Advanced Search (OLGA)

Gene: Cdc16 (cell division cycle 16) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Cdc16

Name:

cell division cycle 16

RGD ID:

1305076

Description:

Predicted to be involved in several processes, including anaphase-promoting complex-dependent catabolic process; positive regulation of mitotic metaphase/anaphase transition; and protein polyubiquitination. Predicted to be located in centrosome; mitotic spindle; and nucleus. Predicted to be part of anaphase-promoting complex. Predicted to be active in cytoplasm. Orthologous to human CDC16 (cell division cycle 16); PARTICIPATES IN cell cycle pathway, mitotic; ubiquitin/proteasome degradation pathway; INTERACTS WITH 1,3-dinitrobenzene; 2,4-dinitrotoluene; 2,6-dinitrotoluene.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

CDC16 cell division cycle 16 homolog; CDC16 cell division cycle 16 homolog (S. cerevisiae); cell division cycle 16 homolog; cell division cycle 16 homolog (S. cerevisiae); cell division cycle protein 16 homolog; LOC290875

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	CDC16 (cell division cycle 16)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Cdc16 (CDC16 cell division cycle 16)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Cdc16 (cell division cycle 16)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	CDC16 (cell division cycle 16)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	CDC16 (cell division cycle 16)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Cdc16 (cell division cycle 16)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	CDC16 (cell division cycle 16)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	CDC16 (cell division cycle 16)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Cdc16 (cell division cycle 16)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	OSBP2 (oxysterol binding protein 2)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	CDC16 (cell division cycle 16)	Alliance	DIOPT (HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Cdc16 (CDC16 cell division cycle 16)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	cdc16 (cell division cycle 16 homolog (S. cerevisiae))	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	CDC16	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Cdc16	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	emb-27	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	cdc16	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PhylomeDB)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	16	82,475,234 - 82,498,797 (-)	NCBI		GRCr8
mRatBN7.2	16	75,773,026 - 75,796,586 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	16	75,773,028 - 75,796,550 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	16	81,053,720 - 81,077,204 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	16	84,506,682 - 84,530,166 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	16	79,756,976 - 79,780,137 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	16	81,493,355 - 81,516,493 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	16	81,493,355 - 81,516,493 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	16	80,981,546 - 81,004,585 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	16	80,628,131 - 80,650,925 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	16	80,628,395 - 80,651,190 (-)	NCBI
Celera	16	73,581,950 - 73,604,842 (-)	NCBI		Celera
Cytogenetic Map	16	q12.5	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Cdc16	Rat	factor X deficiency		ISO	CDC16 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Factor X deficiency	ClinVar	PMID:25741868 and PMID:34355501

