Symbol:
Atp5mg
Name:
ATP synthase membrane subunit G
RGD ID:
1303259
Description:
Predicted to enable proton transmembrane transporter activity. Predicted to contribute to proton-transporting ATP synthase activity, rotational mechanism. Predicted to be involved in proton motive force-driven mitochondrial ATP synthesis. Part of proton-transporting ATP synthase complex. Orthologous to several human genes including ATP5MG (ATP synthase membrane subunit g); PARTICIPATES IN oxidative phosphorylation pathway; INTERACTS WITH 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine; 6-propyl-2-thiouracil.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
ATP synthase subunit g, mitochondrial; ATP synthase, H+ transporting, mitochondrial F0 complex, subunit G; ATP synthase, H+ transporting, mitochondrial Fo complex, subunit G; Atp5l; ATPase subunit g; MGC72942; similar to CG6105-PA
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
ATP5MG (ATP synthase membrane subunit g) HGNC
EggNOG, Ensembl, HomoloGene, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Atp5mg (ATP synthase membrane subunit g) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Atp5mg (ATP synthase membrane subunit g) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
ATP5MG (ATP synthase membrane subunit g) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
ATP5MG (ATP synthase membrane subunit g) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Atp5mg (ATP synthase membrane subunit g) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
ATP5MG (ATP synthase membrane subunit g) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
ATP5MG (ATP synthase membrane subunit g) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Atp5mg (ATP synthase membrane subunit g) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
ATP5MGL (ATP synthase membrane subunit g like) HGNC
EggNOG, Ensembl, Inparanoid, Panther, PhylomeDB, Treefam
Homo sapiens (human):
ZNF518A (zinc finger protein 518A) HGNC
OMA
Alliance orthologs 3
Homo sapiens (human):
ATP5MGL (ATP synthase membrane subunit g like)
Alliance
DIOPT (Ensembl Compara|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB)
Homo sapiens (human):
ATP5MG (ATP synthase membrane subunit g)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Atp5mg (ATP synthase membrane subunit g)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Atg5lrt (ATP synthase, H+ transporting, mitochondrial F0 complex, subunit G, retrotransposed)
Alliance
DIOPT (Ensembl Compara|OrthoFinder|PANTHER|PhylomeDB)
Danio rerio (zebrafish):
atp5l (ATP synthase, H+ transporting, mitochondrial F0 complex, subunit g)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
ATP20
Alliance
DIOPT (Ensembl Compara|PANTHER)
Drosophila melanogaster (fruit fly):
ATPsynG
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Drosophila melanogaster (fruit fly):
ATPsynGL
Alliance
DIOPT (Ensembl Compara|Hieranoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
asg-1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
asg-2
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
atp5mg
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 8 54,122,457 - 54,130,407 (-) NCBI GRCr8 mRatBN7.2 8 45,225,680 - 45,233,630 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 8 45,225,686 - 45,233,559 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 8 50,721,063 - 50,728,984 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 8 48,999,784 - 49,007,705 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 8 46,870,364 - 46,878,285 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 8 49,220,441 - 49,227,273 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 8 49,220,443 - 49,227,273 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 8 47,838,594 - 47,845,425 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 8 47,869,992 - 47,876,824 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 8 47,878,757 - 47,885,590 (-) NCBI Celera 8 44,811,539 - 44,818,403 (-) NCBI Celera Cytogenetic Map 8 q22 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Atp5mg Rat 1,2-dimethylhydrazine multiple interactions ISO Atp5mg (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of ATP5MG mRNA CTD PMID:22206623 Atp5mg Rat 1,2-dimethylhydrazine decreases expression ISO Atp5mg (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of ATP5MG mRNA CTD PMID:22206623 Atp5mg Rat 17alpha-ethynylestradiol increases expression ISO Atp5mg (Mus musculus) 6480464 Ethinyl Estradiol results in increased expression of ATP5MG mRNA CTD PMID:17942748 Atp5mg Rat 17alpha-ethynylestradiol multiple interactions ISO Atp5mg (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of ATP5MG mRNA CTD PMID:17942748 Atp5mg Rat 17beta-estradiol decreases expression EXP 6480464 Estradiol results in decreased expression of ATP5MG protein CTD PMID:32145629 Atp5mg Rat 2,2',4,4',5,5'-hexachlorobiphenyl multiple interactions ISO Atp5mg (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Atp5mg Rat 2,2',5,5'-tetrachlorobiphenyl multiple interactions ISO Atp5mg (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Atp5mg Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Atp5mg (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of ATP5MG mRNA CTD PMID:21570461 Atp5mg Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of ATP5MG mRNA CTD PMID:34747641 Atp5mg Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Atp5mg (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of ATP5MG mRNA CTD PMID:20399798 Atp5mg Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Atp5mg (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of ATP5MG mRNA CTD PMID:17942748 Atp5mg Rat 4,4'-diaminodiphenylmethane affects expression ISO Atp5mg (Mus musculus) 6480464 4 and 4'-diaminodiphenylmethane affects the expression of ATP5MG mRNA CTD PMID:18648102 Atp5mg Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of ATP5MG mRNA CTD PMID:30047161 Atp5mg Rat acetamide decreases expression EXP 6480464 acetamide results in decreased expression of ATP5MG mRNA CTD PMID:31881176 Atp5mg Rat aflatoxin B1 decreases methylation ISO ATP5MG (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of ATP5MG gene CTD PMID:27153756 Atp5mg Rat alpha-Zearalanol multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of ATP5MG mRNA and [Zeranol co-treated with perfluorooctanoic acid] results in increased expression of ATP5MG mRNA CTD PMID:35163327 Atp5mg Rat amitrole increases expression EXP 6480464 Amitrole results in increased expression of ATP5MG mRNA CTD PMID:30047161 Atp5mg Rat arsenite(3-) decreases expression ISO Atp5mg (Mus musculus) 6480464 arsenite results in decreased expression of ATP5MG mRNA CTD PMID:33053406 Atp5mg Rat arsenite(3-) multiple interactions ISO ATP5MG (Homo sapiens) 6480464 arsenite promotes the reaction [G3BP1 protein binds to ATP5MG mRNA] and arsenite promotes the reaction [G3BP1 protein binds to ATP5MG protein] CTD PMID:32406909 Atp5mg Rat atrazine increases expression ISO ATP5MG (Homo sapiens) 6480464 Atrazine results in increased expression of ATP5MG mRNA CTD PMID:22378314 Atp5mg Rat benzalkonium chloride decreases expression ISO Atp5mg (Mus musculus) 6480464 Benzalkonium Compounds results in decreased expression of ATP5MG mRNA CTD PMID:31199489 Atp5mg Rat benzo[a]pyrene increases methylation ISO ATP5MG (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of ATP5MG promoter CTD PMID:27901495 Atp5mg Rat beta-lapachone decreases expression ISO ATP5MG (Homo sapiens) 6480464 beta-lapachone results in decreased expression of ATP5MG mRNA CTD PMID:38218311 Atp5mg Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of ATP5MG mRNA and bisphenol A results in increased expression of ATP5MG protein CTD PMID:25181051 more ... Atp5mg Rat bisphenol A increases expression ISO ATP5MG (Homo sapiens) 6480464 bisphenol A results in increased expression of ATP5MG protein CTD PMID:37567409 Atp5mg Rat bisphenol A affects expression ISO ATP5MG (Homo sapiens) 6480464 bisphenol A affects the expression of ATP5MG mRNA CTD PMID:30903817 Atp5mg Rat bisphenol A increases expression ISO Atp5mg (Mus musculus) 6480464 bisphenol A results in increased expression of ATP5MG mRNA CTD PMID:33221593 and PMID:38074096 Atp5mg Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of ATP5MG mRNA CTD PMID:30903817 Atp5mg Rat bisphenol AF increases expression ISO ATP5MG (Homo sapiens) 6480464 bisphenol AF results in increased expression of ATP5MG mRNA CTD PMID:25912373 Atp5mg Rat Butylparaben increases expression ISO ATP5MG (Homo sapiens) 6480464 butylparaben results in increased expression of ATP5MG mRNA CTD PMID:17121429 Atp5mg Rat carbon nanotube increases expression ISO Atp5mg (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25620056 Atp5mg Rat CGP 52608 multiple interactions ISO ATP5MG (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to ATP5MG gene] CTD PMID:28238834 Atp5mg Rat chloropicrin increases expression ISO ATP5MG (Homo sapiens) 6480464 chloropicrin results in increased expression of ATP5MG mRNA CTD PMID:26352163 Atp5mg Rat chrysene decreases expression ISO Atp5mg (Mus musculus) 6480464 chrysene results in decreased expression of ATP5MG mRNA CTD PMID:26377693 Atp5mg Rat cisplatin increases expression EXP 6480464 Cisplatin results in increased