Epb42 (erythrocyte membrane protein band 4.2) - Rat Genome Database

Epb42 (erythrocyte membrane protein band 4.2) - Rat Genome Database

Submit Data | Help | Video Tutorials | News | Publications | Download | REST API | Citing RGD | Contact

Advanced Search (OLGA)

Gene: Epb42 (erythrocyte membrane protein band 4.2) Rattus norvegicus

Subscribe to Updates

Symbol:

Epb42

Name:

erythrocyte membrane protein band 4.2

RGD ID:

1305306

Description:

Predicted to enable protein-glutamine gamma-glutamyltransferase activity. Predicted to act upstream of or within several processes, including hemoglobin metabolic process; multicellular organismal-level iron ion homeostasis; and spleen development. Predicted to be located in cortical cytoskeleton and membrane. Predicted to be part of ankyrin-1 complex. Human ortholog(s) of this gene implicated in hereditary spherocytosis and hereditary spherocytosis type 5. Orthologous to human EPB42 (erythrocyte membrane protein band 4.2); INTERACTS WITH 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine; 4,4'-sulfonyldiphenol.

Type:

protein-coding

RefSeq Status:

Previously known as:

Epb4.2; erythrocyte protein band 4.2; LOC362202

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	128,433,460 - 128,451,683 (-)	NCBI		GRCr8
mRatBN7.2	3	107,979,709 - 107,997,932 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	107,979,713 - 107,997,932 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	3	111,651,371 - 111,669,669 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	120,246,950 - 120,265,248 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	117,907,354 - 117,925,652 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	112,967,095 - 112,985,318 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	112,965,653 - 112,985,318 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	3	119,509,972 - 119,528,195 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	3	107,806,273 - 107,824,496 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	3	107,703,057 - 107,723,679 (-)	NCBI
Celera	3	106,882,884 - 106,901,107 (-)	NCBI		Celera
Cytogenetic Map	3	q35	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Epb42	Rat	hereditary spherocytosis		ISO	EPB42 (Homo sapiens)	1598910		RGD

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Epb42	Rat	Bloom syndrome		ISO	EPB42 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Bloom syndrome	ClinVar	PMID:28492532
Epb42	Rat	colorectal cancer		ISO	EPB42 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Familial colorectal cancer	ClinVar	PMID:28492532
Epb42	Rat	genetic disease		ISO	EPB42 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Inborn genetic diseases	ClinVar	PMID:25741868 and PMID:28492532
Epb42	Rat	hereditary spherocytosis		ISO	EPB42 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Spherocytosis and Recessive	ClinVar	PMID:28492532
Epb42	Rat	hereditary spherocytosis type 5		ISO	EPB42 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Hereditary spherocytosis type 5	ClinVar	PMID:10406914 more ...

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Epb42	Rat	hereditary spherocytosis type 5		ISO	EPB42 (Homo sapiens)	11554173	CTD Direct Evidence: marker/mechanism	CTD

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Epb42	Rat	hereditary spherocytosis type 1		ISS	Epb42 (Mus musculus)	13592920	OMIM:182900	MouseDO

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Epb42	Rat	hereditary spherocytosis type 5		ISO	EPB42 (Homo sapiens)	7240710		OMIM