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Cdc16	Rat	1,2-dichloroethane	increases expression	ISO	Cdc16 (Mus musculus)	6480464	ethylene dichloride results in increased expression of CDC16 mRNA	CTD	PMID:28960355
Cdc16	Rat	1,2-dimethylhydrazine	increases expression	ISO	Cdc16 (Mus musculus)	6480464	1 and 2-Dimethylhydrazine results in increased expression of CDC16 mRNA	CTD	PMID:22206623
Cdc16	Rat	1,3-dinitrobenzene	decreases expression	EXP		6480464	3-dinitrobenzene results in decreased expression of CDC16 mRNA	CTD	PMID:22841810
Cdc16	Rat	17alpha-ethynylestradiol	multiple interactions	ISO	Cdc16 (Mus musculus)	6480464	[Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of CDC16 mRNA	CTD	PMID:17942748
Cdc16	Rat	17alpha-ethynylestradiol	increases expression	ISO	Cdc16 (Mus musculus)	6480464	Ethinyl Estradiol results in increased expression of CDC16 mRNA	CTD	PMID:17942748
Cdc16	Rat	2,3,7,8-tetrachlorodibenzodioxine	multiple interactions	ISO	Cdc16 (Mus musculus)	6480464	[Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of CDC16 mRNA	CTD	PMID:17942748
Cdc16	Rat	2,3,7,8-tetrachlorodibenzodioxine	affects expression	ISO	Cdc16 (Mus musculus)	6480464	Tetrachlorodibenzodioxin affects the expression of CDC16 mRNA	CTD	PMID:21570461
Cdc16	Rat	2,4-dinitrotoluene	affects expression	EXP		6480464	2 and 4-dinitrotoluene affects the expression of CDC16 mRNA	CTD	PMID:21346803
Cdc16	Rat	2,6-dinitrotoluene	affects expression	EXP		6480464	2 and 6-dinitrotoluene affects the expression of CDC16 mRNA	CTD	PMID:21346803
Cdc16	Rat	3-chloropropane-1,2-diol	increases expression	EXP		6480464	alpha-Chlorohydrin results in increased expression of CDC16 protein	CTD	PMID:34915118
Cdc16	Rat	4,4'-diaminodiphenylmethane	decreases expression	ISO	Cdc16 (Mus musculus)	6480464	4 and 4'-diaminodiphenylmethane results in decreased expression of CDC16 mRNA	CTD	PMID:18648102
Cdc16	Rat	4,4'-sulfonyldiphenol	increases expression	ISO	Cdc16 (Mus musculus)	6480464	bisphenol S results in increased expression of CDC16 mRNA	CTD	PMID:39298647
Cdc16	Rat	antirheumatic drug	increases expression	ISO	CDC16 (Homo sapiens)	6480464	Antirheumatic Agents results in increased expression of CDC16 mRNA	CTD	PMID:24449571
Cdc16	Rat	Aroclor 1254	decreases expression	ISO	Cdc16 (Mus musculus)	6480464	Chlorodiphenyl (54% Chlorine) results in decreased expression of CDC16 mRNA	CTD	PMID:23650126
Cdc16	Rat	arsane	affects methylation	ISO	CDC16 (Homo sapiens)	6480464	Arsenic affects the methylation of CDC16 gene	CTD	PMID:25304211
Cdc16	Rat	arsane	multiple interactions	ISO	CDC16 (Homo sapiens)	6480464	[sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of CDC16 mRNA	CTD	PMID:39836092
Cdc16	Rat	arsenic atom	affects methylation	ISO	CDC16 (Homo sapiens)	6480464	Arsenic affects the methylation of CDC16 gene	CTD	PMID:25304211
Cdc16	Rat	arsenic atom	multiple interactions	ISO	CDC16 (Homo sapiens)	6480464	[sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of CDC16 mRNA	CTD	PMID:39836092
Cdc16	Rat	benzo[a]pyrene	increases expression	ISO	Cdc16 (Mus musculus)	6480464	Benzo(a)pyrene results in increased expression of CDC16 mRNA	CTD	PMID:22228805
Cdc16	Rat	beta-lapachone	increases expression	ISO	CDC16 (Homo sapiens)	6480464	beta-lapachone results in increased expression of CDC16 mRNA	CTD	PMID:38218311
Cdc16	Rat	bisphenol A	increases expression	EXP		6480464	bisphenol A results in increased expression of CDC16 mRNA	CTD	PMID:25181051
Cdc16	Rat	bisphenol A	affects expression	ISO	CDC16 (Homo sapiens)	6480464	bisphenol A affects the expression of CDC16 mRNA	CTD	PMID:30903817
Cdc16	Rat	cadmium dichloride	increases expression	EXP		6480464	Cadmium Chloride results in increased expression of CDC16 mRNA	CTD	PMID:33453195
Cdc16	Rat	caffeine	decreases phosphorylation	ISO	CDC16 (Homo sapiens)	6480464	Caffeine results in decreased phosphorylation of CDC16 protein	CTD	PMID:35688186
Cdc16	Rat	carbamazepine	affects expression	ISO	CDC16 (Homo sapiens)	6480464	Carbamazepine affects the expression of CDC16 mRNA	CTD	PMID:25979313
Cdc16	Rat	chlorpyrifos	decreases expression	ISO	Cdc16 (Mus musculus)	6480464	Chlorpyrifos results in decreased expression of CDC16 mRNA	CTD	PMID:37019170
Cdc16	Rat	clofibrate	increases expression	ISO	Cdc16 (Mus musculus)	6480464	Clofibrate results in increased expression of CDC16 mRNA	CTD	PMID:17585979
Cdc16	Rat	clofibric acid	affects expression	EXP		6480464	Clofibric Acid affects the expression of CDC16 mRNA	CTD	PMID:17602206
Cdc16	Rat	copper atom	multiple interactions	ISO	CDC16 (Homo sapiens)	6480464	[Chelating Agents binds to Copper] which results in increased expression of CDC16 mRNA	CTD	PMID:30911355
Cdc16	Rat	copper(0)	multiple interactions	ISO	CDC16 (Homo sapiens)	6480464	[Chelating Agents binds to Copper] which results in increased expression of CDC16 mRNA	CTD	PMID:30911355
Cdc16	Rat	cyclosporin A	increases expression	ISO	CDC16 (Homo sapiens)	6480464	Cyclosporine results in increased expression of CDC16 mRNA	CTD	PMID:20106945 and PMID:25562108
Cdc16	Rat	dibutyl phthalate	increases expression	EXP		6480464	Dibutyl Phthalate results in increased expression of CDC16 mRNA	CTD	PMID:21266533
Cdc16	Rat	dicrotophos	decreases expression	ISO	CDC16 (Homo sapiens)	6480464	dicrotophos results in decreased expression of CDC16 mRNA	CTD	PMID:28302478
Cdc16	Rat	dioxygen	multiple interactions	ISO	Cdc16 (Mus musculus)	6480464	[sulforaphane affects the susceptibility to Oxygen] which affects the expression of CDC16 mRNA	CTD	PMID:30529165