expression of ATP5MG protein CTD PMID:22023808 Atp5mg Rat clofibrate decreases expression ISO Atp5mg (Mus musculus) 6480464 Clofibrate results in decreased expression of ATP5MG mRNA CTD PMID:17585979 Atp5mg Rat cyclosporin A decreases expression ISO ATP5MG (Homo sapiens) 6480464 Cyclosporine results in decreased expression of ATP5MG mRNA CTD PMID:20106945 and PMID:22147139 Atp5mg Rat dibutyl phthalate decreases expression EXP 6480464 Dibutyl Phthalate results in decreased expression of ATP5MG mRNA CTD PMID:21266533 Atp5mg Rat dihydroartemisinin affects binding ISO ATP5MG (Homo sapiens) 6480464 artenimol analog binds to ATP5MG protein CTD PMID:26340163 Atp5mg Rat doxorubicin increases expression ISO ATP5MG (Homo sapiens) 6480464 Doxorubicin results in increased expression of ATP5MG mRNA CTD PMID:29803840 Atp5mg Rat epoxiconazole increases expression ISO Atp5mg (Mus musculus) 6480464 epoxiconazole results in increased expression of ATP5MG mRNA CTD PMID:35436446 Atp5mg Rat fenthion increases expression ISO Atp5mg (Mus musculus) 6480464 Fenthion results in increased expression of ATP5MG mRNA CTD PMID:34813904 Atp5mg Rat folic acid decreases expression ISO Atp5mg (Mus musculus) 6480464 Folic Acid results in decreased expression of ATP5MG mRNA CTD PMID:25629700 Atp5mg Rat folic acid multiple interactions ISO Atp5mg (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of ATP5MG mRNA CTD PMID:22206623 Atp5mg Rat furan increases methylation EXP 6480464 furan results in increased methylation of ATP5MG gene CTD PMID:22079235 Atp5mg Rat isobutanol multiple interactions ISO ATP5MG (Homo sapiens) 6480464 [[Gasoline co-treated with isobutyl alcohol] results in increased abundance of [Particulate Matter co-treated with Polycyclic Aromatic Hydrocarbons]] which results in decreased expression of ATP5MG mRNA CTD PMID:29432896 Atp5mg Rat ivermectin decreases expression ISO ATP5MG (Homo sapiens) 6480464 Ivermectin results in decreased expression of ATP5MG protein CTD PMID:32959892 Atp5mg Rat lipopolysaccharide multiple interactions ISO ATP5MG (Homo sapiens) 6480464 [Acetaminophen co-treated with Lipopolysaccharides] results in decreased expression of ATP5MG mRNA CTD PMID:31059760 Atp5mg Rat Mesaconitine increases expression EXP 6480464 mesaconitine results in increased expression of ATP5MG protein CTD PMID:37182599 Atp5mg Rat methimazole increases expression EXP 6480464 Methimazole results in increased expression of ATP5MG mRNA CTD PMID:30047161 Atp5mg Rat methylmercury chloride decreases expression ISO ATP5MG (Homo sapiens) 6480464 methylmercuric chloride results in decreased expression of ATP5MG mRNA CTD PMID:28001369 Atp5mg Rat methylparaben increases expression ISO ATP5MG (Homo sapiens) 6480464 methylparaben results in increased expression of ATP5MG mRNA CTD PMID:17121429 Atp5mg Rat N-methyl-4-phenylpyridinium increases expression ISO Atp5mg (Mus musculus) 6480464 1-Methyl-4-phenylpyridinium results in increased expression of ATP5MG protein CTD PMID:26558463 Atp5mg Rat niclosamide decreases expression ISO ATP5MG (Homo sapiens) 6480464 Niclosamide results in decreased expression of ATP5MG mRNA CTD PMID:22576131 Atp5mg Rat ozone multiple interactions ISO Atp5mg (Mus musculus) 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in increased expression of ATP5MG mRNA CTD PMID:34911549 Atp5mg Rat paracetamol increases expression ISO ATP5MG (Homo sapiens) 6480464 Acetaminophen results in increased expression of ATP5MG mRNA CTD PMID:25704631 Atp5mg Rat paracetamol decreases expression ISO ATP5MG (Homo sapiens) 6480464 Acetaminophen results in decreased expression of ATP5MG mRNA CTD PMID:31059760 Atp5mg Rat paracetamol multiple interactions ISO ATP5MG (Homo sapiens) 6480464 [Acetaminophen co-treated with Lipopolysaccharides] results in decreased expression of ATP5MG mRNA CTD PMID:31059760 Atp5mg Rat PCB138 multiple interactions ISO Atp5mg (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Atp5mg Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Atp5mg (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Pectins] results in increased expression of ATP5MG mRNA and PPARA protein inhibits the reaction [perfluorooctane sulfonic acid results in decreased expression of ATP5MG mRNA] CTD PMID:20936131 and PMID:36331819 Atp5mg Rat perfluorooctane-1-sulfonic acid decreases expression ISO Atp5mg (Mus musculus) 6480464 perfluorooctane sulfonic acid results in decreased expression of ATP5MG mRNA CTD PMID:20936131 Atp5mg Rat perfluorooctanoic acid multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of ATP5MG mRNA and [Zeranol co-treated with perfluorooctanoic acid] results in