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Epb42	Rat	17beta-estradiol	increases expression	EXP		6480464	Estradiol results in increased expression of EPB42 mRNA	CTD	PMID:32145629
Epb42	Rat	2,2',4,4',5,5'-hexachlorobiphenyl	multiple interactions	ISO	Epb42 (Mus musculus)	6480464	[NR1I2 protein affects the susceptibility to 2 more ...	CTD	PMID:32352317
Epb42	Rat	2,3,7,8-tetrachlorodibenzodioxine	increases expression	ISO	Epb42 (Mus musculus)	6480464	Tetrachlorodibenzodioxin results in increased expression of EPB42 mRNA	CTD	PMID:28213091
Epb42	Rat	2,3,7,8-tetrachlorodibenzodioxine	increases expression	EXP		6480464	Tetrachlorodibenzodioxin results in increased expression of EPB42 mRNA	CTD	PMID:33387578
Epb42	Rat	2-butoxyethanol	increases expression	ISO	Epb42 (Mus musculus)	6480464	n-butoxyethanol results in increased expression of EPB42 mRNA	CTD	PMID:19812364
Epb42	Rat	4,4'-diaminodiphenylmethane	increases expression	ISO	Epb42 (Mus musculus)	6480464	4 and 4'-diaminodiphenylmethane results in increased expression of EPB42 mRNA	CTD	PMID:18648102
Epb42	Rat	4,4'-sulfonyldiphenol	multiple interactions	EXP		6480464	[bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of EPB42 mRNA	CTD	PMID:36041667
Epb42	Rat	6-propyl-2-thiouracil	decreases expression	EXP		6480464	Propylthiouracil results in decreased expression of EPB42 mRNA	CTD	PMID:24780913
Epb42	Rat	aconitine	increases expression	EXP		6480464	Aconitine results in increased expression of EPB42 protein	CTD	PMID:33236894
Epb42	Rat	acrylamide	decreases expression	EXP		6480464	Acrylamide results in decreased expression of EPB42 mRNA	CTD	PMID:28959563
Epb42	Rat	aflatoxin B1	increases methylation	ISO	EPB42 (Homo sapiens)	6480464	Aflatoxin B1 results in increased methylation of EPB42 gene	CTD	PMID:27153756
Epb42	Rat	aldehydo-D-glucose	multiple interactions	ISO	Epb42 (Mus musculus)	6480464	[lard co-treated with Cholesterol and Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose] results in decreased expression of EPB42 mRNA	CTD	PMID:37567420
Epb42	Rat	benzo[a]pyrene	increases methylation	ISO	EPB42 (Homo sapiens)	6480464	Benzo(a)pyrene results in increased methylation of EPB42 promoter	CTD	PMID:27901495
Epb42	Rat	benzo[a]pyrene	decreases methylation	ISO	Epb42 (Mus musculus)	6480464	Benzo(a)pyrene results in decreased methylation of EPB42 exon and Benzo(a)pyrene results in decreased methylation of EPB42 intron	CTD	PMID:27901495
Epb42	Rat	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of EPB42 mRNA	CTD	PMID:25181051 more ...
Epb42	Rat	bisphenol A	multiple interactions	EXP		6480464	[bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of EPB42 mRNA	CTD	PMID:36041667
Epb42	Rat	bisphenol A	increases expression	EXP		6480464	bisphenol A results in increased expression of EPB42 mRNA	CTD	PMID:32145629 and PMID:34947998
Epb42	Rat	bisphenol F	multiple interactions	EXP		6480464	[bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of EPB42 mRNA	CTD	PMID:36041667
Epb42	Rat	calcium silicate	increases expression	ISO	Epb42 (Mus musculus)	6480464	calcium silicate results in increased expression of EPB42 mRNA	CTD	PMID:29279043
Epb42	Rat	CGP 52608	multiple interactions	ISO	EPB42 (Homo sapiens)	6480464	CGP 52608 promotes the reaction [RORA protein binds to EPB42 gene]	CTD	PMID:28238834
Epb42	Rat	chlorpyrifos	decreases expression	ISO	Epb42 (Mus musculus)	6480464	Chlorpyrifos results in decreased expression of EPB42 mRNA	CTD	PMID:37019170