Cdc16	Rat	doxorubicin	decreases expression	ISO	CDC16 (Homo sapiens)	6480464	Doxorubicin results in decreased expression of CDC16 mRNA	CTD	PMID:29803840
Cdc16	Rat	Echimidine	multiple interactions	ISO	CDC16 (Homo sapiens)	6480464	[CYP3A4 protein results in increased metabolism of echimidine] which results in increased expression of CDC16 mRNA	CTD	PMID:33884520
Cdc16	Rat	elemental selenium	decreases expression	ISO	CDC16 (Homo sapiens)	6480464	Selenium results in decreased expression of CDC16 mRNA	CTD	PMID:19244175
Cdc16	Rat	ethanol	affects splicing	ISO	Cdc16 (Mus musculus)	6480464	Ethanol affects the splicing of CDC16 mRNA	CTD	PMID:30319688
Cdc16	Rat	fenthion	decreases expression	ISO	Cdc16 (Mus musculus)	6480464	Fenthion results in decreased expression of CDC16 mRNA	CTD	PMID:34813904
Cdc16	Rat	flutamide	increases expression	EXP		6480464	Flutamide results in increased expression of CDC16 mRNA	CTD	PMID:24136188
Cdc16	Rat	FR900359	increases phosphorylation	ISO	CDC16 (Homo sapiens)	6480464	FR900359 results in increased phosphorylation of CDC16 protein	CTD	PMID:37730182
Cdc16	Rat	hydrogen peroxide	affects expression	ISO	CDC16 (Homo sapiens)	6480464	Hydrogen Peroxide affects the expression of CDC16 mRNA	CTD	PMID:20044591
Cdc16	Rat	ivermectin	decreases expression	ISO	CDC16 (Homo sapiens)	6480464	Ivermectin results in decreased expression of CDC16 protein	CTD	PMID:32959892
Cdc16	Rat	Lasiocarpine	multiple interactions	ISO	CDC16 (Homo sapiens)	6480464	[CYP3A4 protein results in increased metabolism of lasiocarpine] which results in decreased expression of CDC16 mRNA	CTD	PMID:33884520
Cdc16	Rat	lead(0)	affects splicing	ISO	CDC16 (Homo sapiens)	6480464	Lead affects the splicing of CDC16 mRNA	CTD	PMID:28903495
Cdc16	Rat	metformin	multiple interactions	ISO	CDC16 (Homo sapiens)	6480464	[Paclitaxel co-treated with Metformin] results in decreased expression of CDC16 mRNA	CTD	PMID:29309887
Cdc16	Rat	methylparaben	increases expression	ISO	CDC16 (Homo sapiens)	6480464	methylparaben results in increased expression of CDC16 mRNA	CTD	PMID:31745603
Cdc16	Rat	motexafin gadolinium	multiple interactions	ISO	CDC16 (Homo sapiens)	6480464	[Zinc Acetate co-treated with motexafin gadolinium] results in decreased expression of CDC16 mRNA	CTD	PMID:16357179
Cdc16	Rat	motexafin gadolinium	decreases expression	ISO	CDC16 (Homo sapiens)	6480464	motexafin gadolinium results in decreased expression of CDC16 mRNA	CTD	PMID:16357179
Cdc16	Rat	nitrates	multiple interactions	ISO	Cdc16 (Mus musculus)	6480464	[Particulate Matter results in increased abundance of Nitrates] which results in increased expression of CDC16 mRNA	CTD	PMID:35964746
Cdc16	Rat	paclitaxel	multiple interactions	ISO	CDC16 (Homo sapiens)	6480464	[Paclitaxel co-treated with Metformin] results in decreased expression of CDC16 mRNA	CTD	PMID:29309887
Cdc16	Rat	paracetamol	increases expression	ISO	CDC16 (Homo sapiens)	6480464	Acetaminophen results in increased expression of CDC16 mRNA	CTD	PMID:38614205
Cdc16	Rat	paracetamol	decreases expression	EXP		6480464	Acetaminophen results in decreased expression of CDC16 mRNA	CTD	PMID:33387578
Cdc16	Rat	quercetin	decreases expression	ISO	CDC16 (Homo sapiens)	6480464	Quercetin results in decreased expression of CDC16 mRNA	CTD	PMID:14715546
Cdc16	Rat	selenium atom	decreases expression	ISO	CDC16 (Homo sapiens)	6480464	Selenium results in decreased expression of CDC16 mRNA	CTD	PMID:19244175
Cdc16	Rat	sodium arsenite	decreases expression	ISO	Cdc16 (Mus musculus)	6480464	sodium arsenite results in decreased expression of CDC16 mRNA	CTD	PMID:16014739
Cdc16	Rat	sodium arsenite	multiple interactions	ISO	CDC16 (Homo sapiens)	6480464	[sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of CDC16 mRNA and sodium arsenite promotes the reaction [CDC16 protein binds to CAPRIN1 protein]	CTD	PMID:33939924 and PMID:39836092
Cdc16	Rat	sulforaphane	multiple interactions	ISO	Cdc16 (Mus musculus)	6480464	[sulforaphane affects the susceptibility to Oxygen] which affects the expression of CDC16 mRNA	CTD	PMID:30529165
Cdc16	Rat	temozolomide	decreases expression	ISO	CDC16 (Homo sapiens)	6480464	Temozolomide results in decreased expression of CDC16 mRNA	CTD	PMID:31758290
Cdc16	Rat	tert-butyl hydroperoxide	decreases expression	ISO	CDC16 (Homo sapiens)	6480464	tert-Butylhydroperoxide results in decreased expression of CDC16 mRNA	CTD	PMID:15336504
Cdc16	Rat	tetrachloromethane	increases expression	ISO	Cdc16 (Mus musculus)	6480464	Carbon Tetrachloride results in increased expression of CDC16 mRNA	CTD	PMID:31919559
Cdc16	Rat	triphenyl phosphate	affects expression	ISO	CDC16 (Homo sapiens)	6480464	triphenyl phosphate affects the expression of CDC16 mRNA	CTD	PMID:37042841
Cdc16	Rat	Triptolide	decreases expression	EXP		6480464	triptolide results in decreased expression of CDC16 mRNA	CTD	PMID:23639586
Cdc16	Rat	valproic acid	affects expression	ISO	CDC16 (Homo sapiens)	6480464	Valproic Acid affects the expression of CDC16 mRNA	CTD	PMID:25979313
Cdc16	Rat	vitamin E	decreases expression	ISO	CDC16 (Homo sapiens)	6480464	Vitamin E results in decreased expression of CDC16 mRNA	CTD	PMID:19244175
Cdc16	Rat	zinc acetate	multiple interactions	ISO	CDC16 (Homo sapiens)	6480464	[Zinc Acetate co-treated with motexafin gadolinium] results in decreased expression of CDC16 mRNA	CTD	PMID:16357179
Cdc16	Rat	zinc acetate	decreases expression	ISO	CDC16 (Homo sapiens)	6480464	Zinc Acetate results in decreased expression of CDC16 mRNA	CTD	PMID:16357179

