Symbol:
Tbc1d20
Name:
TBC1 domain family, member 20
RGD ID:
1303293
Description:
Predicted to enable GTPase activator activity and small GTPase binding activity. Predicted to be involved in several processes, including COPII-coated vesicle cargo loading; positive regulation by host of viral genome replication; and positive regulation by virus of viral protein levels in host cell. Predicted to act upstream of or within several processes, including acrosome assembly; lens fiber cell morphogenesis; and seminiferous tubule development. Predicted to be located in Golgi membrane; endoplasmic reticulum membrane; and nuclear membrane. Human ortholog(s) of this gene implicated in Warburg micro syndrome 4. Orthologous to human TBC1D20 (TBC1 domain family member 20); INTERACTS WITH (+)-schisandrin B; 2,3,7,8-tetrachlorodibenzodioxine; 2,6-dinitrotoluene.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
MGC94895; similar to chromosome 20 open reading frame 140; TBC1 domain family member 20
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
TBC1D20 (TBC1 domain family member 20) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Tbc1d20 (TBC1 domain family, member 20) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Tbc1d20 (TBC1 domain family member 20) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
TBC1D20 (TBC1 domain family member 20) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
TBC1D20 (TBC1 domain family member 20) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Tbc1d20 (TBC1 domain family member 20) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
TBC1D20 (TBC1 domain family member 20) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
TBC1D20 (TBC1 domain family member 20) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Tbc1d20 (TBC1 domain family member 20) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
TBC1D20 (TBC1 domain family member 20)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Tbc1d20 (TBC1 domain family, member 20)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
tbc1d20 (TBC1 domain family, member 20)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
CG17883
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
GYP8
Alliance
DIOPT (Ensembl Compara|Hieranoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
tbc-20
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
tbc1d20.1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 3 161,228,699 - 161,247,319 (+) NCBI GRCr8 mRatBN7.2 3 140,768,537 - 140,787,010 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 3 140,768,537 - 140,785,121 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 3 144,673,328 - 144,690,001 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 3 153,257,161 - 153,273,834 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 3 150,997,769 - 151,014,273 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 3 147,772,006 - 147,790,946 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 3 147,772,165 - 147,789,158 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 3 154,120,296 - 154,137,199 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 3 142,623,713 - 142,640,197 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 3 142,529,285 - 142,545,770 (+) NCBI Celera 3 139,520,860 - 139,537,468 (+) NCBI Celera Cytogenetic Map 3 q41 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Tbc1d20 Rat (+)-schisandrin B multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in increased expression of TBC1D20 mRNA] CTD PMID:31150632 Tbc1d20 Rat 2,2',4,4',5,5'-hexachlorobiphenyl multiple interactions ISO Tbc1d20 (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Tbc1d20 Rat 2,2',5,5'-tetrachlorobiphenyl multiple interactions ISO Tbc1d20 (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Tbc1d20 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Tbc1d20 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of TBC1D20 mRNA CTD PMID:19770486 and PMID:31961203 Tbc1d20 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of TBC1D20 mRNA CTD PMID:33387578 Tbc1d20 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Tbc1d20 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of TBC1D20 