Epb42	Rat	D-glucose	multiple interactions	ISO	Epb42 (Mus musculus)	6480464	[lard co-treated with Cholesterol and Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose] results in decreased expression of EPB42 mRNA	CTD	PMID:37567420
Epb42	Rat	dibutyl phthalate	increases expression	ISO	Epb42 (Mus musculus)	6480464	Dibutyl Phthalate results in increased expression of EPB42 mRNA	CTD	PMID:21266533
Epb42	Rat	dioxygen	increases expression	ISO	Epb42 (Mus musculus)	6480464	Oxygen deficiency results in increased expression of EPB42 mRNA	CTD	PMID:22629407
Epb42	Rat	dioxygen	multiple interactions	ISO	Epb42 (Mus musculus)	6480464	Oxygen inhibits the reaction [Oxygen deficiency results in increased expression of EPB42 mRNA]	CTD	PMID:22629407
Epb42	Rat	fructose	multiple interactions	ISO	Epb42 (Mus musculus)	6480464	[lard co-treated with Cholesterol and Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose] results in decreased expression of EPB42 mRNA	CTD	PMID:37567420
Epb42	Rat	genistein	decreases expression	ISO	Epb42 (Mus musculus)	6480464	Genistein results in decreased expression of EPB42 mRNA	CTD	PMID:21048042
Epb42	Rat	gentamycin	decreases expression	EXP		6480464	Gentamicins results in decreased expression of EPB42 mRNA	CTD	PMID:33387578
Epb42	Rat	glucose	multiple interactions	ISO	Epb42 (Mus musculus)	6480464	[lard co-treated with Cholesterol and Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose] results in decreased expression of EPB42 mRNA	CTD	PMID:37567420
Epb42	Rat	nitrofen	increases expression	EXP		6480464	nitrofen results in increased expression of EPB42 mRNA	CTD	PMID:33484710
Epb42	Rat	oxaliplatin	multiple interactions	EXP		6480464	[oxaliplatin co-treated with Topotecan] results in decreased expression of EPB42 mRNA and [Topotecan co-treated with oxaliplatin] results in decreased expression of EPB42 mRNA	CTD	PMID:25729387
Epb42	Rat	oxaliplatin	decreases expression	EXP		6480464	oxaliplatin results in decreased expression of EPB42 mRNA	CTD	PMID:25729387
Epb42	Rat	paracetamol	decreases expression	EXP		6480464	Acetaminophen results in decreased expression of EPB42 mRNA	CTD	PMID:33387578
Epb42	Rat	T-2 toxin	increases expression	ISO	EPB42 (Homo sapiens)	6480464	T-2 Toxin results in increased expression of EPB42 mRNA	CTD	PMID:34581912
Epb42	Rat	tert-butyl hydroperoxide	increases degradation	ISO	EPB42 (Homo sapiens)	6480464	tert-Butylhydroperoxide results in increased degradation of EPB42 protein	CTD	PMID:15040847
Epb42	Rat	thioacetamide	increases expression	EXP		6480464	Thioacetamide results in increased expression of EPB42 mRNA	CTD	PMID:34492290
Epb42	Rat	topotecan	multiple interactions	EXP		6480464	[oxaliplatin co-treated with Topotecan] results in decreased expression of EPB42 mRNA and [Topotecan co-treated with oxaliplatin] results in decreased expression of EPB42 mRNA	CTD	PMID:25729387
Epb42	Rat	topotecan	decreases expression	EXP		6480464	Topotecan results in decreased expression of EPB42 mRNA	CTD	PMID:25729387
Epb42	Rat	triclosan	increases expression	ISO	EPB42 (Homo sapiens)	6480464	Triclosan results in increased expression of EPB42 mRNA	CTD	PMID:30510588
Epb42	Rat	triptonide	increases expression	ISO	Epb42 (Mus musculus)	6480464	triptonide results in increased expression of EPB42 mRNA	CTD	PMID:33045310
Epb42	Rat	valproic acid	affects expression	ISO	Epb42 (Mus musculus)	6480464	Valproic Acid affects the expression of EPB42 mRNA	CTD	PMID:17292431

