1358355 Srcrt4 Stress Responsive Cort QTL 4 6.39 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 6 100364669 140994061 Rat 61329 Eae9 Experimental allergic encephalomyelitis QTL 9 3.7 body mass (VT:0001259) change in body weight (CMO:0002045) 6 122549046 140994061 Rat 2312560 Pur20 Proteinuria QTL 20 2.1 0.005 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 6 125628133 137801795 Rat 2313399 Anxrr28 Anxiety related response QTL 28 aggression-related behavior trait (VT:0015014) tameness/aggressiveness composite score (CMO:0002136) 6 100671796 132340886 Rat 1331725 Bp212 Blood pressure QTL 212 3.52475 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 6 93701310 128713626 Rat 8552796 Vie3 Viral induced encephalitis QTL 3 2.6 brain integrity trait (VT:0010579) encephalitis incidence/prevalence measurement (CMO:0002361) 6 96833997 140994061 Rat 4145118 Mcs26 Mammary carcinoma susceptibility QTL 26 0.0001 mammary gland integrity trait (VT:0010552) post-insult time to mammary tumor formation (CMO:0000345) 6 106752656 132339866 Rat 1581563 Uae33 Urinary albumin excretion QTL 33 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 6 72227641 130729205 Rat 10054138 Gmadr3 Adrenal mass QTL 3 3.68 0.00045 adrenal gland mass (VT:0010420) both adrenal glands wet weight (CMO:0000164) 6 85140138 130140138 Rat 1641917 Colcr5 Colorectal carcinoma resistance QTL 5 3.18 0.0009 intestine integrity trait (VT:0010554) benign colorectal tumor number (CMO:0001795) 6 122549046 137801795 Rat 61414 Pia3 Pristane induced arthritis QTL 3 4.5 joint integrity trait (VT:0010548) post-insult time to onset of experimental arthritis (CMO:0001450) 6 94968928 137848904 Rat 724513 Uae14 Urinary albumin excretion QTL 14 6.5 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 6 85311061 133478515 Rat 2303624 Vencon5 Ventilatory control QTL 5 4.45 respiration trait (VT:0001943) minute ventilation (CMO:0000132) 6 88047916 133047916 Rat 731173 Uae22 Urinary albumin excretion QTL 22 10.1 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 6 65531555 140994061 Rat 10054123 Srcrt6 Stress Responsive Cort QTL 6 2.5 0.0043 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 6 85140138 130140138 Rat 724536 Uae7 Urinary albumin excretion QTL 7 3.5 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 6 72202632 130729475 Rat 737976 Pia24 Pristane induced arthritis QTL 24 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 6 112636280 140994061 Rat 1298087 Iddm18 Insulin dependent diabetes mellitus QTL 18 0.0001 urine glucose amount (VT:0001758) percentage of study population developing diabetes mellitus during a period of time (CMO:0001114) 6 116506292 130245370 Rat 1581550 Pur8 Proteinuria QTL 8 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 6 72227641 130729205 Rat 738034 Anxrr5 Anxiety related response QTL 5 5.9 exploratory behavior trait (VT:0010471) percentage of entries into a discrete space in an experimental apparatus (CMO:0000961) 6 84130881 129130881 Rat 2290393 Uae37 Urinary albumin excretion QTL 37 0.0001 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 6 65531555 140994061 Rat 1300076 Glom8 Glomerulus QTL 8 7 9e-09 kidney glomerulus morphology trait (VT:0005325) count of superficial glomeruli directly contacting the kidney surface (CMO:0001001) 6 86894788 131894788 Rat 2293085 Iddm29 Insulin dependent diabetes mellitus QTL 29 7.66 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 6 122549046 140286318 Rat
BF409188