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Cdc16	Rat	anaphase-promoting complex-dependent catabolic process	involved_in	ISO	CDC16 (Homo sapiens)	1624291	PMID:29033132	RGD	PMID:29033132
Cdc16	Rat	anaphase-promoting complex-dependent catabolic process	involved_in	IEA	UniProtKB:Q13042 and ensembl:ENSP00000348554	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Cdc16	Rat	anaphase-promoting complex-dependent catabolic process	involved_in	IBA	PANTHER:PTN000285227 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Cdc16	Rat	cell division	involved_in	IEA	UniProtKB-KW:KW-0132	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Cdc16	Rat	cell division	involved_in	IBA	PANTHER:PTN001757014 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Cdc16	Rat	positive regulation of mitotic metaphase/anaphase transition	involved_in	IBA	FB:FBgn0025781 and PANTHER:PTN000285227	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Cdc16	Rat	protein branched polyubiquitination	involved_in	ISO	CDC16 (Homo sapiens)	1624291	PMID:29033132	RGD	PMID:29033132
Cdc16	Rat	protein branched polyubiquitination	involved_in	IEA	UniProtKB:Q13042 and ensembl:ENSP00000348554	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Cdc16	Rat	protein K11-linked ubiquitination	involved_in	ISO	CDC16 (Homo sapiens)	1624291	PMID:18485873 and PMID:29033132	RGD	PMID:18485873 and PMID:29033132
Cdc16	Rat	protein K11-linked ubiquitination	involved_in	IEA	UniProtKB:Q13042 and ensembl:ENSP00000348554	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Cdc16	Rat	protein K48-linked ubiquitination	involved_in	ISO	CDC16 (Homo sapiens)	1624291	PMID:29033132	RGD	PMID:29033132
Cdc16	Rat	protein K48-linked ubiquitination	involved_in	IEA	UniProtKB:Q13042 and ensembl:ENSP00000348554	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Cdc16	Rat	protein ubiquitination	involved_in	IBA	PANTHER:PTN000285227 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Cdc16	Rat	anaphase-promoting complex	part_of	ISO	CDC16 (Homo sapiens)	1624291	PMID:16364912 more ...	RGD	PMID:16364912 more ...
Cdc16	Rat	anaphase-promoting complex	part_of	IBA	PANTHER:PTN000285227 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Cdc16	Rat	anaphase-promoting complex	part_of	IEA	UniProtKB:Q13042 and ensembl:ENSP00000348554	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Cdc16	Rat	centrosome	located_in	ISO	CDC16 (Homo sapiens)	1624291	PMID:7736578	RGD	PMID:7736578
Cdc16	Rat	centrosome	located_in	IEA	UniProtKB:Q13042 and ensembl:ENSP00000348554	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Cdc16	Rat	cytoplasm	located_in	ISO	CDC16 (Homo sapiens)	1624291		RGD	GO_REF:0000054
Cdc16	Rat	cytoplasm	located_in	IEA	UniProtKB:Q13042 and ensembl:ENSP00000348554	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Cdc16	Rat	cytoplasm	is_active_in	IBA	PANTHER:PTN000285227 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Cdc16	Rat	mitotic spindle	located_in	ISO	CDC16 (Homo sapiens)	1624291	PMID:7736578	RGD	PMID:7736578
Cdc16	Rat	mitotic spindle	located_in	IEA	UniProtKB:Q13042 and ensembl:ENSP00000348554	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Cdc16	Rat	nucleus	located_in	ISO	Cdc16 (Mus musculus)	1624291	PMID:14744933	RGD	PMID:14744933
Cdc16	Rat	nucleus	located_in	IEA	UniProtKB:Q8R349 and ensembl:ENSMUSP00000047950	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Cdc16	Rat	protein binding	enables	ISO	CDC16 (Homo sapiens)	1624291	UniProtKB:P45984 more ...	RGD	PMID:20360068 more ...
Cdc16	Rat	protein binding	enables	ISO	Cdc16 (Mus musculus)	1624291	PR:O70343 PMID:14744933	RGD	PMID:14744933
Cdc16	Rat	protein binding	enables	ISO	CDC16 (Homo sapiens) and UniProtKB:Q13042-2	1624291	UniProtKB:Q13148 and PMID:32814053	RGD	PMID:32814053
Cdc16	Rat	protein binding	enables	ISO	CDC16 (Homo sapiens) and UniProtKB:Q13042-1	1624291	UniProtKB:Q8NHZ8 and PMID:19668213	RGD	PMID:19668213