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Epb42	Rat	biological_process		ND		1598407	06/2016: no relevant rat data	RGD
Epb42	Rat	cell morphogenesis	acts_upstream_of_or_within	ISO	Epb42 (Mus musculus)	1624291	MGI:2182816 PMID:10359562	RGD	PMID:10359562
Epb42	Rat	hemoglobin metabolic process	acts_upstream_of_or_within	ISO	Epb42 (Mus musculus)	1624291	MGI:2182816 PMID:10359562	RGD	PMID:10359562
Epb42	Rat	monoatomic ion homeostasis	acts_upstream_of_or_within	ISO	Epb42 (Mus musculus)	1624291	MGI:2182816 PMID:10359562	RGD	PMID:10359562
Epb42	Rat	multicellular organismal-level iron ion homeostasis	acts_upstream_of_or_within	ISO	Epb42 (Mus musculus)	1624291	MGI:2182816 PMID:10359562	RGD	PMID:10359562
Epb42	Rat	spleen development	acts_upstream_of_or_within	ISO	Epb42 (Mus musculus)	1624291	MGI:2182816 PMID:10359562	RGD	PMID:10359562

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Epb42	Rat	ankyrin-1 complex	part_of	ISO	EPB42 (Homo sapiens)	1624291	PMID:35835865	RGD	PMID:35835865
Epb42	Rat	cortical cytoskeleton	located_in	ISO	Epb42 (Mus musculus)	1624291	PMID:18723693	RGD	PMID:18723693
Epb42	Rat	membrane	located_in	ISO	Epb42 (Mus musculus)	1624291	PMID:18723693	RGD	PMID:18723693

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Epb42	Rat	protein binding	enables	ISO	EPB42 (Homo sapiens)	1624291	UniProtKB:P58062 more ...	RGD	PMID:12646258 more ...
Epb42	Rat	protein-glutamine gamma-glutamyltransferase activity	enables	IEA	InterPro:IPR008958 more ...	1600115	GO_REF:0000002	InterPro	GO_REF:0000002