increased expression of ATP5MG mRNA CTD PMID:35163327 Atp5mg Rat phenethyl isothiocyanate affects binding ISO ATP5MG (Homo sapiens) 6480464 ATP5MG protein binds to phenethyl isothiocyanate CTD PMID:21838287 Atp5mg Rat resveratrol multiple interactions ISO ATP5MG (Homo sapiens) 6480464 [Plant Extracts co-treated with Resveratrol] results in decreased expression of ATP5MG mRNA CTD PMID:23557933 Atp5mg Rat resveratrol increases expression ISO Atp5mg (Mus musculus) 6480464 Resveratrol results in increased expression of ATP5MG mRNA CTD PMID:22610192 Atp5mg Rat rotenone increases expression ISO ATP5MG (Homo sapiens) 6480464 Rotenone results in increased expression of ATP5MG mRNA CTD PMID:18191903 Atp5mg Rat sodium arsenite increases expression EXP 6480464 sodium arsenite results in increased expression of ATP5MG protein CTD PMID:29459688 Atp5mg Rat sodium arsenite increases expression ISO ATP5MG (Homo sapiens) 6480464 sodium arsenite results in increased expression of ATP5MG mRNA CTD PMID:34032870 Atp5mg Rat sulfadimethoxine increases expression EXP 6480464 Sulfadimethoxine results in increased expression of ATP5MG mRNA CTD PMID:30047161 Atp5mg Rat sunitinib decreases expression ISO ATP5MG (Homo sapiens) 6480464 Sunitinib results in decreased expression of ATP5MG mRNA CTD PMID:31533062 Atp5mg Rat thioacetamide decreases expression EXP 6480464 Thioacetamide results in decreased expression of ATP5MG mRNA CTD PMID:34492290 Atp5mg Rat titanium dioxide decreases expression ISO ATP5MG (Homo sapiens) 6480464 titanium dioxide results in decreased expression of ATP5MG protein CTD PMID:30910687 Atp5mg Rat tolcapone decreases expression EXP 6480464 tolcapone results in decreased expression of ATP5MG mRNA CTD PMID:24136188 Atp5mg Rat tolcapone affects binding EXP 6480464 tolcapone binds to ATP5MG protein CTD PMID:19783845 Atp5mg Rat triphenyl phosphate affects expression ISO ATP5MG (Homo sapiens) 6480464 triphenyl phosphate affects the expression of ATP5MG mRNA CTD PMID:37042841 Atp5mg Rat triptonide increases expression ISO Atp5mg (Mus musculus) 6480464 triptonide results in increased expression of ATP5MG mRNA CTD PMID:33045310 Atp5mg Rat tungsten increases expression ISO Atp5mg (Mus musculus) 6480464 Tungsten results in increased expression of ATP5MG mRNA CTD PMID:30912803 Atp5mg Rat valproic acid increases expression ISO ATP5MG (Homo sapiens) 6480464 Valproic Acid results in increased expression of ATP5MG mRNA CTD PMID:19101580 Atp5mg Rat valproic acid affects expression ISO ATP5MG (Homo sapiens) 6480464 Valproic Acid affects the expression of ATP5MG mRNA CTD PMID:25979313 Atp5mg Rat vanadium atom increases expression ISO ATP5MG (Homo sapiens) 6480464 Vanadium results in increased expression of ATP5MG mRNA CTD PMID:19000753 Atp5mg Rat vanadium(0) increases expression ISO ATP5MG (Homo sapiens) 6480464 Vanadium results in increased expression of ATP5MG mRNA CTD PMID:19000753 Atp5mg Rat vinclozolin decreases expression EXP 6480464 vinclozolin results in decreased expression of ATP5MG mRNA CTD PMID:23034163 Atp5mg Rat zidovudine increases expression ISO ATP5MG (Homo sapiens) 6480464 Zidovudine results in increased expression of ATP5MG mRNA CTD PMID:16894629
Imported Annotations - KEGG (archival)
1,2-dimethylhydrazine (ISO) 17alpha-ethynylestradiol (ISO) 17beta-estradiol (EXP) 2,2',4,4',5,5'-hexachlorobiphenyl (ISO) 2,2',5,5'-tetrachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 4,4'-diaminodiphenylmethane (ISO) 6-propyl-2-thiouracil (EXP) acetamide (EXP) aflatoxin B1 (ISO) alpha-Zearalanol (EXP) amitrole (EXP) arsenite(3-) (ISO) atrazine (ISO) benzalkonium chloride (ISO) benzo[a]pyrene (ISO) beta-lapachone (ISO) bisphenol A (EXP,ISO) bisphenol AF (ISO) Butylparaben (ISO) carbon nanotube (ISO) CGP 52608 (ISO) chloropicrin (ISO) chrysene (ISO) cisplatin (EXP) clofibrate (ISO) cyclosporin A (ISO) dibutyl phthalate (EXP) dihydroartemisinin (ISO) doxorubicin (ISO) epoxiconazole (ISO) fenthion (ISO) folic acid (ISO) furan (EXP) isobutanol (ISO) ivermectin (ISO) lipopolysaccharide (ISO) Mesaconitine (EXP) methimazole (EXP) methylmercury chloride (ISO) methylparaben (ISO) N-methyl-4-phenylpyridinium (ISO) niclosamide (ISO) ozone (ISO) paracetamol (ISO) PCB138 (ISO) perfluorooctane-1-sulfonic acid (ISO) perfluorooctanoic acid (EXP) phenethyl isothiocyanate (ISO) resveratrol (ISO) rotenone (ISO) sodium arsenite (EXP,ISO) sulfadimethoxine (EXP) sunitinib (ISO) thioacetamide (EXP) titanium dioxide (ISO) tolcapone (EXP) triphenyl phosphate (ISO) triptonide (ISO) tungsten (ISO) valproic acid (ISO) vanadium atom (ISO) vanadium(0) (ISO) vinclozolin (EXP) zidovudine (ISO)
1.