mRNA CTD PMID:21570461 Tbc1d20 Rat 2,6-dinitrotoluene affects expression EXP 6480464 2 and 6-dinitrotoluene affects the expression of TBC1D20 mRNA CTD PMID:21346803 Tbc1d20 Rat 2-hydroxypropanoic acid decreases expression ISO TBC1D20 (Homo sapiens) 6480464 Lactic Acid results in decreased expression of TBC1D20 mRNA CTD PMID:30851411 Tbc1d20 Rat all-trans-retinoic acid decreases expression ISO TBC1D20 (Homo sapiens) 6480464 Tretinoin results in decreased expression of TBC1D20 mRNA CTD PMID:33167477 Tbc1d20 Rat benzo[a]pyrene increases expression ISO TBC1D20 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased expression of TBC1D20 mRNA CTD PMID:26238291 Tbc1d20 Rat benzo[a]pyrene decreases methylation ISO TBC1D20 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased methylation of TBC1D20 promoter CTD PMID:27901495 Tbc1d20 Rat benzo[a]pyrene diol epoxide I increases expression ISO TBC1D20 (Homo sapiens) 6480464 7 more ... CTD PMID:26238291 Tbc1d20 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of TBC1D20 mRNA CTD PMID:25181051 more ... Tbc1d20 Rat bisphenol A affects response to substance ISO Tbc1d20 (Mus musculus) 6480464 TBC1D20 mRNA alternative form affects the susceptibility to bisphenol A CTD PMID:31020848 Tbc1d20 Rat bisphenol A increases expression ISO Tbc1d20 (Mus musculus) 6480464 bisphenol A results in increased expression of TBC1D20 mRNA alternative form CTD PMID:31020848 Tbc1d20 Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of TBC1D20 gene CTD PMID:28505145 Tbc1d20 Rat caffeine increases phosphorylation ISO TBC1D20 (Homo sapiens) 6480464 Caffeine results in increased phosphorylation of TBC1D20 protein CTD PMID:35688186 Tbc1d20 Rat chlorpyrifos increases expression ISO Tbc1d20 (Mus musculus) 6480464 Chlorpyrifos results in increased expression of TBC1D20 mRNA CTD PMID:37019170 Tbc1d20 Rat cocaine affects expression EXP 6480464 Cocaine affects the expression of TBC1D20 mRNA CTD PMID:20187946 Tbc1d20 Rat cyclosporin A increases expression ISO TBC1D20 (Homo sapiens) 6480464 Cyclosporine results in increased expression of TBC1D20 mRNA CTD PMID:20106945 more ... Tbc1d20 Rat Dibutyl phosphate affects expression ISO TBC1D20 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of TBC1D20 mRNA CTD PMID:37042841 Tbc1d20 Rat endosulfan increases expression EXP 6480464 Endosulfan results in increased expression of TBC1D20 mRNA CTD PMID:29391264 Tbc1d20 Rat fenthion increases expression ISO Tbc1d20 (Mus musculus) 6480464 Fenthion results in increased expression of TBC1D20 mRNA CTD PMID:34813904 Tbc1d20 Rat folic acid decreases expression ISO Tbc1d20 (Mus musculus) 6480464 Folic Acid results in decreased expression of TBC1D20 mRNA CTD PMID:25629700 Tbc1d20 Rat formaldehyde decreases expression ISO TBC1D20 (Homo sapiens) 6480464 Formaldehyde results in decreased expression of TBC1D20 mRNA CTD PMID:20655997 Tbc1d20 Rat furan increases methylation EXP 6480464 furan results in increased methylation of TBC1D20 gene CTD PMID:22079235 Tbc1d20 Rat inulin multiple interactions ISO Tbc1d20 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in increased expression of TBC1D20 mRNA CTD PMID:36331819 Tbc1d20 Rat leflunomide decreases expression ISO TBC1D20 (Homo sapiens) 6480464 leflunomide results in decreased expression of TBC1D20 mRNA CTD PMID:28988120 Tbc1d20 Rat methidathion increases expression ISO Tbc1d20 (Mus musculus) 6480464 methidathion results in increased expression of TBC1D20 mRNA CTD PMID:34813904 Tbc1d20 Rat nickel sulfate decreases expression ISO TBC1D20 (Homo sapiens) 6480464 nickel sulfate results in decreased expression of TBC1D20 mRNA CTD PMID:22714537 Tbc1d20 Rat nitrates multiple interactions ISO Tbc1d20 (Mus musculus) 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of TBC1D20 mRNA CTD PMID:35964746 Tbc1d20 Rat paracetamol increases expression ISO TBC1D20 (Homo sapiens) 6480464 Acetaminophen results in increased expression of TBC1D20 mRNA CTD PMID:21420995 and PMID:29067470 Tbc1d20 Rat PCB138 multiple interactions ISO Tbc1d20 (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Tbc1d20 Rat perfluorohexanesulfonic acid decreases expression ISO Tbc1d20 (Mus musculus) 6480464 perfluorohexanesulfonic