Symbol:
Acss1
Name:
acyl-CoA synthetase short-chain family member 1
RGD ID:
1306246
Description:
Enables acetate-CoA ligase activity. Involved in acetate biosynthetic process and propionate biosynthetic process. Predicted to be located in mitochondrial matrix. Predicted to be active in mitochondrion. Orthologous to human ACSS1 (acyl-CoA synthetase short chain family member 1); PARTICIPATES IN disulfiram pharmacodynamics pathway; fatty acid beta degradation pathway; malonic aciduria pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 6-propyl-2-thiouracil; acetamide.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
Acas2l; acetyl-Coenzyme A synthetase 2 (AMP forming)-like; acetyl-coenzyme A synthetase 2-like, mitochondrial; LOC296259
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 3 159,910,809 - 159,960,748 (-) NCBI GRCr8 mRatBN7.2 3 139,450,383 - 139,500,325 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 3 139,450,383 - 139,500,325 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 3 143,346,852 - 143,396,694 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 3 151,930,593 - 151,980,423 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 3 149,678,658 - 149,728,584 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 3 146,420,346 - 146,470,293 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 3 146,420,346 - 146,470,293 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 3 152,779,621 - 152,829,324 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 3 141,259,016 - 141,308,871 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 3 141,164,598 - 141,235,812 (-) NCBI Celera 3 138,212,667 - 138,262,509 (-) NCBI Celera Cytogenetic Map 3 q41 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Acss1 Rat (+)-dexrazoxane decreases expression ISO Acss1 (Mus musculus) 6480464 Dexrazoxane results in decreased expression of ACSS1 mRNA CTD PMID:26873546 Acss1 Rat (+)-dexrazoxane multiple interactions ISO Acss1 (Mus musculus) 6480464 [Doxorubicin co-treated with Dexrazoxane] results in increased expression of ACSS1 mRNA CTD PMID:26873546 Acss1 Rat 1,1-dichloroethene decreases expression ISO Acss1 (Mus musculus) 6480464 vinylidene chloride results in decreased expression of ACSS1 mRNA CTD PMID:26682919 Acss1 Rat 1,2-dimethylhydrazine multiple interactions ISO Acss1 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of ACSS1 mRNA CTD PMID:22206623 Acss1 Rat 17beta-estradiol increases expression ISO Acss1 (Mus musculus) 6480464 Estradiol results in increased expression of ACSS1 mRNA CTD PMID:15289156 Acss1 Rat 17beta-estradiol decreases expression ISO ACSS1 (Homo sapiens) 6480464 Estradiol results in decreased expression of ACSS1 mRNA CTD PMID:31614463 Acss1 Rat 17beta-estradiol multiple interactions ISO ACSS1 (Homo sapiens) 6480464 [Estradiol co-treated with TGFB1 protein] results in decreased expression of ACSS1 mRNA CTD PMID:30165855 Acss1 Rat 2,2',4,4'-Tetrabromodiphenyl ether increases expression ISO ACSS1 (Homo sapiens) 6480464 2 more ... CTD PMID:31675489 Acss1 Rat 2,2',5,5'-tetrachlorobiphenyl decreases expression ISO ACSS1 (Homo sapiens) 6480464 2 more ... CTD PMID:36804509 Acss1 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of ACSS1 mRNA CTD PMID:33387578 Acss1 Rat 2,4,6-tribromophenol increases expression ISO ACSS1 (Homo sapiens) 6480464 2 more ... CTD PMID:31675489 Acss1 Rat 3,3',5,5'-tetrabromobisphenol A decreases expression ISO ACSS1 (Homo sapiens) 6480464 tetrabromobisphenol A results in decreased expression of ACSS1 protein CTD PMID:31675489 Acss1 Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of ACSS1 mRNA CTD PMID:24780913 Acss1 Rat acetamide increases expression EXP 6480464 acetamide results in increased expression of ACSS1 mRNA CTD PMID:31881176 Acss1 Rat acrylamide decreases expression EXP 6480464 Acrylamide results in decreased expression of ACSS1 mRNA CTD PMID:28959563 Acss1 Rat acrylamide decreases expression ISO ACSS1 (Homo sapiens) 6480464 Acrylamide results in decreased expression of ACSS1 mRNA CTD PMID:32763439 Acss1 Rat aflatoxin B1 decreases expression ISO ACSS1 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased expression of ACSS1 mRNA CTD PMID:32234424 Acss1 Rat aldehydo-D-glucose increases expression ISO ACSS1 (Homo sapiens) 6480464 Glucose results in increased expression of ACSS1 mRNA CTD PMID:36156098 Acss1 Rat amphetamine decreases expression EXP 6480464 Amphetamine results in decreased expression of ACSS1 mRNA CTD PMID:30779732 Acss1 Rat arsane