Imported Annotations - KEGG (archival)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Cdc16	Rat	cell cycle pathway, mitotic		IEA		6907045		KEGG	rno:04110
Cdc16	Rat	ubiquitin/proteasome degradation pathway		IEA		6907045		KEGG	rno:04120

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
3.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
4.	GOA pipeline	RGD automated data pipeline
5.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

PMID:7736578	PMID:12477932	PMID:14744933	PMID:16364912	PMID:18485873	PMID:21926987

Cdc16
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	16	82,475,234 - 82,498,797 (-)	NCBI		GRCr8
mRatBN7.2	16	75,773,026 - 75,796,586 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	16	75,773,028 - 75,796,550 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	16	81,053,720 - 81,077,204 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	16	84,506,682 - 84,530,166 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	16	79,756,976 - 79,780,137 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	16	81,493,355 - 81,516,493 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	16	81,493,355 - 81,516,493 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	16	80,981,546 - 81,004,585 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	16	80,628,131 - 80,650,925 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	16	80,628,395 - 80,651,190 (-)	NCBI
Celera	16	73,581,950 - 73,604,842 (-)	NCBI		Celera
Cytogenetic Map	16	q12.5	NCBI

CDC16
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	13	114,234,897 - 114,272,723 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	13	114,234,887 - 114,272,723 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	13	115,000,372 - 115,038,198 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	13	114,018,464 - 114,056,252 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	13	114,018,475 - 114,056,252	NCBI
Celera	13	95,672,733 - 95,710,522 (+)	NCBI		Celera
Cytogenetic Map	13	q34	NCBI
HuRef	13	95,262,577 - 95,300,344 (+)	NCBI		HuRef
CHM1_1	13	114,969,034 - 115,006,823 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	13	113,443,956 - 113,481,783 (+)	NCBI		T2T-CHM13v2.0

Cdc16
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	8	13,807,650 - 13,831,951 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	8	13,807,676 - 13,831,938 (+)	Ensembl		GRCm39 Ensembl
GRCm38	8	13,757,649 - 13,781,951 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	8	13,757,676 - 13,781,938 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	8	13,757,690 - 13,781,882 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	8	13,757,667 - 13,781,859 (+)	NCBI		MGSCv36	mm8
Celera	8	13,923,731 - 13,947,923 (+)	NCBI		Celera
Cytogenetic Map	8	A1.1	NCBI
cM Map	8	6.38	NCBI

Cdc16
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955404	45,383 - 71,466 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955404	47,126 - 71,602 (-)	NCBI	ChiLan1.0	ChiLan1.0

CDC16
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	14	115,728,810 - 115,769,093 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	13	114,409,954 - 114,449,375 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	13	95,300,763 - 95,340,762 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	13	114,369,774 - 114,407,267 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	13	114,369,774 - 114,407,267 (+)	Ensembl	panpan1.1		panPan2

CDC16
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	22	61,283,263 - 61,312,283 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	22	61,283,309 - 61,312,283 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	22	60,994,906 - 61,023,919 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	22	61,970,375 - 61,999,261 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	22	61,970,404 - 62,000,439 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	22	61,407,802 - 61,436,819 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	22	61,416,165 - 61,444,982 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	22	61,443,393 - 61,472,197 (+)	NCBI		UU_Cfam_GSD_1.0