Reduced Mitochondrial Activity is Early and Steady in the Entorhinal Cortex but it is Mainly Unmodified in the Frontal Cortex in Alzheimer's Disease.
Armand-Ugon M, etal., Curr Alzheimer Res. 2017;14(12):1327-1334. doi: 10.2174/1567205014666170505095921.
2.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.
Mitochondrial F(0)F(1) ATP synthase. Subunit regions on the F1 motor shielded by F(0), Functional significance, and evidence for an involvement of the unique F(0) subunit F(6).
Ko YH, etal., J Biol Chem. 2000 Oct 20;275(42):32931-9.
4.
Identification of two proteins associated with mammalian ATP synthase.
Meyer B, etal., Mol Cell Proteomics. 2007 Oct;6(10):1690-9. Epub 2007 Jun 17.
5.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
6.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
7.
GOA pipeline
RGD automated data pipeline
8.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
9.
Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
Atp5mg Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 8 54,122,457 - 54,130,407 (-) NCBI GRCr8 mRatBN7.2 8 45,225,680 - 45,233,630 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 8 45,225,686 - 45,233,559 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 8 50,721,063 - 50,728,984 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 8 48,999,784 - 49,007,705 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 8 46,870,364 - 46,878,285 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 8 49,220,441 - 49,227,273 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 8 49,220,443 - 49,227,273 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 8 47,838,594 - 47,845,425 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 8 47,869,992 - 47,876,824 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 8 47,878,757 - 47,885,590 (-) NCBI Celera 8 44,811,539 - 44,818,403 (-) NCBI Celera Cytogenetic Map 8 q22 NCBI
ATP5MG Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 11 118,401,606 - 118,409,847 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 11 118,401,346 - 118,433,278 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 11 118,272,321 - 118,280,562 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 11 117,777,314 - 117,785,772 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 11 117,777,313 - 117,785,771 NCBI Celera 11 115,429,967 - 115,438,425 (+) NCBI Celera Cytogenetic Map 11 q23.3 NCBI HuRef 11 114,206,232 - 114,214,690 (+) NCBI HuRef CHM1_1 11 118,158,560 - 118,167,018 (+) NCBI CHM1_1 T2T-CHM13v2.0 11 118,417,857 - 118,426,099 (+) NCBI T2T-CHM13v2.0
Atp5mg Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 9 44,824,546 - 44,832,470 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 9 44,823,855 - 44,832,040 (-) Ensembl GRCm39 Ensembl GRCm38 9 44,913,248 - 44,920,742 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 9 44,912,557 - 44,920,742 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 9 44,721,331 - 44,728,825 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 9 44,664,264 - 44,671,693 (-) NCBI MGSCv36 mm8 Celera 9 42,178,549 - 42,186,041 (-) NCBI Celera Cytogenetic Map 9 A5.2 NCBI cM Map 9 24.84 NCBI
Atp5mg Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 NW_004955412 19,555,736 - 19,563,094 (+) NCBI ChiLan1.0 ChiLan1.0
ATP5MG Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 9 119,097,507 - 119,110,189 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 11 120,207,603 - 120,215,241 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 11 113,236,010 - 113,243,661 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 11 117,167,404 - 117,175,813 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 11 117,167,404 - 117,200,030 (+) Ensembl panpan1.1 panPan2
ATP5MG Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 5 15,329,060 - 15,336,344 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 5 15,379,815 - 15,387,098 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 5 15,271,207 - 15,278,474 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 5 15,271,208 - 15,278,312 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 5 15,409,657 - 15,416,929 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 5 15,313,394 - 15,320,670 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 5 15,354,006 - 15,361,292 (-) NCBI UU_Cfam_GSD_1.0
Atp5mg
ATP5MG Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 9 45,706,534 - 45,717,036 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 9 45,706,449 - 45,716,541 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 9 50,747,581 - 50,757,679 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
ATP5MG
Atp5mg
.