multiple interactions ISO Acss1 (Mus musculus) 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of ACSS1 mRNA CTD PMID:32045263 Acss1 Rat arsenic atom multiple interactions ISO Acss1 (Mus musculus) 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of ACSS1 mRNA CTD PMID:32045263 Acss1 Rat arsenite(3-) increases methylation ISO ACSS1 (Homo sapiens) 6480464 arsenite results in increased methylation of ACSS1 promoter CTD PMID:23974009 Acss1 Rat Azoxymethane multiple interactions ISO Acss1 (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in increased expression of ACSS1 mRNA CTD PMID:29950665 Acss1 Rat benzo[a]pyrene increases expression ISO Acss1 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of ACSS1 mRNA CTD PMID:22228805 Acss1 Rat benzo[a]pyrene decreases expression ISO ACSS1 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of ACSS1 mRNA and Benzo(a)pyrene results in decreased expression of ACSS1 protein CTD PMID:32234424 and PMID:33278487 Acss1 Rat benzo[a]pyrene affects methylation ISO ACSS1 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of ACSS1 promoter CTD PMID:30157460 Acss1 Rat benzo[a]pyrene increases methylation ISO ACSS1 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of ACSS1 3' UTR more ... CTD PMID:27901495 Acss1 Rat benzo[a]pyrene decreases expression ISO Acss1 (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of ACSS1 mRNA CTD PMID:22610609 Acss1 Rat bis(2-ethylhexyl) phthalate multiple interactions ISO Acss1 (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of ACSS1 mRNA CTD PMID:39150890 Acss1 Rat bis(2-ethylhexyl) phthalate decreases expression ISO Acss1 (Mus musculus) 6480464 Diethylhexyl Phthalate results in decreased expression of ACSS1 mRNA CTD PMID:35550907 Acss1 Rat bis(2-ethylhexyl) phthalate increases expression ISO Acss1 (Mus musculus) 6480464 Diethylhexyl Phthalate results in increased expression of ACSS1 mRNA CTD PMID:35550907 Acss1 Rat bisphenol A increases expression ISO Acss1 (Mus musculus) 6480464 bisphenol A results in increased expression of ACSS1 mRNA CTD PMID:26063408 Acss1 Rat bisphenol A decreases expression ISO Acss1 (Mus musculus) 6480464 bisphenol A results in decreased expression of ACSS1 mRNA CTD PMID:32156529 Acss1 Rat bisphenol A multiple interactions ISO ACSS1 (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in increased methylation of ACSS1 gene CTD PMID:31601247 Acss1 Rat bisphenol A affects methylation ISO ACSS1 (Homo sapiens) 6480464 bisphenol A affects the methylation of ACSS1 gene CTD PMID:31601247 Acss1 Rat bisphenol A decreases expression ISO ACSS1 (Homo sapiens) 6480464 bisphenol A results in decreased expression of ACSS1 protein CTD PMID:31675489 Acss1 Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of ACSS1 gene CTD PMID:28505145 Acss1 Rat bisphenol A affects methylation ISO Acss1 (Mus musculus) 6480464 bisphenol A affects the methylation of ACSS1 promoter CTD PMID:27334623 Acss1 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of ACSS1 mRNA CTD PMID:25181051 Acss1 Rat Butylbenzyl phthalate multiple interactions ISO Acss1 (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of ACSS1 mRNA CTD PMID:39150890 Acss1 Rat cadmium atom multiple interactions ISO Acss1 (Mus musculus) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of ACSS1 mRNA CTD PMID:37325564 Acss1 Rat cadmium dichloride multiple interactions ISO Acss1 (Mus musculus) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of ACSS1 mRNA CTD PMID:37325564 Acss1 Rat carbon nanotube decreases expression ISO Acss1 (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 Acss1 Rat CGP 52608 multiple interactions ISO ACSS1 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to ACSS1 gene] CTD PMID:28238834 Acss1 Rat choline multiple interactions ISO Acss1 (Mus musculus) 6480464 [Choline deficiency co-treated with Folic Acid deficiency co-treated with Methionine deficiency] results in increased expression of ACSS1 mRNA and [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of ACSS1 mRNA CTD PMID:20938992 and PMID:29127188 Acss1 Rat cocaine decreases expression EXP 6480464 Cocaine results in decreased expression of ACSS1 mRNA CTD PMID:27899881 Acss1 Rat copper atom multiple interactions ISO ACSS1 (Homo sapiens) 6480464 [NSC 689534 binds to Copper] which results in decreased expression of ACSS1 mRNA CTD PMID:20971185 Acss1 Rat copper atom increases expression EXP 6480464 Copper results in increased expression of ACSS1 mRNA CTD PMID:30556269 Acss1 Rat copper(0) multiple