#	Reference Title	Reference Citation
1.	An alanine-to-threonine substitution in protein 4.2 cDNA is associated with a Japanese form of hereditary hemolytic anemia (protein 4.2NIPPON).	Bouhassira EE, etal., Blood. 1992 Apr 1;79(7):1846-54.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
4.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
5.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
6.	GOA pipeline	RGD automated data pipeline
7.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
8.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
9.	Comprehensive gene review and curation	RGD comprehensive gene curation

PMID:10359562	PMID:12477932	PMID:18723693

Epb42
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	128,433,460 - 128,451,683 (-)	NCBI		GRCr8
mRatBN7.2	3	107,979,709 - 107,997,932 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	107,979,713 - 107,997,932 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	3	111,651,371 - 111,669,669 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	120,246,950 - 120,265,248 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	117,907,354 - 117,925,652 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	112,967,095 - 112,985,318 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	112,965,653 - 112,985,318 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	3	119,509,972 - 119,528,195 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	3	107,806,273 - 107,824,496 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	3	107,703,057 - 107,723,679 (-)	NCBI
Celera	3	106,882,884 - 106,901,107 (-)	NCBI		Celera
Cytogenetic Map	3	q35	NCBI

EPB42
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	15	43,197,227 - 43,225,737 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	15	43,197,227 - 43,221,018 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	15	43,489,425 - 43,513,216 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	15	41,276,720 - 41,300,773 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	15	41,276,719 - 41,300,773	NCBI
Celera	15	20,260,253 - 20,284,152 (-)	NCBI		Celera
Cytogenetic Map	15	q15.2	NCBI
HuRef	15	20,338,220 - 20,362,120 (-)	NCBI		HuRef
CHM1_1	15	43,608,206 - 43,632,105 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	15	41,004,516 - 41,033,028 (-)	NCBI		T2T-CHM13v2.0

Epb42
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	2	120,848,372 - 120,867,358 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	2	120,848,372 - 120,867,553 (-)	Ensembl		GRCm39 Ensembl
GRCm38	2	121,017,891 - 121,036,877 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	2	121,017,891 - 121,037,072 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	2	120,843,953 - 120,862,491 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	2	120,709,658 - 120,728,196 (-)	NCBI		MGSCv36	mm8
Celera	2	122,170,412 - 122,188,962 (-)	NCBI		Celera
Cytogenetic Map	2	E5	NCBI
cM Map	2	60.37	NCBI

Epb42
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955416	9,784,260 - 9,798,194 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955416	9,784,211 - 9,800,453 (-)	NCBI	ChiLan1.0	ChiLan1.0

EPB42
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	16	32,448,060 - 32,481,629 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	15	36,608,897 - 36,643,381 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	15	22,157,831 - 22,183,254 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	15	40,313,462 - 40,337,458 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	15	40,313,462 - 40,337,458 (-)	Ensembl	panpan1.1		panPan2

EPB42
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	30	10,065,352 - 10,085,021 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	30	10,065,469 - 10,084,976 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	30	10,124,435 - 10,143,997 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	30	10,201,518 - 10,221,080 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	30	10,201,616 - 10,221,099 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	30	10,118,341 - 10,137,883 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	30	10,239,312 - 10,258,862 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	30	10,359,057 - 10,378,759 (-)	NCBI		UU_Cfam_GSD_1.0

Epb42
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024408640	88,529,093 - 88,547,882 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936471	6,377,775 - 6,395,753 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936471	6,377,232 - 6,393,588 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

EPB42
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	1	128,231,997 - 128,253,031 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	1	128,231,863 - 128,253,696 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	1	143,108,368 - 143,129,865 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

EPB42
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	26	39,770,288 - 39,794,252 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	26	39,770,664 - 39,794,173 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666048	101,218,993 - 101,243,288 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Epb42
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624804	10,300,724 - 10,318,084 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624804	10,299,905 - 10,318,154 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

.