Cdc16
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404945	196,169,252 - 196,194,381 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004937030	216,744 - 241,196 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004937030	217,078 - 242,126 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

CDC16
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	11	79,084,182 - 79,115,268 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	11	79,084,243 - 79,111,758 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Pig Cytomap	11	q	NCBI

CDC16
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	3	92,018,619 - 92,057,232 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	3	92,018,681 - 92,059,413 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666046	49,312,946 - 49,352,029 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Cdc16
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla 1.0	NW_004624793	151,508 - 186,342 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Cdc16
141 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	47
Count of miRNA genes:	43
Interacting mature miRNAs:	47
Transcripts:	ENSRNOT00000023736
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2300163	Bmd64	Bone mineral density QTL 64	5.3	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	16	37752156	82752156	Rat
7411648	Foco22	Food consumption QTL 22	15	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	16	52726464	84729064	Rat
1600378	Arunc4	Aerobic running capacity QTL 4		0.03	exercise endurance trait (VT:0002332)	maximum distance run on treadmill (CMO:0001406)	16	380245	80345693	Rat
1578768	Stresp22	Stress response QTL 22	2.8		thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	16	35288870	80288870	Rat
2293690	Bss45	Bone structure and strength QTL 45	5.13	0.0001	lumbar vertebra morphology trait (VT:0010494)	lumbar vertebra cortical cross-sectional area (CMO:0001690)	16	37752156	82752156	Rat
8694364	Abfw7	Abdominal fat weight QTL 7	12.22	0.001	visceral adipose mass (VT:0010063)	abdominal fat pad weight to body weight ratio (CMO:0000095)	16	52726464	84729064	Rat
8694429	Bw164	Body weight QTL 164	5	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	16	52726464	84729064	Rat
7205510	Activ5	Activity QTL 5	3.78	0.00028	locomotor behavior trait (VT:0001392)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	16	42396345	84729064	Rat
70205	Gcr3	Gastric cancer resistance QTL 3	2.3		stomach morphology trait (VT:0000470)	stomach tumor diameter (CMO:0001889)	16	17696791	82635055	Rat
631525	Pia14	Pristane induced arthritis QTL 14	4.4		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	16	55711087	83402471	Rat

RH127667

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	16	75,773,257 - 75,773,466 (-)	MAPPER	mRatBN7.2
Rnor_6.0	16	81,516,096 - 81,516,304	NCBI	Rnor6.0
Rnor_5.0	16	81,004,188 - 81,004,396	UniSTS	Rnor5.0
RGSC_v3.4	16	80,628,320 - 80,628,528	UniSTS	RGSC3.4
Celera	16	73,582,139 - 73,582,347	UniSTS
RH 3.4 Map	16	743.9	UniSTS
Cytogenetic Map	16	q12.5	UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31


RefSeq Transcripts	NM_001024744	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039094410	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063275254	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC097498	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473970	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000016	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000023736 ⟹ ENSRNOP00000023736

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	16	75,773,040 - 75,796,550 (-)	Ensembl
Rnor_6.0 Ensembl	16	81,493,355 - 81,516,493 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000090674 ⟹ ENSRNOP00000068614

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	16	75,773,028 - 75,795,986 (-)	Ensembl
Rnor_6.0 Ensembl	16	81,493,371 - 81,516,492 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000092265

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	16	81,510,496 - 81,511,243 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000092305

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	16	81,514,026 - 81,514,579 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000092433

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	16	81,508,375 - 81,508,980 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000092531

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	16	75,773,028 - 75,796,269 (-)	Ensembl
Rnor_6.0 Ensembl	16	81,493,477 - 81,516,493 (+)	Ensembl

RefSeq Acc Id:

NM_001024744 ⟹ NP_001019915

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	16	82,475,277 - 82,498,765 (-)	NCBI
mRatBN7.2	16	75,773,069 - 75,796,557 (-)	NCBI
Rnor_6.0	16	81,493,355 - 81,516,493 (+)	NCBI
Rnor_5.0	16	80,981,546 - 81,004,585 (+)	NCBI
RGSC_v3.4	16	80,628,131 - 80,650,925 (-)	RGD
Celera	16	73,581,950 - 73,604,842 (-)	RGD