interactions ISO ACSS1 (Homo sapiens) 6480464 [NSC 689534 binds to Copper] which results in decreased expression of ACSS1 mRNA CTD PMID:20971185 Acss1 Rat copper(0) increases expression EXP 6480464 Copper results in increased expression of ACSS1 mRNA CTD PMID:30556269 Acss1 Rat copper(II) sulfate decreases expression ISO ACSS1 (Homo sapiens) 6480464 Copper Sulfate results in decreased expression of ACSS1 mRNA CTD PMID:19549813 Acss1 Rat Cuprizon increases expression EXP 6480464 Cuprizone results in increased expression of ACSS1 mRNA CTD PMID:26577399 and PMID:27523638 Acss1 Rat D-glucose increases expression ISO ACSS1 (Homo sapiens) 6480464 Glucose results in increased expression of ACSS1 mRNA CTD PMID:36156098 Acss1 Rat decabromodiphenyl ether increases expression ISO ACSS1 (Homo sapiens) 6480464 decabromobiphenyl ether results in increased expression of ACSS1 protein CTD PMID:31675489 Acss1 Rat dextran sulfate multiple interactions ISO Acss1 (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in increased expression of ACSS1 mRNA CTD PMID:29950665 Acss1 Rat dibutyl phthalate decreases expression ISO Acss1 (Mus musculus) 6480464 Dibutyl Phthalate results in decreased expression of ACSS1 mRNA CTD PMID:17361019 and PMID:21266533 Acss1 Rat dibutyl phthalate multiple interactions ISO Acss1 (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of ACSS1 mRNA CTD PMID:39150890 Acss1 Rat diethyl phthalate multiple interactions ISO Acss1 (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of ACSS1 mRNA CTD PMID:39150890 Acss1 Rat diethylstilbestrol increases expression ISO Acss1 (Mus musculus) 6480464 Diethylstilbestrol results in increased expression of ACSS1 mRNA CTD PMID:15289156 Acss1 Rat diisobutyl phthalate multiple interactions ISO Acss1 (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of ACSS1 mRNA CTD PMID:39150890 Acss1 Rat diisononyl phthalate multiple interactions ISO Acss1 (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of ACSS1 mRNA CTD PMID:39150890 Acss1 Rat dioxygen multiple interactions ISO Acss1 (Mus musculus) 6480464 [NFE2L2 protein affects the susceptibility to Oxygen] which affects the expression of ACSS1 mRNA CTD PMID:30529165 Acss1 Rat diuron decreases expression EXP 6480464 Diuron results in decreased expression of ACSS1 mRNA CTD PMID:21551480 Acss1 Rat dorsomorphin multiple interactions ISO ACSS1 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of ACSS1 mRNA CTD PMID:27188386 Acss1 Rat doxorubicin multiple interactions ISO Acss1 (Mus musculus) 6480464 [Doxorubicin co-treated with Dexrazoxane] results in increased expression of ACSS1 mRNA and Doxorubicin affects the reaction [SIRT1 protein affects the acetylation of ACSS1 protein] CTD PMID:26873546 and PMID:31768571 Acss1 Rat doxorubicin decreases acetylation ISO Acss1 (Mus musculus) 6480464 Doxorubicin results in decreased acetylation of ACSS1 protein CTD PMID:31768571 Acss1 Rat doxorubicin decreases expression ISO Acss1 (Mus musculus) 6480464 Doxorubicin results in decreased expression of ACSS1 mRNA CTD PMID:26873546 Acss1 Rat ethanol increases expression ISO Acss1 (Mus musculus) 6480464 Ethanol results in increased expression of ACSS1 mRNA CTD PMID:30319688 Acss1 Rat ethylparaben increases expression ISO ACSS1 (Homo sapiens) 6480464 ethyl-p-hydroxybenzoate results in increased expression of ACSS1 mRNA CTD PMID:37690743 Acss1 Rat folic acid multiple interactions ISO Acss1 (Mus musculus) 6480464 [1 more ... CTD PMID:20938992 more ... Acss1 Rat fulvestrant multiple interactions ISO ACSS1 (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in increased methylation of ACSS1 gene CTD PMID:31601247 Acss1 Rat genistein increases expression ISO Acss1 (Mus musculus) 6480464 Genistein results in increased expression of ACSS1 mRNA CTD PMID:15289156 Acss1 Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of ACSS1 mRNA CTD PMID:22061828 Acss1 Rat glucose increases expression ISO ACSS1 (Homo sapiens) 6480464 Glucose results in increased expression of ACSS1 mRNA CTD PMID:36156098 Acss1 Rat hydrogen peroxide affects expression ISO ACSS1 (Homo sapiens) 6480464 Hydrogen Peroxide affects the expression of ACSS1 mRNA CTD PMID:20044591 Acss1 Rat indole-3-methanol multiple interactions EXP 6480464 [indole-3-carbinol co-treated with Diethylnitrosamine co-treated with Acetylcysteine] results in decreased expression of ACSS1 mRNA CTD PMID:22129741 Acss1 Rat L-methionine multiple interactions ISO Acss1 (Mus musculus) 6480464 [Choline deficiency co-treated with