Predicted Target Of
Count of predictions: 37 Count of miRNA genes: 34 Interacting mature miRNAs: 37 Transcripts: ENSRNOT00000050878 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1298065 Scl16 Serum cholesterol level QTL 16 3.8 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 8 30856404 75856404 Rat 1554321 Bmd3 Bone mineral density QTL 3 7.9 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 8 40952565 123900184 Rat 1578769 Uae31 Urinary albumin excretion QTL 31 3.3 0.001 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 8 30848154 101699754 Rat 1298079 Activ2 Activity QTL 2 9.5 0.000001 voluntary movement trait (VT:0003491) rearing measurement (CMO:0001515) 8 41866876 86866876 Rat 11556286 Cm81 Cardiac mass QTL 81 0.01 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 8 30848154 61290444 Rat 70161 Bp62 Blood pressure QTL 62 2.9 0.001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 8 42692684 90165460 Rat 1578765 Klgr1 Kidney lesion grade QTL 1 3.3 0.0001 kidney morphology trait (VT:0002135) organ lesion measurement (CMO:0000677) 8 30848154 101699754 Rat 1582222 Epfw2 Epididymal fat weight QTL 2 3.2 0.0005 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 8 31737729 76737729 Rat 1354627 Despr14 Despair related QTL 14 0.0056 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 8 7688955 52688955 Rat 61464 Niddm11 Non-insulin dependent diabetes mellitus QTL 11 3.1 0.001 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 8 35582032 80582032 Rat 1578755 Pur5 Proteinuria QTL 5 3.3 0.0001 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 8 30848154 101699754 Rat 1300146 Rf17 Renal function QTL 17 2.9 renal blood flow trait (VT:2000006) absolute change in renal blood flow rate (CMO:0001168) 8 28242912 73242912 Rat 8662823 Vetf5 Vascular elastic tissue fragility QTL 5 1.9 artery integrity trait (VT:0010639) patent ductus arteriosus score (CMO:0002566) 8 28242912 99525068 Rat 2313088 Bss75 Bone structure and strength QTL 75 3.1 0.0001 body length (VT:0001256) body length, nose to rump (CMO:0000079) 8 30848154 82460899 Rat 1358896 Bp262 Blood pressure QTL 262 2.89 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 8 27205715 99103503 Rat 731182 Uae24 Urinary albumin excretion QTL 24 6.4 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 8 19331152 93965294 Rat 724514 Uae15 Urinary albumin excretion QTL 15 2.9 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 8 29502665 70386295 Rat 61353 Bp35 Blood pressure QTL 35 0.001 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 8 30848154 61290444 Rat 631842 Inf1 Infertility severity QTL 1 4.1 0.001 seminal gland mass (VT:0010524) seminal vesicle wet weight (CMO:0001603) 8 22662330 67662330 Rat 737824 Hcar10 Hepatocarcinoma resistance QTL 10 2.9 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 8 40713066 82925667 Rat 1359033 Bp273 Blood pressure QTL 273 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 8 30848154 61290444 Rat 1331769 Rf39 Renal function QTL 39 3.871 urine output (VT:0003620) timed urine volume (CMO:0000260) 8 41866876 75097878 Rat 61358 Bp39 Blood pressure QTL 39 2 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 8 35551938 80551938 Rat 1358906 Bp253 Blood pressure QTL 253 4 0.0004 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 8 40713066 93965294 Rat 1358907 Cm40 Cardiac mass QTL 40 1.89 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 8 27205715 99103503 Rat 1331744 Bp217 Blood pressure QTL 217 3.398 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 8 30848154 58482492 Rat 2316950 Scl66 Serum cholesterol level QTL 66 4.1 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 8 30848259 105647037 Rat 1358892 Kidm26 Kidney mass QTL 26 3.69 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 8 27205715 99103503 Rat 1359021 Bp271 Blood pressure QTL 271 1.8 