Sequence:

show sequence

GTGCCGTGTGGCGCGCGGGGTCTGATCCGGGTGGTGGTCGGCGGGCTTGGGTCCATCGACACCCGGGGGCGCGCGGAGGCTCGAGGGGGTGTCGGGTGCCTGACCTGGCCTCGCGGCCATGAACCTGG
AGCCGCTGCGCAAACGCGTCCGGCAGTACCTGGACCAGCAACAGTATCAAAGTGCTCTGTTTTGGGCAGACAAGGTAGCTTCACTCTCTCATGAGGAACCCCAGGATGTTTATTGGTTGGCTCAGTGT
CTTTACCTCACAGCACAGTACCACAGAGCAGCCCATGCACTCCGGTCACGCAAGCTGGACAAACTGTATGAAGCTTGCCGATACCTTGCAGCTAGATGCCACTATGCTGCGAAAGAGTACCAGCAGGC
TCTAGACATCCTTGATATGGAGGAACCAATTAACAGAAGGCTCTTTGAGAAGTACCTGAAGGATGACAGTGGCTCCAAAGACCCTTCCAGTGACTGGGAGATGTCACAGTCCTCCATAAAGAGCTCGA
TTTGTCTTCTGAGGGGGAAAATCTACGATGCATTAGATAATCGCACCCTGGCTACCTACAGTTACAAAGAGGCTTTGAAGCTCGACGTCTACTGCTTTGAAGCATTTGATCTTCTGACGTCACACCAC
ATGTTGACAGCACAGGAAGAAAAAGAACTTCTAGACTCACTGCCTCTTAGCAAGCTCTGTGCCGAAGAACAAGAATTGCTACGATTTGTATTTGAGAACAAATTAAAGAAGTATAATAAGCCCAGTGA
GACTGTCATTCCCCAGTCAGTGGACGGCTTGCAAGAGAATCTGGATGTGGTAGTGTCTTTGGCTGAGAGACACTATTATAACTGTGATTTTAAGATGTGCTACAAGCTTACGTCTGCAGTGATGGAAA
AGGACCCTTTCCATGCAAACTGTTTACCTGTGCACATAGGAACTCTTGTGGAGTTGAATAAAGCAAATGAACTTTTCTATCTTTCTCACAAATTGGTGGATTTATATCCGAGTAATCCTGTGTCGTGG
TTCGCGGTGGGCTGCTACTACCTCATGGTTGGCCATAAAAACGAGCACGCCAGGAGATACCTCAGCAAAGCTACCACACTGGAGAAGACCTATGGGCCCGCCTGGATAGCCTACGGGCACTCCTTCGC
TGTGGAGAGCGAGCATGACCAAGCCATGGCTGCTTATTTCACAGCCGCACAGCTCATGAAGGGGTGTCACTTGCCAATGCTGTATATTGGGTTAGAATATGGTTTGACCAATAACTCTAAACTGGCTG
AGCGGTTCTTTGGCCAAGCTCTGAGCATTGCCCCGGAAGACCCGTTTGTCATCCATGAGGTTGGAGTGGTTGCCTTTCAGAATGGAGAATGGAAAACAGCAGAAAAGTGGTTTCTCGATGCTTTGGAA
AAAATTAAAGCAATTGGGAATGAGGTAACAGTTGACAAATGGGAACCTTTATTGAACAACCTGGGGCATGTCTGCAGAAAACTCAAGAAGTACGCCGAGGCTCTGGATTACCACAGGCAGGCACTGGT
GCTGATCCCTCAGAATGCGTCCACATACTCTGCTATAGGCTACATCCACAGTCTGATGGGCAACTTCGAAAACGCTGTGGACTATTTCCATACAGCTCTCGGTCTTAGGCGAGACGACACGTTTTCTG
TTACAATGCTTGGTCATTGCATTGAAATGTACATTGGAGATTCCGAAGCTTATATCGGAGCAGACATTAAAGACAAACTAAAGTGCTATGACTTTGACGTGCATACAATGAAAACACTAAAAAACATC
ATTTCGCCTCCGTGGGATTTCAGGGACTTTGAAGTAGAAAAGCAGAACACAGAGGAAGCCGGGCTTGCACCTCTGGAAAACGCCACTAAAACCCCGGAGTCCAGACCTTCCTTGGAAGAGACTTTTGA
AATTGAAATGAACGAAAGTGACATGATGCTAGAGACATCTATGTCAGACCACAGCACATAGCCACAGCACACAATTGACAGAGGTCCAGGGCCACCCTCGTGTGCCAGCATAGGTCAGTGCTCCCTCG
CGGCCTTGCTACATCTTAAGAATTTCCCAGTTCCTGCTGTGACTCCTAACTACAGCTCTACATTAAAGACCAGCAGCCTGCGTTAAATGTGGGACAGCAGACCCTGGCCGCAGATGTTCTCTGATCTT
CTGAGCCTACAGAGTAGTACATGTAGCAGAATAAAGGTCAATGTTCATTGTCAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_039094410 ⟹ XP_038950338

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	16	82,475,234 - 82,498,797 (-)	NCBI
mRatBN7.2	16	75,773,026 - 75,796,575 (-)	NCBI

RefSeq Acc Id:

XM_063275254 ⟹ XP_063131324

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	16	82,480,761 - 82,498,790 (-)	NCBI


Protein RefSeqs	NP_001019915	(Get FASTA)	NCBI Sequence Viewer
	XP_038950338	(Get FASTA)	NCBI Sequence Viewer
	XP_063131324	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH97498	(Get FASTA)	NCBI Sequence Viewer
	EDM08912	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000023736
	ENSRNOP00000023736.5
	ENSRNOP00000068614.2
	ENSRNOP00000092614.1