acid results in decreased expression of TBC1D20 mRNA CTD PMID:37995155 Tbc1d20 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Tbc1d20 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in increased expression of TBC1D20 mRNA and [perfluorooctane sulfonic acid co-treated with Pectins] results in increased expression of TBC1D20 mRNA CTD PMID:36331819 Tbc1d20 Rat pirinixic acid increases expression ISO Tbc1d20 (Mus musculus) 6480464 pirinixic acid results in increased expression of TBC1D20 mRNA CTD PMID:18301758 Tbc1d20 Rat rac-lactic acid decreases expression ISO TBC1D20 (Homo sapiens) 6480464 Lactic Acid results in decreased expression of TBC1D20 mRNA CTD PMID:30851411 Tbc1d20 Rat silver atom increases expression ISO Tbc1d20 (Mus musculus) 6480464 Silver results in increased expression of TBC1D20 mRNA CTD PMID:27131904 Tbc1d20 Rat silver(0) increases expression ISO Tbc1d20 (Mus musculus) 6480464 Silver results in increased expression of TBC1D20 mRNA CTD PMID:27131904 Tbc1d20 Rat sodium arsenite decreases expression ISO TBC1D20 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of TBC1D20 mRNA CTD PMID:22714537 Tbc1d20 Rat sodium arsenite increases expression ISO TBC1D20 (Homo sapiens) 6480464 sodium arsenite results in increased expression of TBC1D20 mRNA CTD PMID:38568856 Tbc1d20 Rat sunitinib increases expression ISO TBC1D20 (Homo sapiens) 6480464 Sunitinib results in increased expression of TBC1D20 mRNA CTD PMID:31533062 Tbc1d20 Rat tetrachloromethane multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in increased expression of TBC1D20 mRNA] CTD PMID:31150632 Tbc1d20 Rat tetrachloromethane increases expression EXP 6480464 Carbon Tetrachloride results in increased expression of TBC1D20 mRNA CTD PMID:31150632 Tbc1d20 Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of TBC1D20 mRNA CTD PMID:34492290 Tbc1d20 Rat thiram increases expression ISO TBC1D20 (Homo sapiens) 6480464 Thiram results in increased expression of TBC1D20 mRNA CTD PMID:38568856 Tbc1d20 Rat titanium dioxide increases methylation ISO Tbc1d20 (Mus musculus) 6480464 titanium dioxide results in increased methylation of TBC1D20 gene CTD PMID:35295148 Tbc1d20 Rat valproic acid increases expression ISO TBC1D20 (Homo sapiens) 6480464 Valproic Acid results in increased expression of TBC1D20 mRNA CTD PMID:23179753
(+)-schisandrin B (EXP) 2,2',4,4',5,5'-hexachlorobiphenyl (ISO) 2,2',5,5'-tetrachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,6-dinitrotoluene (EXP) 2-hydroxypropanoic acid (ISO) all-trans-retinoic acid (ISO) benzo[a]pyrene (ISO) benzo[a]pyrene diol epoxide I (ISO) bisphenol A (EXP,ISO) caffeine (ISO) chlorpyrifos (ISO) cocaine (EXP) cyclosporin A (ISO) Dibutyl phosphate (ISO) endosulfan (EXP) fenthion (ISO) folic acid (ISO) formaldehyde (ISO) furan (EXP) inulin (ISO) leflunomide (ISO) methidathion (ISO) nickel sulfate (ISO) nitrates (ISO) paracetamol (ISO) PCB138 (ISO) perfluorohexanesulfonic acid (ISO) perfluorooctane-1-sulfonic acid (ISO) pirinixic acid (ISO) rac-lactic acid (ISO) silver atom (ISO) silver(0) (ISO) sodium arsenite (ISO) sunitinib (ISO) tetrachloromethane (EXP) thioacetamide (EXP) thiram (ISO) titanium dioxide (ISO) valproic acid (ISO)
Biological Process
acrosome assembly (IEA,ISO) camera-type eye development (IEA,ISO) COPII-coated vesicle cargo loading (IEA,ISO) endoplasmic reticulum to Golgi vesicle-mediated transport (IEA,ISO) Golgi organization (IEA,ISO) lens development in camera-type eye (IEA,ISO) lens fiber cell morphogenesis (IEA,ISO) lipid droplet organization (IEA,ISO) male gonad development (IEA,ISO) positive regulation by host of viral genome replication (IEA,ISO) positive regulation by virus of viral protein levels in host cell (IEA,ISO) positive regulation of ER to Golgi vesicle-mediated transport (IEA,ISO) positive regulation of GTPase activity (ISO) regulation of cilium assembly (ISO) seminiferous tubule development (IEA,ISO) spermatogenesis (IEA,ISO) vesicle-mediated transport (IEA) virion assembly (IEA)
