Atp5mg (ATP synthase membrane subunit g)

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) RatMine GViewer (Genome Viewer) Overgo Probe Designer Aging & Age-Related Disease Cancer Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models PhenoMiner (Quantitative Phenotypes) Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Atp5mg (ATP synthase membrane subunit g) Rattus norvegicus

Analyze

Symbol:

Atp5mg

Name:

ATP synthase membrane subunit g

RGD ID:

1303259

Description:

Predicted to enable proton transmembrane transporter activity. Predicted to contribute to proton-transporting ATP synthase activity, rotational mechanism. Involved in ATP metabolic process. Part of mitochondrial proton-transporting ATP synthase complex, coupling factor F(o). Orthologous to several human genes including ATP5MG (ATP synthase membrane subunit g); PARTICIPATES IN oxidative phosphorylation pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; acetamide; bisphenol A.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

ATP synthase subunit g, mitochondrial; ATP synthase, H+ transporting, mitochondrial F0 complex, subunit G; ATP synthase, H+ transporting, mitochondrial Fo complex, subunit G; Atp5l; ATPase subunit g; MGC72942; similar to CG6105-PA

RGD Orthologs

Human

Mouse

Chinchilla

Bonobo

Dog

Squirrel

Pig

Green Monkey

Naked Mole-Rat

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	ATP5MG (ATP synthase membrane subunit g)	HGNC	EggNOG, Ensembl, HomoloGene, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Atp5l (ATP synthase, H+ transporting, mitochondrial F0 complex, subunit G)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Atp5mg (ATP synthase membrane subunit g)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	ATP5MG (ATP synthase membrane subunit g)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	ATP5MG (ATP synthase membrane subunit g)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Atp5mg (ATP synthase membrane subunit g)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	ATP5MG (ATP synthase membrane subunit g)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	ATP5MG (ATP synthase membrane subunit g)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Atp5mg (ATP synthase membrane subunit g)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	ATP5MGL (ATP synthase membrane subunit g like)	HGNC	EggNOG, Ensembl, Inparanoid, OMA, OrthoDB, Panther, PhylomeDB, Treefam
Alliance orthologs ³
Homo sapiens (human):	ATP5MGL (ATP synthase membrane subunit g like)	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)
Homo sapiens (human):	ATP5MG (ATP synthase membrane subunit g)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Atp5l (ATP synthase, H+ transporting, mitochondrial F0 complex, subunit G)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Gm5426 (predicted pseudogene 5426)	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER\|PhylomeDB)
Danio rerio (zebrafish):	atp5l (ATP synthase, H+ transporting, mitochondrial F0 complex, subunit g)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	ATP20	Alliance	DIOPT (Ensembl Compara\|PANTHER)
Drosophila melanogaster (fruit fly):	ATPsynG	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	ATPsynGL	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	asg-1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	asg-2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	8	45,226,750 - 45,233,582 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	8	45,225,686 - 45,233,559 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	8	50,721,063 - 50,728,984 (-)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	8	48,999,784 - 49,007,705 (-)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	8	46,870,364 - 46,878,285 (-)	NCBI	Rnor_WKY
Rnor_6.0	8	49,220,441 - 49,227,273 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	8	49,220,443 - 49,227,273 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	8	47,838,594 - 47,845,425 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	8	47,869,992 - 47,876,824 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	8	47,878,757 - 47,885,590 (-)	NCBI
Celera	8	44,811,539 - 44,818,403 (-)	NCBI		Celera
Cytogenetic Map	8	q22	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Alzheimer's disease (ISO)

CD3epsilon deficiency (ISO)

Chromosome 11, Partial Trisomy 11q (ISO)

congenital disorder of glycosylation Ij (ISO)

congenital myasthenic syndrome 13 (ISO)

Dwarfism (ISO)

Glycogen Storage Disease IB (ISO)

immunodeficiency 17 (ISO)

immunodeficiency 18 (ISO)

immunodeficiency 19 (ISO)

inflammatory bowel disease 28 (ISO)

intellectual disability (ISO)

long QT syndrome 10 (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dimethylhydrazine (ISO)