Variants in Epb42
128 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	45
Count of miRNA genes:	41
Interacting mature miRNAs:	44
Transcripts:	ENSRNOT00000015556
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2312673	Scl63	Serum cholesterol level QTL 63		0.001	blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	3	98535255	168026850	Rat
2301414	Kidm37	Kidney mass QTL 37		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	3	70653097	121056321	Rat
2302373	Gluco39	Glucose level QTL 39	5.01		blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	3	98535386	161695835	Rat
1582238	Bw68	Body weight QTL 68	3.2	0.0064	body mass (VT:0001259)	body weight (CMO:0000012)	3	53184593	115665732	Rat
1582239	Epfw1	Epididymal fat weight QTL 1	4.5	0.0006	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	3	53184593	115665732	Rat
70216	Cm14	Cardiac mass QTL 14	2.1		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	3	31172320	163586636	Rat
2292591	Esta4	Estrogen-induced thymic atrophy QTL 4			thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	3	47233211	147415807	Rat
1358362	Srcrt2	Stress Responsive Cort QTL 2	2.78		blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	3	38192233	133483320	Rat
1582216	Bw65	Body weight QTL 65	6.3		body mass (VT:0001259)	body weight (CMO:0000012)	3	102200529	115665732	Rat
737818	Hcar12	Hepatocarcinoma resistance QTL 12	2.6		liver integrity trait (VT:0010547)	volume of individual liver tumorous lesion (CMO:0001078)	3	29463235	118376539	Rat
1582218	Bw74	Body weight QTL 74	3.9	0.0021	body mass (VT:0001259)	body weight (CMO:0000012)	3	53184593	115665732	Rat
1582219	Bw63	Body weight QTL 63	3.8	0.001	body mass (VT:0001259)	body weight (CMO:0000012)	3	96127817	115665732	Rat
1582221	Kidm30	Kidney mass QTL 30	3.5	0.0008	kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	3	64655305	115665732	Rat
1581568	Rf53	Renal function QTL 53			urine total protein amount (VT:0000032)	urine protein excretion rate to body weight ratio (CMO:0001099)	3	56395968	161299569	Rat
1582210	Bw71	Body weight QTL 71	3.3	0.0012	body mass (VT:0001259)	body weight (CMO:0000012)	3	64655305	115665732	Rat
7387306	Bw124	Body weight QTL 124	3.2	0.0003	body mass (VT:0001259)	body weight (CMO:0000012)	3	84091273	129091273	Rat
1300111	Rf12	Renal function QTL 12	3.78		renal blood flow trait (VT:2000006)	absolute change in renal blood flow rate (CMO:0001168)	3	61017749	121056321	Rat
724523	Tsu1	Thymus enlargement suppressive QTL 1	3.84		thymus mass (VT:0004954)	thymus weight to body weight ratio (CMO:0000612)	3	50437504	115638231	Rat
1600376	Arunc5	Aerobic running capacity QTL 5		0.21	exercise endurance trait (VT:0002332)	maximum distance run on treadmill (CMO:0001406)	3	73376539	118376539	Rat
8694437	Bw167	Body weight QTL 167	22.46	0.001	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	3	91797474	136797474	Rat
2302273	Gluco35	Glucose level QTL 35	5.3	0.001	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	3	80800231	114297550	Rat
8662816	Vetf4	Vascular elastic tissue fragility QTL 4	4		renal artery integrity trait (VT:0010642)	number of ruptures of the internal elastic lamina of the renal arteries (CMO:0002563)	3	59242096	157323038	Rat
1559282	Emca5	Estrogen-induced mammary cancer QTL 5	3.9		mammary gland integrity trait (VT:0010552)	percentage of study population developing mammary tumors during a period of time (CMO:0000948)	3	43827364	169034231	Rat
1581503	Cm58	Cardiac mass QTL 58	2.7	0.05	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	3	43827364	121056321	Rat
1354611	Despr2	Despair related QTL 2	3.03	0.0028	locomotor behavior trait (VT:0001392)	amount of time spent in voluntary immobility (CMO:0001043)	3	97084464	142084464	Rat
2292613	Ept16	Estrogen-induced pituitary tumorigenesis QTL 16	8.3		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	3	47233430	110362260	Rat
631649	Bp123	Blood pressure QTL 123	3.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	3	89772419	134772419	Rat
631841	Niddm39	Non-insulin dependent diabetes mellitus QTL 39	3.36		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	3	94856903	159898684	Rat
619618	Rf3	Renal disease susceptibility QTL 3	6.5	0.001	urine albumin amount (VT:0002871)	urine albumin excretion rate to body weight ratio (CMO:0001270)	3	107693393	152693393	Rat
12879848	Bw181	Body weght QTL 181		0.015	body mass (VT:0001259)	body weight (CMO:0000012)	3	70348525	121056321	Rat
2312659	Slep7	Serum leptin concentration QTL 7		0.001	blood leptin amount (VT:0005667)	serum leptin level (CMO:0000780)	3	98535255	168026850	Rat
2301971	Cm71	Cardiac mass QTL 71	4.63		heart left ventricle mass (VT:0007031)	heart left ventricle weight (CMO:0000776)	3	41874578	155617519	Rat
2301970	Bw81	Body weight QTL 81	5.19		body mass (VT:0001259)	body weight (CMO:0000012)	3	41874578	155617519	Rat
1358885	Bp251	Blood pressure QTL 251	3.8		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	14489145	121056321	Rat
1581546	Pur13	Proteinuria QTL 13	2.93	0.0335	urine total protein amount (VT:0000032)	urine protein excretion rate (CMO:0000759)	3	78196190	146592722	Rat
631665	Bw8	Body weight QTL 8	5.5		body mass (VT:0001259)	body weight (CMO:0000012)	3	50437042	119183768	Rat
1358888	Bp264	Blood pressure QTL 264	4.43		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	14489145	121056321	Rat
2312670	Bw94	Body weight QTL 94		0.01	inguinal fat pad mass (VT:0010424)	inguinal fat pad weight to body weight ratio (CMO:0001253)	3	98535255	168026850	Rat
2293087	Iddm27	Insulin dependent diabetes mellitus QTL 27	2.68		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	3	97551417	147415807	Rat
1358186	Ept2	Estrogen-induced pituitary tumorigenesis QTL 2	8.3		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	3	47233430	110362260	Rat
724532	Cm17	Cardiac mass QTL 17	2		heart mass (VT:0007028)	calculated heart weight (CMO:0000073)	3	95735366	140735366	Rat