Folic Acid deficiency co-treated with Methionine deficiency] results in increased expression of ACSS1 mRNA and [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of ACSS1 mRNA CTD PMID:20938992 and PMID:29127188 Acss1 Rat lead(0) decreases expression ISO ACSS1 (Homo sapiens) 6480464 Lead results in decreased expression of ACSS1 mRNA CTD PMID:19921347 Acss1 Rat leflunomide decreases expression ISO ACSS1 (Homo sapiens) 6480464 leflunomide results in decreased expression of ACSS1 mRNA CTD PMID:28988120 and PMID:29427785 Acss1 Rat lipopolysaccharide decreases expression ISO ACSS1 (Homo sapiens) 6480464 Lipopolysaccharides results in decreased expression of ACSS1 mRNA CTD PMID:35811015 Acss1 Rat lipopolysaccharide multiple interactions ISO ACSS1 (Homo sapiens) 6480464 [S-(1 and 2-dichlorovinyl)cysteine affects the susceptibility to Lipopolysaccharides] which results in increased expression of ACSS1 mRNA CTD PMID:35811015 Acss1 Rat MeIQx decreases expression ISO ACSS1 (Homo sapiens) 6480464 2-amino-3 more ... CTD PMID:20816883 Acss1 Rat menadione affects expression ISO ACSS1 (Homo sapiens) 6480464 Vitamin K 3 affects the expression of ACSS1 mRNA CTD PMID:20044591 Acss1 Rat N-acetyl-L-cysteine multiple interactions EXP 6480464 [indole-3-carbinol co-treated with Diethylnitrosamine co-treated with Acetylcysteine] results in decreased expression of ACSS1 mRNA CTD PMID:22129741 Acss1 Rat N-nitrosodiethylamine multiple interactions EXP 6480464 [indole-3-carbinol co-treated with Diethylnitrosamine co-treated with Acetylcysteine] results in decreased expression of ACSS1 mRNA CTD PMID:22129741 Acss1 Rat N-Nitrosopyrrolidine decreases expression ISO ACSS1 (Homo sapiens) 6480464 N-Nitrosopyrrolidine results in decreased expression of ACSS1 mRNA CTD PMID:32234424 Acss1 Rat O-methyleugenol decreases expression ISO ACSS1 (Homo sapiens) 6480464 methyleugenol results in decreased expression of ACSS1 mRNA CTD PMID:32234424 Acss1 Rat ochratoxin A increases methylation EXP 6480464 ochratoxin A results in increased methylation of ACSS1 gene CTD PMID:37162024 Acss1 Rat ochratoxin A decreases expression EXP 6480464 ochratoxin A results in decreased expression of ACSS1 mRNA CTD PMID:37162024 Acss1 Rat oxaliplatin decreases expression EXP 6480464 oxaliplatin results in decreased expression of ACSS1 mRNA CTD PMID:25729387 Acss1 Rat oxaliplatin multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of ACSS1 mRNA CTD PMID:25729387 Acss1 Rat paracetamol decreases expression ISO ACSS1 (Homo sapiens) 6480464 Acetaminophen results in decreased expression of ACSS1 mRNA CTD PMID:25704631 and PMID:29067470 Acss1 Rat paraquat decreases expression EXP 6480464 Paraquat results in decreased expression of ACSS1 mRNA CTD PMID:32680482 Acss1 Rat perfluorohexanesulfonic acid increases expression ISO Acss1 (Mus musculus) 6480464 perfluorohexanesulfonic acid results in increased expression of ACSS1 mRNA CTD PMID:21705711 and PMID:37995155 Acss1 Rat perfluorooctanoic acid increases expression ISO Acss1 (Mus musculus) 6480464 perfluorooctanoic acid results in increased expression of ACSS1 mRNA CTD PMID:30657992 Acss1 Rat pirinixic acid increases expression ISO Acss1 (Mus musculus) 6480464 pirinixic acid results in increased expression of ACSS1 mRNA CTD PMID:23811191 Acss1 Rat S-(1,2-dichlorovinyl)-L-cysteine multiple interactions ISO ACSS1 (Homo sapiens) 6480464 [S-(1 and 2-dichlorovinyl)cysteine affects the susceptibility to Lipopolysaccharides] which results in increased expression of ACSS1 mRNA CTD PMID:35811015 Acss1 Rat SB 431542 multiple interactions ISO ACSS1 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of ACSS1 mRNA CTD PMID:27188386 Acss1 Rat sodium acetate trihydrate increases expression ISO ACSS1 (Homo sapiens) 6480464 Sodium Acetate results in increased expression of ACSS1 mRNA CTD PMID:36156098 Acss1 Rat sodium arsenite multiple interactions ISO Acss1 (Mus musculus) 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of ACSS1 mRNA CTD PMID:32045263 Acss1 Rat streptozocin multiple interactions ISO Acss1 (Mus musculus) 6480464 [Streptozocin co-treated with Dietary Fats] results in increased expression of ACSS1 mRNA CTD PMID:29127188 Acss1 Rat sunitinib increases expression ISO ACSS1 (Homo sapiens) 6480464 Sunitinib results in increased expression of ACSS1 mRNA CTD PMID:31533062 Acss1 Rat tebuconazole decreases expression ISO ACSS1 (Homo sapiens) 6480464 tebuconazole results in decreased expression of ACSS1 mRNA CTD PMID:30458266 Acss1 Rat temozolomide