17alpha-ethynylestradiol (ISO)

2,2',4,4',5,5'-hexachlorobiphenyl (ISO)

2,2',5,5'-tetrachlorobiphenyl (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

4,4'-diaminodiphenylmethane (ISO)

acetamide (EXP)

aflatoxin B1 (ISO)

arsenite(3-) (ISO)

atrazine (ISO)

benzalkonium chloride (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP,ISO)

Butylparaben (ISO)

carbon nanotube (ISO)

CGP 52608 (ISO)

chloropicrin (ISO)

chrysene (ISO)

cisplatin (EXP)

clofibrate (ISO)

cyclosporin A (ISO)

dibutyl phthalate (EXP)

dihydroartemisinin (ISO)

doxorubicin (ISO)

epoxiconazole (ISO)

fenthion (ISO)

folic acid (ISO)

furan (EXP)

isobutanol (ISO)

ivermectin (ISO)

lipopolysaccharide (ISO)

methylmercury chloride (ISO)

methylparaben (ISO)

N-methyl-4-phenylpyridinium (ISO)

niclosamide (ISO)

ozone (ISO)

paracetamol (ISO)

PCB138 (ISO)

perfluorooctane-1-sulfonic acid (ISO)

phenethyl isothiocyanate (ISO)

resveratrol (ISO)

rotenone (ISO)

sodium arsenite (EXP,ISO)

sunitinib (ISO)

thioacetamide (EXP)

titanium dioxide (ISO)

tolcapone (EXP)

triptonide (ISO)

tungsten (ISO)

valproic acid (ISO)

vanadium atom (ISO)

vanadium(0) (ISO)

vinclozolin (EXP)

zidovudine (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

ATP metabolic process (IDA)

proton motive force-driven ATP synthesis (IBA,IEA)

proton motive force-driven mitochondrial ATP synthesis (ISO)

proton transmembrane transport (IEA)

Cellular Component

mitochondrial proton-transporting ATP synthase complex (IDA,ISO)

mitochondrial proton-transporting ATP synthase complex, coupling factor F(o) (IBA,IDA,IEA)

mitochondrion (ISO)

Molecular Function

protein binding (ISO)

proton transmembrane transporter activity (IEA)

proton-transporting ATP synthase activity, rotational mechanism (ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

oxidative phosphorylation pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Reduced Mitochondrial Activity is Early and Steady in the Entorhinal Cortex but it is Mainly Unmodified in the Frontal Cortex in Alzheimer's Disease.	Armand-Ugon M, etal., Curr Alzheimer Res. 2017;14(12):1327-1334. doi: 10.2174/1567205014666170505095921.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	Mitochondrial F(0)F(1) ATP synthase. Subunit regions on the F1 motor shielded by F(0), Functional significance, and evidence for an involvement of the unique F(0) subunit F(6).	Ko YH, etal., J Biol Chem. 2000 Oct 20;275(42):32931-9.
4.	Identification of two proteins associated with mammalian ATP synthase.	Meyer B, etal., Mol Cell Proteomics. 2007 Oct;6(10):1690-9. Epub 2007 Jun 17.
5.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
6.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
7.	GOA pipeline	RGD automated data pipeline
8.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
9.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.

Additional References at PubMed

PMID:12110673	PMID:12865426	PMID:14651853	PMID:18614015	PMID:23376485	PMID:29476059

Genomics

Comparative Map Data

Atp5mg
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	8	45,226,750 - 45,233,582 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	8	45,225,686 - 45,233,559 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	8	50,721,063 - 50,728,984 (-)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	8	48,999,784 - 49,007,705 (-)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	8	46,870,364 - 46,878,285 (-)	NCBI	Rnor_WKY
Rnor_6.0	8	49,220,441 - 49,227,273 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	8	49,220,443 - 49,227,273 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	8	47,838,594 - 47,845,425 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	8	47,869,992 - 47,876,824 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	8	47,878,757 - 47,885,590 (-)	NCBI
Celera	8	44,811,539 - 44,818,403 (-)	NCBI		Celera
Cytogenetic Map	8	q22	NCBI