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 8 26644912 46711092 Rat 631216 Stl9 Serum triglyceride level QTL 9 4.71 0.0001 blood triglyceride amount (VT:0002644) serum triglyceride level (CMO:0000360) 8 41867010 70386132 Rat 61373 Mcs4 Mammary carcinoma susceptibility QTL 4 1.1 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 8 16290444 61290444 Rat 2313057 Bss76 Bone structure and strength QTL 76 3 0.0001 tibia size trait (VT:0100001) tibia midshaft cross-sectional area (CMO:0001717) 8 30848154 82460899 Rat 12879878 Bw183 Body weight QTL 183 0.001 body mass (VT:0001259) body weight (CMO:0000012) 8 43296169 98968765 Rat 1549908 Neudeg1 Neurodegradation QTL 1 5.5 0 nervous system integrity trait (VT:0010566) logarithm of the ratio of the lesioned side motor neuron count to contralateral side motor neuron count (CMO:0001986) 8 30188867 94457446 Rat 12879879 Cm99 Cardiac mass QTL 99 0.001 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 8 43296169 98968765 Rat 2317030 Wbc5 White blood cell count QTL 5 3.21 0.005 leukocyte quantity (VT:0000217) white blood cell count (CMO:0000027) 8 8736635 53736635 Rat 1331804 Cm30 Cardiac mass QTL 30 3.77443 heart mass (VT:0007028) heart wet weight (CMO:0000069) 8 28242912 53961020 Rat 2313067 Bss77 Bone structure and strength QTL 77 3.1 0.0001 tibia size trait (VT:0100001) tibia midshaft endosteal cross-sectional area (CMO:0001716) 8 30848154 82460899 Rat 2317032 Ginf2 Gastrointestinal inflammation QTL 2 3.21 0.005 liver integrity trait (VT:0010547) liver granuloma severity score (CMO:0002157) 8 4705810 49705810 Rat 2301416 Bp315 Blood pressure QTL 315 0.008 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 8 7670578 52670578 Rat 12879880 Cm100 Cardiac mass QTL 100 0.001 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 8 43296169 98968765 Rat 12879881 Cm101 Cardiac mass QTL 101 0.001 heart right ventricle mass (VT:0007033) heart right ventricle weight to body weight ratio (CMO:0000914) 8 43296169 98968765 Rat 12879882 Am8 Aortic mass QTL 8 0.001 aorta mass (VT:0002845) aorta weight to aorta length to body weight ratio (CMO:0002722) 8 43296169 98968765 Rat 2317036 Livw3 Liver weight QTL 3 2.43 0.01 liver mass (VT:0003402) liver weight to body weight ratio (CMO:0000633) 8 4705810 49705810 Rat 12879883 Kidm65 Kidney mass QTL 65 0.001 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 8 43296169 98968765 Rat 12880023 Bw184 Body weight QTL 184 0.001 body mass (VT:0001259) body weight (CMO:0000012) 8 2097640 47097640 Rat 5684993 Bmd84 Bone mineral density QTL 84 4.1 tibia mineral mass (VT:1000283) bone mineral content (CMO:0001554) 8 42692684 50095447 Rat 12880028 Cm103 Cardiac mass QTL 103 0.02 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 8 2097640 47097640 Rat 2317051 Aia18 Adjuvant induced arthritis QTL 18 2.42 joint integrity trait (VT:0010548) left rear ankle joint diameter (CMO:0002149) 8 8736635 53736635 Rat 2317048 Ginf1 Gastrointestinal inflammation QTL 1 3.52 0.005 cecum mucosa thickness (VT:0010234) enterocolitis severity score (CMO:0002138) 8 4705810 49705810 Rat 12880025 Cm102 Cardiac mass QTL 102 0.044 heart mass (VT:0007028) heart wet weight to body weight ratio (CMO:0002408) 8 2097640 47097640 Rat 1558646 Swd5 Spike wave discharge measurement QTL 5 3.45 0.00036 brain electrophysiology trait (VT:0010557) brain spike-and-wave discharge frequency (CMO:0001742) 8 14906751 59906751 Rat 2302278 Gluco36 Glucose level QTL 36 4.2 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 8 29502665 50095447 Rat 12880044 Am9 Aortic mass QTL 9 0.007 aorta mass (VT:0002845) aorta weight to aorta length to body weight ratio (CMO:0002722) 8 2097640 47097640 Rat 631648 Stl5 Serum triglyceride level QTL 5 4 0.0003 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 8 27205715 54998217 Rat 1331838 Niddm61 Non-insulin dependent diabetes mellitus QTL 61 3.53 0.0004 