increases expression ISO ACSS1 (Homo sapiens) 6480464 Temozolomide results in increased expression of ACSS1 mRNA CTD PMID:31758290 Acss1 Rat testosterone decreases expression ISO Acss1 (Mus musculus) 6480464 Testosterone results in decreased expression of ACSS1 mRNA CTD PMID:20403060 Acss1 Rat testosterone increases expression ISO Acss1 (Mus musculus) 6480464 Testosterone deficiency results in increased expression of ACSS1 mRNA CTD PMID:33848595 Acss1 Rat thioacetamide affects expression EXP 6480464 Thioacetamide affects the expression of ACSS1 mRNA CTD PMID:34492290 Acss1 Rat titanium dioxide decreases expression ISO Acss1 (Mus musculus) 6480464 titanium dioxide results in decreased expression of ACSS1 mRNA CTD PMID:27760801 Acss1 Rat titanium dioxide multiple interactions ISO Acss1 (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in increased expression of ACSS1 mRNA CTD PMID:29950665 Acss1 Rat topotecan multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of ACSS1 mRNA CTD PMID:25729387 Acss1 Rat topotecan decreases expression EXP 6480464 Topotecan results in decreased expression of ACSS1 mRNA CTD PMID:25729387 Acss1 Rat tributylstannane increases expression ISO Acss1 (Mus musculus) 6480464 tributyltin results in increased expression of ACSS1 mRNA CTD PMID:31939706 Acss1 Rat trichloroethene decreases expression EXP 6480464 Trichloroethylene results in decreased expression of ACSS1 mRNA CTD PMID:33387578 Acss1 Rat trovafloxacin decreases expression ISO Acss1 (Mus musculus) 6480464 trovafloxacin results in decreased expression of ACSS1 mRNA CTD PMID:35537566 Acss1 Rat urethane decreases expression ISO ACSS1 (Homo sapiens) 6480464 Urethane results in decreased expression of ACSS1 mRNA CTD PMID:28818685 Acss1 Rat valproic acid increases expression ISO Acss1 (Mus musculus) 6480464 Valproic Acid results in increased expression of ACSS1 mRNA CTD PMID:21427059 Acss1 Rat valproic acid multiple interactions ISO ACSS1 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of ACSS1 mRNA CTD PMID:27188386 Acss1 Rat valproic acid increases expression ISO ACSS1 (Homo sapiens) 6480464 Valproic Acid results in increased expression of ACSS1 mRNA CTD PMID:23179753 and PMID:26272509 Acss1 Rat vancomycin increases expression ISO Acss1 (Mus musculus) 6480464 Vancomycin results in increased expression of ACSS1 mRNA CTD PMID:18930951 Acss1 Rat vinclozolin decreases methylation EXP 6480464 vinclozolin results in decreased methylation of ACSS1 gene CTD PMID:31079544
Imported Annotations - SMPDB
Imported Annotations - KEGG (archival)
(+)-dexrazoxane (ISO) 1,1-dichloroethene (ISO) 1,2-dimethylhydrazine (ISO) 17beta-estradiol (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,2',5,5'-tetrachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP) 2,4,6-tribromophenol (ISO) 3,3',5,5'-tetrabromobisphenol A (ISO) 6-propyl-2-thiouracil (EXP) acetamide (EXP) acrylamide (EXP,ISO) aflatoxin B1 (ISO) aldehydo-D-glucose (ISO) amphetamine (EXP) arsane (ISO) arsenic atom (ISO) arsenite(3-) (ISO) Azoxymethane (ISO) benzo[a]pyrene (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) Butylbenzyl phthalate (ISO) cadmium atom (ISO) cadmium dichloride (ISO) carbon nanotube (ISO) CGP 52608 (ISO) choline (ISO) cocaine (EXP) copper atom (EXP,ISO) copper(0) (EXP,ISO) copper(II) sulfate (ISO) Cuprizon (EXP) D-glucose (ISO) decabromodiphenyl ether (ISO) dextran sulfate (ISO) dibutyl phthalate (ISO) diethyl phthalate (ISO) diethylstilbestrol (ISO) diisobutyl phthalate (ISO) diisononyl phthalate (ISO) dioxygen (ISO) diuron (EXP) dorsomorphin (ISO) doxorubicin (ISO) ethanol (ISO) ethylparaben (ISO) folic acid (ISO) fulvestrant (ISO) genistein (ISO) gentamycin (EXP) glucose (ISO) hydrogen peroxide (ISO) indole-3-methanol (EXP) L-methionine (ISO) lead(0) (ISO) leflunomide (ISO) lipopolysaccharide (ISO) MeIQx (ISO) menadione (ISO) N-acetyl-L-cysteine (EXP) N-nitrosodiethylamine (EXP) N-Nitrosopyrrolidine (ISO) O-methyleugenol (ISO) ochratoxin A (EXP) oxaliplatin (EXP) paracetamol (ISO) paraquat (EXP) perfluorohexanesulfonic acid (ISO) perfluorooctanoic acid (ISO) pirinixic acid (ISO) S-(1,2-dichlorovinyl)-L-cysteine (ISO) SB 431542 (ISO) sodium acetate trihydrate (ISO) sodium arsenite (ISO) streptozocin (ISO) sunitinib (ISO) tebuconazole (ISO) temozolomide (ISO) testosterone (ISO) thioacetamide (EXP) titanium dioxide (ISO) topotecan (EXP) tributylstannane (ISO) trichloroethene (EXP) trovafloxacin (ISO) urethane (ISO) valproic acid (ISO) vancomycin (ISO) vinclozolin (EXP)
1.