ATP5MG
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	11	118,401,606 - 118,409,847 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p13 Ensembl	11	118,401,346 - 118,433,278 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	11	118,272,321 - 118,280,562 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	11	117,777,314 - 117,785,772 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	11	117,777,313 - 117,785,771	NCBI
Celera	11	115,429,967 - 115,438,425 (+)	NCBI		Celera
Cytogenetic Map	11	q23.3	NCBI
HuRef	11	114,206,232 - 114,214,690 (+)	NCBI		HuRef
CHM1_1	11	118,158,560 - 118,167,018 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	11	118,417,857 - 118,426,099 (+)	NCBI		T2T-CHM13v2.0

Atp5l
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	9	44,824,546 - 44,832,470 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	9	44,823,855 - 44,832,040 (-)	Ensembl		GRCm39 Ensembl
GRCm38	9	44,913,248 - 44,920,742 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	9	44,912,557 - 44,920,742 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	9	44,721,331 - 44,728,825 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	9	44,664,264 - 44,671,693 (-)	NCBI		MGSCv36	mm8
Celera	9	42,178,549 - 42,186,041 (-)	NCBI		Celera
Cytogenetic Map	9	A5.2	NCBI

Atp5mg
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0	NW_004955412	19,555,736 - 19,563,094 (+)	NCBI	ChiLan1.0	ChiLan1.0

ATP5MG
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
PanPan1.1	11	117,167,404 - 117,175,813 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	11	117,167,404 - 117,200,030 (+)	Ensembl	panpan1.1		panPan2
Mhudiblu_PPA_v0	11	113,236,010 - 113,243,661 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3

ATP5MG
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	5	15,329,060 - 15,336,344 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
Dog10K_Boxer_Tasha	5	15,379,815 - 15,387,098 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	5	15,271,207 - 15,278,474 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	5	15,271,208 - 15,278,312 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	5	15,409,657 - 15,416,929 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	5	15,313,394 - 15,320,670 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	5	15,354,006 - 15,361,292 (-)	NCBI		UU_Cfam_GSD_1.0

Atp5mg
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404947	100,531,841 - 100,539,716 (+)	NCBI		HiC_Itri_2
SpeTri2.0	NW_004936542	3,453,287 - 3,461,125 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

ATP5MG
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	9	45,706,534 - 45,717,036 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	9	45,706,449 - 45,716,541 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	9	50,747,581 - 50,757,679 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

ATP5MG
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	1	109,779,020 - 109,789,097 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666043	16,248,046 - 16,256,735 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Atp5mg
(Heterocephalus glaber - naked mole-rat)