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 8 36469535 99083736 Rat 631650 Stl6 Serum triglyceride level QTL 6 4 0.0019 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 8 10378157 112202585 Rat 1581557 Eae16 Experimental allergic encephalomyelitis QTL 16 3.8 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046) 8 8462195 110921472 Rat 631271 Lecl1 Lens clarity QTL 1 0.001 lens clarity trait (VT:0001304) age of onset/diagnosis of cataract (CMO:0001584) 8 18984168 84531599 Rat 2303564 Gluco43 Glucose level QTL 43 3 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 8 26130187 71130187 Rat 1598824 Memor4 Memory QTL 4 2.5 exploratory behavior trait (VT:0010471) total horizontal distance resulting from voluntary locomotion in an experimental apparatus (CMO:0001443) 8 9712220 53356647 Rat 2313046 Bss78 Bone structure and strength QTL 78 3.5 0.0001 tibia strength trait (VT:1000284) tibia total energy absorbed before break (CMO:0001736) 8 30848154 82460899 Rat 1354595 Despr4 Despair related QTL 4 2.16 0.0036 locomotor behavior trait (VT:0001392) amount of time spent in voluntary immobility (CMO:0001043) 8 7688955 52688955 Rat 2303572 Insul13 Insulin level QTL 13 2 blood insulin amount (VT:0001560) blood insulin level (CMO:0000349) 8 26130187 71130187 Rat
RH143634
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 8 45,226,787 - 45,226,914 (+) MAPPER mRatBN7.2 Rnor_6.0 8 49,220,479 - 49,220,605 NCBI Rnor6.0 Rnor_5.0 8 47,838,632 - 47,838,758 UniSTS Rnor5.0 RGSC_v3.4 8 47,870,030 - 47,870,156 UniSTS RGSC3.4 Celera 8 44,811,577 - 44,811,703 UniSTS RH 3.4 Map 8 452.1 UniSTS Cytogenetic Map 8 q22 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000050878 ⟹ ENSRNOP00000040969
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 8 45,225,686 - 45,233,559 (-) Ensembl Rnor_6.0 Ensembl 8 49,220,443 - 49,227,273 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000112312 ⟹ ENSRNOP00000088483
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 8 45,225,686 - 45,230,491 (-) Ensembl
RefSeq Acc Id:
NM_212516 ⟹ NP_997681
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 54,122,457 - 54,130,407 (-) NCBI mRatBN7.2 8 45,225,680 - 45,233,630 (-) NCBI Rnor_6.0 8 49,220,441 - 49,227,273 (-) NCBI Rnor_5.0 8 47,838,594 - 47,845,425 (-) NCBI RGSC_v3.4 8 47,869,992 - 47,876,824 (-) RGD Celera 8 44,811,539 - 44,818,403 (-) RGD
Sequence:
GGGGAGACGAACCTTCCACCTTAGACCATGGCCAAGTTCATCCGTAACCTCGCGGACAAGGCACCGTCGATGGTGGCGGCTGCCGTGACTTACTCGAAGCCTCGATTGGCCACATTTTGGCACTATGC
hide sequence
RefSeq Acc Id:
NP_997681 ⟸ NM_212516
- UniProtKB:
Q6PDU7 (UniProtKB/Swiss-Prot), G3V9A9 (UniProtKB/Swiss-Prot)
- Sequence:
MAKFIRNLADKAPSMVAAAVTYSKPRLATFWHYARVELVPPTLGEIPTAIQSMKNIIHSAQTGNFKHLTVKEAVLNGLVATEVWMWFYIGEIIGKRGIVGYDV
hide sequence
Ensembl Acc Id:
ENSRNOP00000040969 ⟸ ENSRNOT00000050878
Ensembl Acc Id:
ENSRNOP00000088483 ⟸ ENSRNOT00000112312
RGD ID: 13695905 Promoter ID: EPDNEW_R6429 Type: initiation region Name: Atp5mg_1 Description: ATP synthase membrane subunit g SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 8 49,227,303 - 49,227,363 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2023-05-26
Atp5mg
ATP synthase membrane subunit G
Atp5mg
ATP synthase membrane subunit g
Name changed
629549 APPROVED
2017-12-01
Atp5mg
ATP synthase membrane subunit g
Atp5l
ATP synthase, H+ transporting, mitochondrial Fo complex, subunit G
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2011-12-01
Atp5l
ATP synthase, H+ transporting, mitochondrial Fo complex, subunit G
Atp5l
ATP synthase, H+ transporting, mitochondrial F0 complex, subunit G
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-04-25
Atp5l
ATP synthase, H+ transporting, mitochondrial F0 complex, subunit G
MGC72942
similar to CG6105-PA
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2005-09-30
MGC72942
Symbol and Name status set to provisional
70820 PROVISIONAL