The subcellular distribution of short-chain fatty acyl-CoA synthetase activity in rat tissues.
Barth C, etal., Biochim Biophys Acta. 1971 Oct 5;248(1):24-33.
2.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.
Glucose-independent Acetate Metabolism Promotes Melanoma Cell Survival and Tumor Growth.
Lakhter AJ, etal., J Biol Chem. 2016 Oct 14;291(42):21869-21879. doi: 10.1074/jbc.M115.712166. Epub 2016 Aug 18.
4.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
5.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
6.
SMPDB Annotation Import Pipeline
Pipeline to import SMPDB annotations from SMPDB into RGD
7.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
8.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
9.
Fasting-induced hypothermia and reduced energy production in mice lacking acetyl-CoA synthetase 2.
Sakakibara I, etal., Cell Metab. 2009 Feb;9(2):191-202. doi: 10.1016/j.cmet.2008.12.008.
10.
Evidence for 26 distinct acyl-coenzyme A synthetase genes in the human genome.
Watkins PA, etal., J Lipid Res. 2007 Dec;48(12):2736-50. Epub 2007 Aug 30.
Acss1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 3 159,910,809 - 159,960,748 (-) NCBI GRCr8 mRatBN7.2 3 139,450,383 - 139,500,325 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 3 139,450,383 - 139,500,325 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 3 143,346,852 - 143,396,694 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 3 151,930,593 - 151,980,423 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 3 149,678,658 - 149,728,584 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 3 146,420,346 - 146,470,293 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 3 146,420,346 - 146,470,293 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 3 152,779,621 - 152,829,324 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 3 141,259,016 - 141,308,871 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 3 141,164,598 - 141,235,812 (-) NCBI Celera 3 138,212,667 - 138,262,509 (-) NCBI Celera Cytogenetic Map 3 q41 NCBI
ACSS1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 20 25,006,237 - 25,058,139 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 20 25,006,230 - 25,058,980 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 20 24,986,873 - 25,038,775 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 20 24,934,873 - 24,987,616 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 20 24,934,873 - 24,987,616 NCBI Celera 20 25,060,679 - 25,113,427 (-) NCBI Celera Cytogenetic Map 20 p11.21 NCBI HuRef 20 24,943,703 - 24,995,659 (-) NCBI HuRef CHM1_1 20 24,987,355 - 25,039,309 (-) NCBI CHM1_1 T2T-CHM13v2.0 20 25,070,421 - 25,122,324 (-) NCBI T2T-CHM13v2.0
Acss1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 2 150,460,031 - 150,510,160 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 2 150,460,025 - 150,510,420 (-) Ensembl GRCm39 Ensembl GRCm38 2 150,618,111 - 150,668,240 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 2 150,618,105 - 150,668,500 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 2 150,443,847 - 150,493,976 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 2 150,309,552 - 150,359,670 (-) NCBI MGSCv36 mm8 Celera 2 151,852,988 - 151,903,233 (-) NCBI Celera Cytogenetic Map 2 G3 NCBI cM Map 2 74.74 NCBI
Acss1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955415 31,117,303 - 31,154,654 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955415 31,117,542 - 31,154,654 (-) NCBI ChiLan1.0 ChiLan1.0
ACSS1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 21 25,877,357 - 25,932,094 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 20 25,874,190 - 25,928,929 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 20 24,946,629 - 25,001,311 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 20 25,294,186 - 25,348,109 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 20 25,293,511 - 25,349,017 (-) Ensembl panpan1.1 panPan2
ACSS1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 23 1,192,771 - 1,251,724 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 23 1,184,392 - 1,252,255 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 23 1,222,892 - 1,281,311 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 23 1,435,773 - 1,494,208 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 23 1,435,776 - 1,494,754 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 23 1,251,020 - 1,309,471 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 23 1,381,192 - 1,439,604 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 23 1,364,196 - 1,422,653 (-) NCBI UU_Cfam_GSD_1.0
Acss1
ACSS1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 17 30,800,427 - 30,839,742 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 17 30,800,536 - 30,839,799 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 17 34,949,412 - 34,988,665 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
LOC103247057 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Vero_WHO_p1.0 NW_023666087 2,048,170 - 2,100,706 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Acss1
.