Naked Mole-rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624784	13,794,685 - 13,802,056 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624784	13,794,610 - 13,802,056 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Atp5mg
25 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	37
Count of miRNA genes:	34
Interacting mature miRNAs:	37
Transcripts:	ENSRNOT00000050878
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
12880023	Bw184	Body weight QTL 184		0.001	body mass (VT:0001259)	body weight (CMO:0000012)	8	2097640	47097640	Rat
12880025	Cm102	Cardiac mass QTL 102		0.044	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	8	2097640	47097640	Rat
12880028	Cm103	Cardiac mass QTL 103		0.02	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	8	2097640	47097640	Rat
12880044	Am9	Aortic mass QTL 9		0.007	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	8	2097640	47097640	Rat
2317032	Ginf2	Gastrointestinal inflammation QTL 2	3.21	0.005	liver integrity trait (VT:0010547)	liver granuloma severity score (CMO:0002157)	8	4705810	49705810	Rat
2317036	Livw3	Liver weight QTL 3	2.43	0.01	liver mass (VT:0003402)	liver weight to body weight ratio (CMO:0000633)	8	4705810	49705810	Rat
2317048	Ginf1	Gastrointestinal inflammation QTL 1	3.52	0.005	cecum mucosa thickness (VT:0010234)	enterocolitis severity score (CMO:0002138)	8	4705810	49705810	Rat
2301416	Bp315	Blood pressure QTL 315		0.008	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	7670578	52670578	Rat
1354595	Despr4	Despair related QTL 4	2.16	0.0036	locomotor behavior trait (VT:0001392)	amount of time spent in voluntary immobility (CMO:0001043)	8	7688955	52688955	Rat
1354627	Despr14	Despair related QTL 14		0.0056	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	8	7688955	52688955	Rat
1581557	Eae16	Experimental allergic encephalomyelitis QTL 16	3.8		nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046)	8	8462195	110921472	Rat
2317030	Wbc5	White blood cell count QTL 5	3.21	0.005	leukocyte quantity (VT:0000217)	white blood cell count (CMO:0000027)	8	8736635	53736635	Rat
2317051	Aia18	Adjuvant induced arthritis QTL 18	2.42		joint integrity trait (VT:0010548)	left rear ankle joint diameter (CMO:0002149)	8	8736635	53736635	Rat
1598824	Memor4	Memory QTL 4	2.5		exploratory behavior trait (VT:0010471)	total horizontal distance resulting from voluntary locomotion in an experimental apparatus (CMO:0001443)	8	9712220	53356647	Rat
631650	Stl6	Serum triglyceride level QTL 6	4	0.0019	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	8	10378157	112202585	Rat
1558646	Swd5	Spike wave discharge measurement QTL 5	3.45	0.00036	brain electrophysiology trait (VT:0010557)	brain spike-and-wave discharge frequency (CMO:0001742)	8	14906751	59906751	Rat
61373	Mcs4	Mammary carcinoma susceptibility QTL 4	1.1		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	8	16290444	61290444	Rat
631271	Lecl1	Lens clarity QTL 1		0.001	lens clarity trait (VT:0001304)	age of onset/diagnosis of cataract (CMO:0001584)	8	18984168	84531599	Rat
731182	Uae24	Urinary albumin excretion QTL 24	6.4		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	8	19331152	93965294	Rat
631842	Inf1	Infertility severity QTL 1	4.1	0.001	seminal gland mass (VT:0010524)	seminal vesicle wet weight (CMO:0001603)	8	22662330	67662330	Rat
2303564	Gluco43	Glucose level QTL 43	3		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	8	26130187	71130187	Rat
2303572	Insul13	Insulin level QTL 13	2		blood insulin amount (VT:0001560)	blood insulin level (CMO:0000349)	8	26130187	71130187	Rat
1359021	Bp271	Blood pressure QTL 271	1.8		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	26644912	46711092	Rat
631648	Stl5	Serum triglyceride level QTL 5	4	0.0003	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	8	27205715	54998217	Rat
1358892	Kidm26	Kidney mass QTL 26	3.69		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	8	27205715	99103503	Rat
1358896	Bp262	Blood pressure QTL 262	2.89		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	27205715	99103503	Rat
1358907	Cm40	Cardiac mass QTL 40	1.89		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	8	27205715	99103503	Rat
1331804	Cm30	Cardiac mass QTL 30	3.77443		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	8	28242912	53961020	Rat
1300146	Rf17	Renal function QTL 17	2.9		renal blood flow trait (VT:2000006)	absolute change in renal blood flow rate (CMO:0001168)	8	28242912	73242912	Rat
8662823	Vetf5	Vascular elastic tissue fragility QTL 5	1.9		artery integrity trait (VT:0010639)	patent ductus arteriosus score (CMO:0002566)	8	28242912	99525068	Rat
2302278	Gluco36	Glucose level QTL 36	4.2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	8	29502665	50095447	Rat