Tbc1d20 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 3 161,228,699 - 161,247,319 (+) NCBI GRCr8 mRatBN7.2 3 140,768,537 - 140,787,010 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 3 140,768,537 - 140,785,121 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 3 144,673,328 - 144,690,001 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 3 153,257,161 - 153,273,834 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 3 150,997,769 - 151,014,273 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 3 147,772,006 - 147,790,946 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 3 147,772,165 - 147,789,158 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 3 154,120,296 - 154,137,199 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 3 142,623,713 - 142,640,197 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 3 142,529,285 - 142,545,770 (+) NCBI Celera 3 139,520,860 - 139,537,468 (+) NCBI Celera Cytogenetic Map 3 q41 NCBI
TBC1D20 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 20 435,480 - 462,533 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 20 423,596 - 462,566 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 20 416,124 - 443,177 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 20 364,124 - 391,187 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 20 364,125 - 391,147 NCBI Celera 20 510,958 - 538,015 (-) NCBI Celera Cytogenetic Map 20 p13 NCBI HuRef 20 367,459 - 394,130 (-) NCBI HuRef CHM1_1 20 416,126 - 443,204 (-) NCBI CHM1_1 T2T-CHM13v2.0 20 479,231 - 506,260 (-) NCBI T2T-CHM13v2.0
Tbc1d20 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 2 152,135,745 - 152,155,914 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 2 152,135,748 - 152,155,916 (+) Ensembl GRCm39 Ensembl GRCm38 2 152,293,826 - 152,313,994 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 2 152,293,828 - 152,313,996 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 2 152,119,608 - 152,138,326 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 2 151,985,313 - 152,004,031 (+) NCBI MGSCv36 mm8 Celera 2 158,107,984 - 158,126,733 (+) NCBI Celera Cytogenetic Map 2 G3 NCBI cM Map 2 74.83 NCBI
Tbc1d20 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955597 291,541 - 314,292 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955597 291,541 - 313,799 (-) NCBI ChiLan1.0 ChiLan1.0
TBC1D20 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 21 1,524,951 - 1,551,103 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 20 1,521,783 - 1,547,931 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 20 644,646 - 670,860 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 20 414,066 - 429,189 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 20 414,066 - 431,032 (-) Ensembl panpan1.1 panPan2
TBC1D20 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 24 20,400,647 - 20,419,652 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 24 20,400,791 - 20,419,655 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 24 20,054,600 - 20,073,599 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 24 21,093,909 - 21,112,923 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 24 21,093,893 - 21,112,920 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 24 20,368,969 - 20,388,211 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 24 20,475,176 - 20,494,176 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 24 20,905,480 - 20,924,706 (+) NCBI UU_Cfam_GSD_1.0
Tbc1d20 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024408640 169,603,422 - 169,624,377 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936485 18,034,732 - 18,055,767 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936485 18,034,776 - 18,055,741 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
TBC1D20 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 17 34,760,347 - 34,779,701 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 17 34,760,379 - 34,778,301 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 17 39,584,314 - 39,589,765 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
TBC1D20 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 2 56,065,975 - 56,093,521 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 2 56,066,042 - 56,094,333 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666078 7,861,563 - 7,886,879 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Tbc1d20
.