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 6 127,363,119 - 127,363,238 (+) MAPPER mRatBN7.2 Rnor_6.0 6 132,361,194 - 132,361,312 NCBI Rnor6.0 Rnor_5.0 6 141,530,620 - 141,530,738 UniSTS Rnor5.0 RGSC_v3.4 6 132,819,396 - 132,819,514 UniSTS RGSC3.4 Celera 6 124,920,892 - 124,921,010 UniSTS RH 3.4 Map 6 796.4 UniSTS Cytogenetic Map 6 q32 UniSTS
BM390550
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 6 127,304,943 - 127,305,163 (+) MAPPER mRatBN7.2 Rnor_6.0 6 132,303,846 - 132,304,065 NCBI Rnor6.0 Rnor_5.0 6 141,473,785 - 141,474,004 UniSTS Rnor5.0 RGSC_v3.4 6 132,762,243 - 132,762,462 UniSTS RGSC3.4 Celera 6 124,863,617 - 124,863,836 UniSTS RH 3.4 Map 6 791.5 UniSTS Cytogenetic Map 6 q32 UniSTS
This gene Eml1 is modified in the following models/strains:
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000071733 ⟹ ENSRNOP00000067418
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 6 127,385,187 - 127,455,903 (+) Ensembl Rnor_6.0 Ensembl 6 132,383,337 - 132,450,393 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000071863 ⟹ ENSRNOP00000067636
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 6 127,284,029 - 127,455,903 (+) Ensembl Rnor_6.0 Ensembl 6 132,383,370 - 132,450,393 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000107380 ⟹ ENSRNOP00000085896
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 6 127,284,029 - 127,457,235 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000108825 ⟹ ENSRNOP00000097362
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 6 127,284,075 - 127,457,246 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000114172 ⟹ ENSRNOP00000090244
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 6 127,341,559 - 127,457,235 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000118546 ⟹ ENSRNOP00000096898
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 6 127,284,083 - 127,457,245 (+) Ensembl
RefSeq Acc Id:
NM_001025741 ⟹ NP_001020912
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 133,133,659 - 133,221,642 (+) NCBI mRatBN7.2 6 127,369,259 - 127,457,246 (+) NCBI Rnor_6.0 6 132,367,342 - 132,450,488 (+) NCBI Rnor_5.0 6 141,536,753 - 141,619,726 (+) NCBI RGSC_v3.4 6 132,825,590 - 132,880,169 (+) RGD Celera 6 124,926,667 - 125,013,010 (+) RGD
Sequence:
GTTAGAACTGCCACTCAGGAGGTTTATAGGCGGTGACCCGGTGACTCGTGTGGCACGCTCCTGGGGATGGCTTTGCACTCGATGTCCTGGCAGAGTTCCTGACTTCTAGATGACAGCGCGTCTGCTGC
hide sequence
RefSeq Acc Id:
NM_001399709 ⟹ NP_001386638
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 133,048,430 - 133,221,642 (+) NCBI mRatBN7.2 6 127,284,024 - 127,457,246 (+) NCBI
RefSeq Acc Id:
NM_001399710 ⟹ NP_001386639
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 133,105,934 - 133,221,642 (+) NCBI mRatBN7.2 6 127,341,530 - 127,457,246 (+) NCBI
RefSeq Acc Id:
NM_001399711 ⟹ NP_001386640
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 133,105,934 - 133,221,642 (+) NCBI mRatBN7.2 6 127,341,530 - 127,457,246 (+) NCBI
RefSeq Acc Id:
NM_001399712 ⟹ NP_001386641
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 133,048,430 - 133,221,642 (+) NCBI mRatBN7.2 6 127,284,024 - 127,457,246 (+) NCBI
RefSeq Acc Id:
NR_174190
RefSeq Status:
VALIDATED
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 133,048,430 - 133,221,642 (+) NCBI mRatBN7.2 6 127,284,024 - 127,457,246 (+) NCBI
RefSeq Acc Id:
NR_174191
RefSeq Status:
VALIDATED
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 133,105,934 - 133,221,642 (+) NCBI mRatBN7.2 6 127,341,530 - 127,457,246 (+) NCBI
RefSeq Acc Id:
XM_039112546 ⟹ XP_038968474
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 133,105,856 - 133,221,631 (+) NCBI mRatBN7.2 6 127,341,396 - 127,457,246 (+) NCBI
RefSeq Acc Id:
XM_039112547 ⟹ XP_038968475
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 133,048,271 - 133,221,631 (+) NCBI mRatBN7.2 6 127,283,968 - 127,457,246 (+) NCBI
RefSeq Acc Id:
XM_039112550 ⟹ XP_038968478
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 133,133,617 - 133,221,631 (+) NCBI mRatBN7.2 6 127,369,216 - 127,457,246 (+) NCBI
RefSeq Acc Id:
XM_039112551 ⟹ XP_038968479
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 133,091,524 - 133,221,631 (+) NCBI mRatBN7.2 6 127,327,111 - 127,457,246 (+) NCBI
RefSeq Acc Id:
XM_039112552 ⟹ XP_038968480
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 133,181,394 - 133,221,631 (+) NCBI mRatBN7.2 6 127,416,984 - 127,457,246 (+) NCBI
RefSeq Acc Id:
XM_039112553 ⟹ XP_038968481
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 133,181,394 - 133,221,631 (+) NCBI mRatBN7.2 6 127,416,984 - 127,457,235 (+) NCBI
RefSeq Acc Id:
XM_063262135 ⟹ XP_063118205
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 133,091,777 - 133,221,631 (+) NCBI
RefSeq Acc Id:
NP_001020912 ⟸ NM_001025741
- Peptide Label:
isoform 5
- UniProtKB:
A0A8I6ASI8 (UniProtKB/TrEMBL)
- Sequence:
MEISDRIASLEQRVQMQEDDIQLLKSALADVVRRLNITEEQQAVLNRKGPTKARPLGQTLPLRTTVNNGTVLPKKPSASLPSPSGSRKEMVVPVTKSINRTSSSERVSPGGRRESSGDSKGSRNRTGS
hide sequence
Ensembl Acc Id:
ENSRNOP00000067636 ⟸ ENSRNOT00000071863
Ensembl Acc Id:
ENSRNOP00000067418 ⟸ ENSRNOT00000071733
RefSeq Acc Id:
XP_038968475 ⟸ XM_039112547
- Peptide Label:
isoform X2
- UniProtKB:
A0A8I6A157 (UniProtKB/TrEMBL), A0A8I6ASI8 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038968479 ⟸ XM_039112551
- Peptide Label:
isoform X3
- UniProtKB:
A0A8I6ASI8 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038968474 ⟸ XM_039112546
- Peptide Label:
isoform X1
- UniProtKB:
A0A8I6AD94 (UniProtKB/TrEMBL), A0A8I6ASI8 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038968478 ⟸ XM_039112550
- Peptide Label:
isoform X3
- UniProtKB:
A0A8I6ASI8 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038968480 ⟸ XM_039112552
- Peptide Label:
isoform X5
- UniProtKB:
A6KBG3 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038968481 ⟸ XM_039112553
- Peptide Label:
isoform X6
- UniProtKB:
A6KBG3 (UniProtKB/TrEMBL)
Ensembl Acc Id:
ENSRNOP00000085896 ⟸ ENSRNOT00000107380
Ensembl Acc Id:
ENSRNOP00000096898 ⟸ ENSRNOT00000118546
Ensembl Acc Id:
ENSRNOP00000090244 ⟸ ENSRNOT00000114172
Ensembl Acc Id:
ENSRNOP00000097362 ⟸ ENSRNOT00000108825
RefSeq Acc Id:
NP_001386638 ⟸ NM_001399709
- Peptide Label:
isoform 1
- UniProtKB:
A0A8I6AVR0 (UniProtKB/TrEMBL), A0A8I6ASI8 (UniProtKB/TrEMBL)
RefSeq Acc Id:
NP_001386641 ⟸ NM_001399712
- Peptide Label:
isoform 4
- UniProtKB:
A0A8I6ASI8 (UniProtKB/TrEMBL)
RefSeq Acc Id:
NP_001386640 ⟸ NM_001399711
- Peptide Label:
isoform 3
- UniProtKB:
Q4V8C3 (UniProtKB/Swiss-Prot), A0A8I6ASI8 (UniProtKB/TrEMBL)
RefSeq Acc Id:
NP_001386639 ⟸ NM_001399710
- Peptide Label:
isoform 2
- UniProtKB:
A0A8I6ASI8 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063118205 ⟸ XM_063262135
- Peptide Label:
isoform X4
- UniProtKB:
A0A8I6ASI8 (UniProtKB/TrEMBL)
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2018-12-04
Eml1
EMAP like 1
Eml1
echinoderm microtubule associated protein like 1
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2005-12-06
Eml1
echinoderm microtubule associated protein like 1
Eml1_predicted
echinoderm microtubule associated protein like 1 (predicted)
Symbol and Name updated
1559027 APPROVED
2005-01-12
Eml1_predicted
echinoderm microtubule associated protein like 1 (predicted)
Symbol and Name status set to approved
70820 APPROVED