RH140989

Rat Assembly	Chr	Position (strand)	Source	JBrowse
RH 3.4 Map	3	944.5	UniSTS
Cytogenetic Map	3	q35	UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31


RefSeq Transcripts	NM_001108590	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC094543	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC168935	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473949	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ235200	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000003	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000015556 ⟹ ENSRNOP00000015556

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	3	107,979,713 - 107,997,932 (-)	Ensembl
Rnor_6.0 Ensembl	3	112,965,653 - 112,985,318 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000112520 ⟹ ENSRNOP00000085044

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	3	107,979,713 - 107,996,858 (-)	Ensembl

RefSeq Acc Id:

NM_001108590 ⟹ NP_001102060

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	128,433,460 - 128,451,683 (-)	NCBI
mRatBN7.2	3	107,979,709 - 107,997,932 (-)	NCBI
Rnor_6.0	3	112,967,095 - 112,985,318 (-)	NCBI
Rnor_5.0	3	119,509,972 - 119,528,195 (-)	NCBI
RGSC_v3.4	3	107,806,273 - 107,824,496 (-)	RGD
Celera	3	106,882,884 - 106,901,107 (-)	RGD

Sequence:

show sequence

CTTTAAACCAGAAGTCCACCATCTTCGCCGGTGTGGAGGTAGATTTGGAGAGAGAATCCAGAGAGAAGCAACAGAGGGAGGTCAGCGTCTCCTGAGCTGTGGACTCAAGTAGCCTGCAGCCATGGGAC
AAGCTCTGAGTATCAAGAGCTGCGACTTCCACGCAGCAGAAAACAACAAGGAGCACCACACCGACGCCATCAGCTCCCAGCACCTTATTTTGAGGAGGGGACAGTCCTTCACCATCACCCTGAACTTC
CGTGCCCCGGCCCACATATTTCTGTCTGCCCTGAAGAAAGTGGCTCTCATTGCACAAACTGGAGAGCAACCTTCCAAGACCAGTAAGACCCAAGCCATATTCCCTATTTCCTCCCTGGGGGACAAAAA
AGGGTGGAGTGCAGCAGTGGTGGAAAGAGATGCCCAACATTGGACCATCTCTGTGACCACGCCCGTGGATGCTGTCATTGGCCACTACTCACTCCTGCTTCAGGTTTCCGGCAAGAAACAATACCCCT
TGGGCCAATTCACACTGCTCTTTAATCCATGGAATAGAGATGATGCTGTATTTCTGCAGAACGAGGTTCAACGCACTGAATATGTACTGAATCAGGATGGCTTTATCTACCTGGGCACAGCTGACTGC
ATTCAAGAAGAGCCCTGGGACTTCGGTCAGTTTGAGAGAGACGTCATGGACCTCAGCCTGAACTTACTGAGTGTGGACAAGCAAGTGAAAGACTGGAGCCAGCCTGCACACGTGGCCTGCATAGTGGG
CGCCTTGTTGCATGCCCTCAAGAAGAAGAGTGTCCTGCCTATTTCACAGACCCAGGCTGCCCAGCAAGGTGCCTTGTTGTACAAACGACGAGGCAGTGTGCCCATCCTGAGGCAGTGGCTCACTGGCC
GAGGACGACCTGTGTATGAGAGCCAGGCGTGGGTGTTTGCTGCTGTTGCTTGCACAGTGCTACGATGCCTGGGCATCCCAGCTCGAGTTGTTACCACATTTGACTCAGCCCAAGGTACCAATGGGAGC
CTGCTGGTGGATGAGTACTACAATGAGGAGGGGCTCCAGAATGGAGAAGGACAGAGGGGCCATATCTGGGTCTTCCAAACTTCTGTAGAATGCTGGATGAACAGACCTGATTTGTCCCCGGGTTATGA
TGGATGGCAGATTCTGCACCCAAGAGCTCCTAATGGAGTTGGAGTCCTGGGATCCTGCAATCTGGTCCCAGTCAAAGCAGTCAAAGAGGGGGACCTGCAGCTGGACCCGGCAGTACCAGAGCTCTTTG
CCGCAGTGAATGCCTCGTGCGTGGTCTGGAAGTGCTGTGAGGATGGGAAGTTGGAGTTGACCAACTCCAACAGAAAGAATGTTGGCAACAGCATCAGCACCAAGGTCGTGGGCAGTGACCGCTGCGAA
GACATCACCCAGAACTACAAATATCCTGAAGGATCTCTTCAAGAAAAGGAGGTACTGGAGAGAGTCCAAAAAGAAAGAATGAAACTTGGGGAAGACACGTGTCCTCCTAGTTGTGAGCCTGGGGATCC
TCTGCACCTGTTCTTGGAAGTACCTAGCTCCCAGCCTCTGAGAGGAAATGGTCGGCTCTCAGTGGCCTTGATTAACCCCACAGACAAGGAGAAGGAGGTAGAACTGGTGATTGCGGCCCAGGCTTTGT
ACTACAATGGAGTCCTTGCTACTGGGCTCTGGAGGCAGAAGCAGTTCCTCATGCTCGGACCCAACCAGGTTCTGAGACTCTCCACCAGCCTGTCCTTCTCCTGTTTCGAACAAAACCCACCTGAGAAC
ACCTTTCTCAGAGTCACAGCAATGGCAAGGCACTCCCACGCTGGCTTCAGCTGCTTTGCTCAGGAAGATGTGGTCATCAGTAGACCGAATCTTGTCATTGAGATGCCAAAGAGAGCAACACAGTATCA
GCCCCTTACTGCCTCAGTTAGAATGCACAACTCCTTAGACGCCCCCATGCAGAACTGCATCATCTCCATCTTTGGAAGGGGACTCATTCACAGAGAAAAGAGATACGGATTGGGTTCTGTGTGGCCAG
GAAGCAGCCTGCATACTCAGTTCCAGTTCACCCCAACACATCTGGGGCTCCAAAGGCTCACTGTGGAAGTAGATTGTGACATGTTCCAGAACCTGACCGGCCACAGAAGTGTCCTTGTGGTGGCCCCT
GAAGTTTCTGTTTAAACTCCAAACAACCTTCAGACTTCTAAAGCTAGACATGCTCCAGAGGGAAACTCTACCTATCAGACAAATGAGTCTATACTAAAGTTGAACAGACCGGTGACCAAAAACCAAAA
TTCATTTTTTTCTTGTTTTTTTTTGGGGGGGTGGTTTGTTTTTGTTTGTTTGTTTGTTTGTTTTTGTTGTTGTTGTTTTTTGGTTATTTGGTGGGTATTTTCGAAACAGAGTTTCTCTATGTAGTCCT
GGTGGTCCTGGAACTCACGCTGTAGATCAGGCTGGCCTTGAACTCAGAGATCCACCTGCCTCTCCCTCCCGAGTGCTTCCATTAAAGGCATGTGCCACCATTGTCTGGCTCCAAAAAAAAAAAAAAAA
AAAAAAAA

hide sequence


Protein RefSeqs	NP_001102060	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAI68935	(Get FASTA)	NCBI Sequence Viewer
	EDL79970	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000015556.4
	ENSRNOP00000085044.1

RefSeq Acc Id:

NP_001102060 ⟸ NM_001108590

- UniProtKB:

B5DF57 (UniProtKB/TrEMBL), A6HPL9 (UniProtKB/TrEMBL), A0A8I5ZZB1 (UniProtKB/TrEMBL), F7F1R4 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MGQALSIKSCDFHAAENNKEHHTDAISSQHLILRRGQSFTITLNFRAPAHIFLSALKKVALIAQTGEQPSKTSKTQAIFPISSLGDKKGWSAAVVERDAQHWTISVTTPVDAVIGHYSLLLQVSGKKQ
YPLGQFTLLFNPWNRDDAVFLQNEVQRTEYVLNQDGFIYLGTADCIQEEPWDFGQFERDVMDLSLNLLSVDKQVKDWSQPAHVACIVGALLHALKKKSVLPISQTQAAQQGALLYKRRGSVPILRQWL
TGRGRPVYESQAWVFAAVACTVLRCLGIPARVVTTFDSAQGTNGSLLVDEYYNEEGLQNGEGQRGHIWVFQTSVECWMNRPDLSPGYDGWQILHPRAPNGVGVLGSCNLVPVKAVKEGDLQLDPAVPE
LFAAVNASCVVWKCCEDGKLELTNSNRKNVGNSISTKVVGSDRCEDITQNYKYPEGSLQEKEVLERVQKERMKLGEDTCPPSCEPGDPLHLFLEVPSSQPLRGNGRLSVALINPTDKEKEVELVIAAQ
ALYYNGVLATGLWRQKQFLMLGPNQVLRLSTSLSFSCFEQNPPENTFLRVTAMARHSHAGFSCFAQEDVVISRPNLVIEMPKRATQYQPLTASVRMHNSLDAPMQNCIISIFGRGLIHREKRYGLGSV
WPGSSLHTQFQFTPTHLGLQRLTVEVDCDMFQNLTGHRSVLVVAPEVSV

hide sequence

Ensembl Acc Id:

ENSRNOP00000015556 ⟸ ENSRNOT00000015556

Ensembl Acc Id:

ENSRNOP00000085044 ⟸ ENSRNOT00000112520

Protein Domains

Transglutaminase-like

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-B5DF57-F1-model_v2	AlphaFold	B5DF57	1-689	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-48149	BioCyc
Ensembl Genes	ENSRNOG00000011649	Ensembl, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000015556.7	UniProtKB/TrEMBL
	ENSRNOT00000112520.1	UniProtKB/TrEMBL
Gene3D-CATH	2.60.40.10	UniProtKB/TrEMBL
	3.90.260.10	UniProtKB/TrEMBL
InterPro	Gln_gamma-glutamylTfrase_euk	UniProtKB/TrEMBL
	Ig-like_fold	UniProtKB/TrEMBL
	Ig_E-set	UniProtKB/TrEMBL
	Papain_like_cys_pep_sf	UniProtKB/TrEMBL
	Transglutaminase	UniProtKB/TrEMBL
	Transglutaminase-like	UniProtKB/TrEMBL
	Transglutaminase-like_sf	UniProtKB/TrEMBL
	Transglutaminase_C	UniProtKB/TrEMBL
	Transglutaminase_C_sf	UniProtKB/TrEMBL
	Transglutaminase_N	UniProtKB/TrEMBL
KEGG Report	rno:362202	UniProtKB/TrEMBL
NCBI Gene	362202	ENTREZGENE
PANTHER	PROTEIN 4.2	UniProtKB/TrEMBL
	PROTEIN-GLUTAMINE GAMMA-GLUTAMYLTRANSFERASE	UniProtKB/TrEMBL
Pfam	Transglut_C	UniProtKB/TrEMBL
	Transglut_core	UniProtKB/TrEMBL
	Transglut_N	UniProtKB/TrEMBL
PhenoGen	Epb42	PhenoGen
PIRSF	TGM_EBP42	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000011649	RatGTEx
SMART	TGc	UniProtKB/TrEMBL
Superfamily-SCOP	Ig_E-set	UniProtKB/TrEMBL
	SSF54001	UniProtKB/TrEMBL
	Transglut_C	UniProtKB/TrEMBL
UniProt	A0A8I5ZZB1	ENTREZGENE, UniProtKB/TrEMBL
	A6HPL9	ENTREZGENE, UniProtKB/TrEMBL
	B5DF57	ENTREZGENE
	F7F1R4	ENTREZGENE, UniProtKB/TrEMBL
UniProt Secondary	B5DF57	UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-04-30	Epb4.2	erythrocyte protein band 4.2	Epb4.2_predicted	erythrocyte protein band 4.2 (predicted)	'predicted' is removed	2292626	APPROVED
2005-01-12	Epb4.2_predicted	erythrocyte protein band 4.2 (predicted)			Symbol and Name status set to approved	70820	APPROVED