Predicted Target Of
Count of predictions: 107 Count of miRNA genes: 95 Interacting mature miRNAs: 101 Transcripts: ENSRNOT00000008713 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
2312673 Scl63 Serum cholesterol level QTL 63 0.001 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 3 98535255 168026850 Rat 1598877 Bp285 Blood pressure QTL 285 1.5 0.03 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 3 120538241 165538241 Rat 1578653 Vnigr3 Vascular neointimal growth QTL 3 3.1 artery morphology trait (VT:0002191) artery neointimal hyperplastic lesion area (CMO:0001414) 3 130656562 169034231 Rat 2302373 Gluco39 Glucose level QTL 39 5.01 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 3 98535386 161695835 Rat 70216 Cm14 Cardiac mass QTL 14 2.1 heart mass (VT:0007028) heart wet weight (CMO:0000069) 3 31172320 163586636 Rat 2292591 Esta4 Estrogen-induced thymic atrophy QTL 4 thymus mass (VT:0004954) thymus wet weight (CMO:0000855) 3 47233211 147415807 Rat 2298477 Eau4 Experimental allergic uveoretinitis QTL 4 0.0011 uvea integrity trait (VT:0010551) experimental autoimmune uveitis score (CMO:0001504) 3 137398739 169034231 Rat 1581568 Rf53 Renal function QTL 53 urine total protein amount (VT:0000032) urine protein excretion rate to body weight ratio (CMO:0001099) 3 56395968 161299569 Rat 1578754 Stresp16 Stress response QTL 16 4 0.001 blood renin amount (VT:0003349) plasma renin activity level (CMO:0000116) 3 112681431 157681431 Rat 1300173 Rf11 Renal function QTL 11 3.38 renal blood flow trait (VT:2000006) absolute change in renal blood flow rate (CMO:0001168) 3 121056165 145956249 Rat 9589106 Insul23 Insulin level QTL 23 13.86 0.001 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 3 131635904 169034231 Rat 10755461 Coatc16 Coat color QTL 16 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 3 122438700 167438700 Rat 8662816 Vetf4 Vascular elastic tissue fragility QTL 4 4 renal artery integrity trait (VT:0010642) number of ruptures of the internal elastic lamina of the renal arteries (CMO:0002563) 3 59242096 157323038 Rat 1559282 Emca5 Estrogen-induced mammary cancer QTL 5 3.9 mammary gland integrity trait (VT:0010552) percentage of study population developing mammary tumors during a period of time (CMO:0000948) 3 43827364 169034231 Rat 1354611 Despr2 Despair related QTL 2 3.03 0.0028 locomotor behavior trait (VT:0001392) amount of time spent in voluntary immobility (CMO:0001043) 3 97084464 142084464 Rat 2303620 Vencon4 Ventilatory control QTL 4 3.9 respiration trait (VT:0001943) tidal volume (CMO:0000222) 3 127162703 168026850 Rat 631841 Niddm39 Non-insulin dependent diabetes mellitus QTL 39 3.36 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 3 94856903 159898684 Rat 1576306 Schws3 Schwannoma susceptibility QTL 3 0.001 nervous system integrity trait (VT:0010566) percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017) 3 118839124 163839124 Rat 619618 Rf3 Renal disease susceptibility QTL 3 6.5 0.001 urine albumin amount (VT:0002871) urine albumin excretion rate to body weight ratio (CMO:0001270) 3 107693393 152693393 Rat 1300159 Kidm4 Kidney mass QTL 4 3.83 kidney mass (VT:0002707) right kidney wet weight to body weight ratio (CMO:0001953) 3 121056165 157309487 Rat 5686842 Rf59 Renal function QTL 59 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 3 140069424 146976080 Rat 2301971 Cm71 Cardiac mass QTL 71 4.63 heart left ventricle mass (VT:0007031) heart left ventricle weight (CMO:0000776) 3 41874578 155617519 Rat 2312659 Slep7 Serum leptin concentration QTL 7 0.001 blood leptin amount (VT:0005667) serum leptin level (CMO:0000780) 3 98535255 168026850 Rat 631673 Iddm13 Insulin dependent diabetes mellitus QTL 13 1.3 0.663 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 3 130193298 161695983 Rat 2301970 Bw81 Body weight QTL 81 5.19 body mass (VT:0001259) body weight (CMO:0000012) 3 41874578 155617519 Rat 1581546 Pur13 Proteinuria QTL 13 2.93 0.0335 urine total protein amount (VT:0000032) urine protein excretion rate (CMO:0000759) 