RefSeq Acc Id:

NP_001019915 ⟸ NM_001024744

- UniProtKB:

Q4V884 (UniProtKB/TrEMBL), A0A0G2JT88 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MNLEPLRKRVRQYLDQQQYQSALFWADKVASLSHEEPQDVYWLAQCLYLTAQYHRAAHALRSRKLDKLYEACRYLAARCHYAAKEYQQALDILDMEEPINRRLFEKYLKDDSGSKDPSSDWEMSQSSI
KSSICLLRGKIYDALDNRTLATYSYKEALKLDVYCFEAFDLLTSHHMLTAQEEKELLDSLPLSKLCAEEQELLRFVFENKLKKYNKPSETVIPQSVDGLQENLDVVVSLAERHYYNCDFKMCYKLTSA
VMEKDPFHANCLPVHIGTLVELNKANELFYLSHKLVDLYPSNPVSWFAVGCYYLMVGHKNEHARRYLSKATTLEKTYGPAWIAYGHSFAVESEHDQAMAAYFTAAQLMKGCHLPMLYIGLEYGLTNNS
KLAERFFGQALSIAPEDPFVIHEVGVVAFQNGEWKTAEKWFLDALEKIKAIGNEVTVDKWEPLLNNLGHVCRKLKKYAEALDYHRQALVLIPQNASTYSAIGYIHSLMGNFENAVDYFHTALGLRRDD
TFSVTMLGHCIEMYIGDSEAYIGADIKDKLKCYDFDVHTMKTLKNIISPPWDFRDFEVEKQNTEEAGLAPLENATKTPESRPSLEETFEIEMNESDMMLETSMSDHST

hide sequence

Ensembl Acc Id:

ENSRNOP00000023736 ⟸ ENSRNOT00000023736

Ensembl Acc Id:

ENSRNOP00000068614 ⟸ ENSRNOT00000090674

RefSeq Acc Id:	XP_038950338 ⟸ XM_039094410
- Peptide Label:	isoform X1
- UniProtKB:	A0A0G2JT88 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_063131324 ⟸ XM_063275254
- Peptide Label:	isoform X2

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q4V884-F1-model_v2	AlphaFold	Q4V884	1-620	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

RGD ID:

13700227

Promoter ID:

EPDNEW_R10751

Type:

multiple initiation site

Name:

Cdc16_1

Description:

cell division cycle 16

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	16	81,493,346 - 81,493,406	EPDNEW

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-10732	BioCyc
Ensembl Genes	ENSRNOG00000017536	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000023736	ENTREZGENE
	ENSRNOT00000023736.8	UniProtKB/TrEMBL
	ENSRNOT00000090674.2	UniProtKB/TrEMBL
	ENSRNOT00000092531.2	UniProtKB/TrEMBL
Gene3D-CATH	1.25.40.10	UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7462333	IMAGE-MGC_LOAD
InterPro	TPR-like_helical	UniProtKB/TrEMBL
	TPR_repeat	UniProtKB/TrEMBL
KEGG Report	rno:290875	UniProtKB/TrEMBL
MGC_CLONE	MGC:114573	IMAGE-MGC_LOAD
NCBI Gene	290875	ENTREZGENE
PANTHER	CELL DIVISION CYCLE 16,23,27	UniProtKB/TrEMBL
	CELL DIVISION CYCLE PROTEIN 16 HOMOLOG	UniProtKB/TrEMBL
Pfam	ANAPC3	UniProtKB/TrEMBL
	TPR_12	UniProtKB/TrEMBL
PhenoGen	Cdc16	PhenoGen
PROSITE	TPR	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000017536	RatGTEx
SMART	TPR	UniProtKB/TrEMBL
Superfamily-SCOP	HCP-like	UniProtKB/TrEMBL
	SSF48452	UniProtKB/TrEMBL
UniProt	A0A0G2JT88	ENTREZGENE, UniProtKB/TrEMBL
	A0A8I6AE10_RAT	UniProtKB/TrEMBL
	A6IWG0_RAT	UniProtKB/TrEMBL
	Q4V884	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2013-01-31	Cdc16	cell division cycle 16	Cdc16	cell division cycle 16 homolog (S. cerevisiae)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2010-04-20	Cdc16	cell division cycle 16 homolog (S. cerevisiae)	Cdc16	CDC16 cell division cycle 16 homolog (S. cerevisiae)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-12-06	Cdc16	CDC16 cell division cycle 16 homolog (S. cerevisiae)	Cdc16_predicted	CDC16 cell division cycle 16 homolog (S. cerevisiae) (predicted)	Symbol and Name updated	1559027	APPROVED
2005-01-12	Cdc16_predicted	CDC16 cell division cycle 16 homolog (S. cerevisiae) (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Send us a Message

Imported Disease Annotations - ClinVar

Imported Annotations - KEGG (archival)