724514	Uae15	Urinary albumin excretion QTL 15	2.9		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	8	29502665	70386295	Rat
1549908	Neudeg1	Neurodegradation QTL 1	5.5	0	nervous system integrity trait (VT:0010566)	logarithm of the ratio of the lesioned side motor neuron count to contralateral side motor neuron count (CMO:0001986)	8	30188867	94457446	Rat
1331744	Bp217	Blood pressure QTL 217	3.398		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	30848154	58482492	Rat
61353	Bp35	Blood pressure QTL 35		0.001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	30848154	61290444	Rat
61353	Bp35	Blood pressure QTL 35		0.001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	30848154	61290444	Rat
61353	Bp35	Blood pressure QTL 35		0.001	arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	8	30848154	61290444	Rat
61353	Bp35	Blood pressure QTL 35		0.001	arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	8	30848154	61290444	Rat
11556286	Cm81	Cardiac mass QTL 81		0.01	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	8	30848154	61290444	Rat
1359033	Bp273	Blood pressure QTL 273			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	30848154	61290444	Rat
2313046	Bss78	Bone structure and strength QTL 78	3.5	0.0001	tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	8	30848154	82460899	Rat
2313057	Bss76	Bone structure and strength QTL 76	3	0.0001	tibia size trait (VT:0100001)	tibia midshaft cross-sectional area (CMO:0001717)	8	30848154	82460899	Rat
2313067	Bss77	Bone structure and strength QTL 77	3.1	0.0001	tibia size trait (VT:0100001)	tibia midshaft endosteal cross-sectional area (CMO:0001716)	8	30848154	82460899	Rat
2313088	Bss75	Bone structure and strength QTL 75	3.1	0.0001	body length (VT:0001256)	body length, nose to rump (CMO:0000079)	8	30848154	82460899	Rat
1578755	Pur5	Proteinuria QTL 5	3.3	0.0001	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	8	30848154	101699754	Rat
1578765	Klgr1	Kidney lesion grade QTL 1	3.3	0.0001	kidney morphology trait (VT:0002135)	organ lesion measurement (CMO:0000677)	8	30848154	101699754	Rat
1578769	Uae31	Urinary albumin excretion QTL 31	3.3	0.001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	8	30848154	101699754	Rat
2316950	Scl66	Serum cholesterol level QTL 66	4.1		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	8	30848259	105647037	Rat
1298065	Scl16	Serum cholesterol level QTL 16	3.8		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	8	30856404	75856404	Rat
1582222	Epfw2	Epididymal fat weight QTL 2	3.2	0.0005	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	8	31737729	76737729	Rat
61358	Bp39	Blood pressure QTL 39	2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	35551938	80551938	Rat
61464	Niddm11	Non-insulin dependent diabetes mellitus QTL 11	3.1	0.001	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	8	35582032	80582032	Rat
1331838	Niddm61	Non-insulin dependent diabetes mellitus QTL 61	3.53	0.0004	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	8	36469535	99083736	Rat
737824	Hcar10	Hepatocarcinoma resistance QTL 10	2.9		liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	8	40713066	82925667	Rat
1358906	Bp253	Blood pressure QTL 253	4	0.0004	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	40713066	93965294	Rat
1554321	Bmd3	Bone mineral density QTL 3	7.9	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	8	40952565	123900184	Rat
1331769	Rf39	Renal function QTL 39	3.871		urine output (VT:0003620)	timed urine volume (CMO:0000260)	8	41866876	75097878	Rat
1298079	Activ2	Activity QTL 2	9.5	0.000001	voluntary movement trait (VT:0003491)	rearing measurement (CMO:0001515)	8	41866876	86866876	Rat
631216	Stl9	Serum triglyceride level QTL 9	4.71	0.0001	blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	8	41867010	70386132	Rat
5684993	Bmd84	Bone mineral density QTL 84	4.1		tibia mineral mass (VT:1000283)	bone mineral content (CMO:0001554)	8	42692684	50095447	Rat
70161	Bp62	Blood pressure QTL 62	2.9	0.001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	42692684	90165460	Rat
12879882	Am8	Aortic mass QTL 8		0.001	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	8	43296169	98968765	Rat
12879878	Bw183	Body weight QTL 183		0.001	body mass (VT:0001259)	body weight (CMO:0000012)	8	43296169	98968765	Rat
12879879	Cm99	Cardiac mass QTL 99		0.001	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	8	43296169	98968765	Rat
12879880	Cm100	Cardiac mass QTL 100		0.001	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	8	43296169	98968765	Rat
12879881	Cm101	Cardiac mass QTL 101		0.001	heart right ventricle mass (VT:0007033)	heart right ventricle weight to body weight ratio (CMO:0000914)	8	43296169	98968765	Rat
12879883	Kidm65	Kidney mass QTL 65		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	8	43296169	98968765	Rat