3 78196190 146592722 Rat 1578656 Vnigr2 Vascular neointimal growth QTL 2 4.2 artery morphology trait (VT:0002191) lesioned artery residual lumen area (CMO:0001417) 3 130656562 169034231 Rat 8552952 Pigfal13 Plasma insulin-like growth factor 1 level QTL 13 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 3 138799500 169034231 Rat 631541 Bp81 Blood pressure QTL 81 4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 3 124122556 169034231 Rat 2293087 Iddm27 Insulin dependent diabetes mellitus QTL 27 2.68 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 3 97551417 147415807 Rat 2312670 Bw94 Body weight QTL 94 0.01 inguinal fat pad mass (VT:0010424) inguinal fat pad weight to body weight ratio (CMO:0001253) 3 98535255 168026850 Rat
BE118229
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 3 140,782,217 - 140,782,367 (+) MAPPER mRatBN7.2 Rnor_6.0 3 147,786,155 - 147,786,304 NCBI Rnor6.0 Rnor_5.0 3 154,134,296 - 154,134,445 UniSTS Rnor5.0 RGSC_v3.4 3 142,637,294 - 142,637,443 UniSTS RGSC3.4 Celera 3 139,534,565 - 139,534,714 UniSTS RH 3.4 Map 3 1277.5 UniSTS Cytogenetic Map 3 q41 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000008713 ⟹ ENSRNOP00000008713
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 3 140,768,537 - 140,785,121 (+) Ensembl Rnor_6.0 Ensembl 3 147,772,165 - 147,789,158 (+) Ensembl
RefSeq Acc Id:
NM_001004281 ⟹ NP_001004281
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 161,228,848 - 161,245,430 (+) NCBI mRatBN7.2 3 140,768,537 - 140,785,121 (+) NCBI Rnor_6.0 3 147,772,155 - 147,789,058 (+) NCBI Rnor_5.0 3 154,120,296 - 154,137,199 (+) NCBI RGSC_v3.4 3 142,623,713 - 142,640,197 (+) RGD Celera 3 139,520,860 - 139,537,468 (+) RGD
Sequence:
CCGCGCGTCAGGCTCCGCCGCCAGCCGGGGCTCGGGCTGGGGCCCGGGCCCCCGGGGATGGCCCTCCGGCCCTCAGAGGGCGACGGCTCCGCCGGCCGCTGGAACCGCGGCTCAGGGAAGGCAGACTT
hide sequence
RefSeq Acc Id:
XM_039105482 ⟹ XP_038961410
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 161,229,001 - 161,247,319 (+) NCBI mRatBN7.2 3 140,768,675 - 140,787,010 (+) NCBI
RefSeq Acc Id:
XM_039105483 ⟹ XP_038961411
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 161,228,998 - 161,247,319 (+) NCBI mRatBN7.2 3 140,768,673 - 140,787,010 (+) NCBI
RefSeq Acc Id:
XM_039105485 ⟹ XP_038961413
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 161,228,995 - 161,247,319 (+) NCBI mRatBN7.2 3 140,768,671 - 140,784,996 (+) NCBI
RefSeq Acc Id:
XM_063284174 ⟹ XP_063140244
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 161,228,699 - 161,247,319 (+) NCBI
RefSeq Acc Id:
XM_063284175 ⟹ XP_063140245
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 161,229,658 - 161,247,319 (+) NCBI
RefSeq Acc Id:
XM_063284176 ⟹ XP_063140246
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 161,228,699 - 161,247,319 (+) NCBI
RefSeq Acc Id:
NP_001004281 ⟸ NM_001004281
- UniProtKB:
Q6AXR1 (UniProtKB/TrEMBL), A6KHM6 (UniProtKB/TrEMBL), F7EVY6 (UniProtKB/TrEMBL)
- Sequence:
MALRPSEGDGSAGRWNRGSGKADFNAKRKKKVAEIHQALNSDPTDVAALRRMAISEGGLLTDEIRCQVWPKLLNVNTDEPPPMSRKDLRDMSKDYQQVLLDVRRSLRRFPPGMPDEQREGLQEELIDI
hide sequence
Ensembl Acc Id:
ENSRNOP00000008713 ⟸ ENSRNOT00000008713
RefSeq Acc Id:
XP_038961413 ⟸ XM_039105485
- Peptide Label:
isoform X5
RefSeq Acc Id:
XP_038961411 ⟸ XM_039105483
- Peptide Label:
isoform X2
RefSeq Acc Id:
XP_038961410 ⟸ XM_039105482
- Peptide Label:
isoform X1
RefSeq Acc Id:
XP_063140244 ⟸ XM_063284174
- Peptide Label:
isoform X3
RefSeq Acc Id:
XP_063140246 ⟸ XM_063284176
- Peptide Label:
isoform X6
RefSeq Acc Id:
XP_063140245 ⟸ XM_063284175
- Peptide Label:
isoform X4
RGD ID: 13692532 Promoter ID: EPDNEW_R3057 Type: initiation region Name: Tbc1d20_1 Description: TBC1 domain family, member 20 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 3 147,772,114 - 147,772,174 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2006-03-30
Tbc1d20
TBC1 domain family, member 20
MGC94895
similar to chromosome 20 open reading frame 140
Symbol and Name updated
1299863 APPROVED
2005-09-30
MGC94895
Symbol and Name status set to provisional
70820 PROVISIONAL