Predicted Target Of
Count of predictions: 811 Count of miRNA genes: 294 Interacting mature miRNAs: 391 Transcripts: ENSRNOT00000009627 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
2312673 Scl63 Serum cholesterol level QTL 63 0.001 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 3 98535255 168026850 Rat 1598877 Bp285 Blood pressure QTL 285 1.5 0.03 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 3 120538241 165538241 Rat 1578653 Vnigr3 Vascular neointimal growth QTL 3 3.1 artery morphology trait (VT:0002191) artery neointimal hyperplastic lesion area (CMO:0001414) 3 130656562 169034231 Rat 2302373 Gluco39 Glucose level QTL 39 5.01 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 3 98535386 161695835 Rat 70216 Cm14 Cardiac mass QTL 14 2.1 heart mass (VT:0007028) heart wet weight (CMO:0000069) 3 31172320 163586636 Rat 2292591 Esta4 Estrogen-induced thymic atrophy QTL 4 thymus mass (VT:0004954) thymus wet weight (CMO:0000855) 3 47233211 147415807 Rat 2298477 Eau4 Experimental allergic uveoretinitis QTL 4 0.0011 uvea integrity trait (VT:0010551) experimental autoimmune uveitis score (CMO:0001504) 3 137398739 169034231 Rat 1581568 Rf53 Renal function QTL 53 urine total protein amount (VT:0000032) urine protein excretion rate to body weight ratio (CMO:0001099) 3 56395968 161299569 Rat 1578754 Stresp16 Stress response QTL 16 4 0.001 blood renin amount (VT:0003349) plasma renin activity level (CMO:0000116) 3 112681431 157681431 Rat 1300173 Rf11 Renal function QTL 11 3.38 renal blood flow trait (VT:2000006) absolute change in renal blood flow rate (CMO:0001168) 3 121056165 145956249 Rat 9589106 Insul23 Insulin level QTL 23 13.86 0.001 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 3 131635904 169034231 Rat 10755461 Coatc16 Coat color QTL 16 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 3 122438700 167438700 Rat 8662816 Vetf4 Vascular elastic tissue fragility QTL 4 4 renal artery integrity trait (VT:0010642) number of ruptures of the internal elastic lamina of the renal arteries (CMO:0002563) 3 59242096 157323038 Rat 1559282 Emca5 Estrogen-induced mammary cancer QTL 5 3.9 mammary gland integrity trait (VT:0010552) percentage of study population developing mammary tumors during a period of time (CMO:0000948) 3 43827364 169034231 Rat 1354611 Despr2 Despair related QTL 2 3.03 0.0028 locomotor behavior trait (VT:0001392) amount of time spent in voluntary immobility (CMO:0001043) 3 97084464 142084464 Rat 2303620 Vencon4 Ventilatory control QTL 4 3.9 respiration trait (VT:0001943) tidal volume (CMO:0000222) 3 127162703 168026850 Rat 631841 Niddm39 Non-insulin dependent diabetes mellitus QTL 39 3.36 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 3 94856903 159898684 Rat 1576306 Schws3 Schwannoma susceptibility QTL 3 0.001 nervous system integrity trait (VT:0010566) percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017) 3 118839124 163839124 Rat 619618 Rf3 Renal disease susceptibility QTL 3 6.5 0.001 urine albumin amount (VT:0002871) urine albumin excretion rate to body weight ratio (CMO:0001270) 3 107693393 152693393 Rat 1300159 Kidm4 Kidney mass QTL 4 3.83 kidney mass (VT:0002707) right kidney wet weight to body weight ratio (CMO:0001953) 3 121056165 157309487 Rat 2301971 Cm71 Cardiac mass QTL 71 4.63 heart left ventricle mass (VT:0007031) heart left ventricle weight (CMO:0000776) 3 41874578 155617519 Rat 2312659 Slep7 Serum leptin concentration QTL 7 0.001 blood leptin amount (VT:0005667) serum leptin level (CMO:0000780) 3 98535255 168026850 Rat 631673 Iddm13 Insulin dependent diabetes mellitus QTL 13 1.3 0.663 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 3 130193298 161695983 Rat 2301970 Bw81 Body weight QTL 81 5.19 body mass (VT:0001259) body weight (CMO:0000012) 3 41874578 155617519 Rat 1581546 Pur13 Proteinuria QTL 13 2.93 0.0335 urine total protein amount (VT:0000032) urine protein excretion rate (CMO:0000759) 3 78196190 146592722 Rat 1578656 Vnigr2 Vascular neointimal growth QTL 2 4.2 artery morphology trait (VT:0002191) lesioned artery residual lumen area (CMO:0001417) 3 130656562 169034231 Rat 8552952 Pigfal13 Plasma insulin-like growth factor 1 level QTL 13 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 3 138799500 169034231 Rat 631541 Bp81 Blood pressure QTL 81 4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 3 124122556 169034231 Rat 2293087 Iddm27 Insulin dependent diabetes mellitus QTL 27 2.68 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 3 97551417 147415807 Rat 2312670 Bw94 Body weight QTL 94 0.01 inguinal fat pad mass (VT:0010424) inguinal fat pad weight to body weight ratio (CMO:0001253) 3 98535255 168026850 Rat 724532 Cm17 Cardiac mass QTL 17 2 heart mass (VT:0007028) calculated heart weight (CMO:0000073) 3 95735366 140735366 Rat
D3Rat148
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 3 159,917,263 - 159,917,474 (+) Marker Load Pipeline Rnor_6.0 3 146,426,801 - 146,427,014 NCBI Rnor6.0 Rnor_5.0 3 152,786,076 - 152,786,289 UniSTS Rnor5.0 RGSC_v3.4 3 141,265,470 - 141,265,676 RGD RGSC3.4 RGSC_v3.4 3 141,265,471 - 141,265,676 UniSTS RGSC3.4 RGSC_v3.1 3 141,171,043 - 141,171,249 RGD Celera 3 138,219,122 - 138,219,291 UniSTS SHRSP x BN Map 3 65.2999 RGD SHRSP x BN Map 3 65.2999 UniSTS Cytogenetic Map 3 q41 UniSTS
BF389773
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 3 139,463,124 - 139,463,298 (+) MAPPER mRatBN7.2 Rnor_6.0 3 146,433,095 - 146,433,268 NCBI Rnor6.0 Rnor_5.0 3 152,792,370 - 152,792,543 UniSTS Rnor5.0 RGSC_v3.4 3 141,271,757 - 141,271,930 UniSTS RGSC3.4 Celera 3 138,225,372 - 138,225,545 UniSTS RH 3.4 Map 3 1197.32 UniSTS Cytogenetic Map 3 q41 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000009627 ⟹ ENSRNOP00000009627
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 3 139,450,383 - 139,500,325 (-) Ensembl Rnor_6.0 Ensembl 3 146,420,346 - 146,470,293 (-) Ensembl
RefSeq Acc Id:
NM_001106524 ⟹ NP_001099994
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 159,910,809 - 159,960,748 (-) NCBI mRatBN7.2 3 139,450,383 - 139,500,325 (-) NCBI Rnor_6.0 3 146,420,346 - 146,470,293 (-) NCBI Rnor_5.0 3 152,779,621 - 152,829,324 (-) NCBI RGSC_v3.4 3 141,259,016 - 141,308,871 (-) RGD Celera 3 138,212,667 - 138,262,509 (-) RGD
Sequence:
GGCTCCTGCACCCGCGTGGGGCGTCGGGCGAGATGGCGGCGCGCAGCCTCGGCAGCGGTGTGGGGCGACTGCTGCGTGGCCTGCACGGGCACTCGGGACAATCGGGGTGGTTGCTGAGCCTGTCCCGC
hide sequence
RefSeq Acc Id:
NP_001099994 ⟸ NM_001106524
- UniProtKB:
D3ZZN3 (UniProtKB/TrEMBL), A6KHF6 (UniProtKB/TrEMBL)
- Sequence:
MAARSLGSGVGRLLRGLHGHSGQSGWLLSLSRWTTTRFLGSVPAAAQLGSYPALSAQAAQEPAAFWGPLARDTLVWDTPYHTVWDCDFRTGKIGWFLGGQLNVSVNCLDQHVQKSPDTIALIWERDEP
hide sequence
Ensembl Acc Id:
ENSRNOP00000009627 ⟸ ENSRNOT00000009627
RGD ID: 13692516 Promoter ID: EPDNEW_R3041 Type: multiple initiation site Name: Acss1_1 Description: acyl-CoA synthetase short-chain family member 1 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 3 146,470,278 - 146,470,338 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2008-04-30
Acss1
acyl-CoA synthetase short-chain family member 1
Acss1_predicted
acyl-CoA synthetase short-chain family member 1 (predicted)
'predicted' is removed
2292626 APPROVED
2008-01-09
Acss1_predicted
acyl-CoA synthetase short-chain family member 1 (predicted)
LOC681886
similar to acetyl-CoA synthetase 2-like
Data merged from RGD:1590480
1643240 APPROVED
2006-11-20
LOC681886
similar to acetyl-CoA synthetase 2-like
Symbol and Name status set to provisional
70820 PROVISIONAL
2006-03-30
Acss1_predicted
acyl-CoA synthetase short-chain family member 1 (predicted)
Acas2l_predicted
acetyl-Coenzyme A synthetase 2 (AMP forming)-like (predicted)
Symbol and Name updated
1299863 APPROVED
2005-01-12
Acas2l_predicted
acetyl-Coenzyme A synthetase 2 (AMP forming)-like (predicted)
Symbol and Name status set to approved
70820 APPROVED