Markers in Region

RH143634

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	8	45,226,787 - 45,226,914 (+)	MAPPER	mRatBN7.2
Rnor_6.0	8	49,220,479 - 49,220,605	NCBI	Rnor6.0
Rnor_5.0	8	47,838,632 - 47,838,758	UniSTS	Rnor5.0
RGSC_v3.4	8	47,870,030 - 47,870,156	UniSTS	RGSC3.4
Celera	8	44,811,577 - 44,811,703	UniSTS
RH 3.4 Map	8	452.1	UniSTS
Cytogenetic Map	8	q22	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High		25
Medium	3	18	57	41	19	41	8	11	74	35	41	11	8
Low
Below cutoff

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_212516	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC136866	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC058497	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ210248	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ211867	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ214495	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ214576	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ217032	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ217139	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ217410	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ217906	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ218008	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ221909	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ223878	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ223920	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ224004	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ224067	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ224620	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ224644	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ229120	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000198	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Reference Sequences

RefSeq Acc Id:

ENSRNOT00000050878 ⟹ ENSRNOP00000040969

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	8	45,225,686 - 45,233,559 (-)	Ensembl
Rnor_6.0 Ensembl	8	49,220,443 - 49,227,273 (-)	Ensembl

RefSeq Acc Id:

ENSRNOT00000112312 ⟹ ENSRNOP00000088483

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	8	45,225,686 - 45,230,491 (-)	Ensembl

RefSeq Acc Id:

NM_212516 ⟹ NP_997681

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	8	45,226,750 - 45,233,582 (-)	NCBI
Rnor_6.0	8	49,220,441 - 49,227,273 (-)	NCBI
Rnor_5.0	8	47,838,594 - 47,845,425 (-)	NCBI
RGSC_v3.4	8	47,869,992 - 47,876,824 (-)	RGD
Celera	8	44,811,539 - 44,818,403 (-)	RGD

Sequence:

show sequence

GGGGAGACGAACCTTCCACCTTAGACCATGGCCAAGTTCATCCGTAACCTCGCGGACAAGGCAC
CGTCGATGGTGGCGGCTGCCGTGACTTACTCGAAGCCTCGATTGGCCACATTTTGGCACTATGC
TAGGGTTGAGCTGGTTCCCCCAACCCTTGGTGAAATCCCTACAGCTATTCAGAGCATGAAAAAT
ATAATTCACAGTGCCCAAACTGGTAACTTCAAACACCTCACAGTTAAGGAAGCTGTGCTGAATG
GTTTGGTGGCCACTGAGGTGTGGATGTGGTTTTATATCGGAGAGATCATAGGCAAACGTGGCAT
TGTTGGCTATGATGTTTGAAGACCAATCTTTAACTTCTGATTTGAGTTCTTATCTTGGACCATG
TGTAATGAGACTGCTATCTGAATAAAATGCTAGCTGTGCAGTGGCAGTGTTTCCTCTGTCAAGT
ACTGCACAGTGACAGTATTTCCTGATAGTAAAAAAATAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_997681	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH58497	(Get FASTA)	NCBI Sequence Viewer
	Q6PDU7	(Get FASTA)	NCBI Sequence Viewer

Reference Sequences

RefSeq Acc Id:	NP_997681 ⟸ NM_212516
- UniProtKB:	G3V9A9 (UniProtKB/Swiss-Prot)
- Sequence:	show sequence MAKFIRNLADKAPSMVAAAVTYSKPRLATFWHYARVELVPPTLGEIPTAIQSMKNIIHSAQTGN FKHLTVKEAVLNGLVATEVWMWFYIGEIIGKRGIVGYDV hide sequence

RefSeq Acc Id:

ENSRNOP00000040969 ⟸ ENSRNOT00000050878

RefSeq Acc Id:

ENSRNOP00000088483 ⟸ ENSRNOT00000112312

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q6PDU7-F1-model_v2	AlphaFold	Q6PDU7	1-103	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13695905

Promoter ID:

EPDNEW_R6429

Type:

initiation region

Name:

Atp5mg_1

Description:

ATP synthase membrane subunit g

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	8	49,227,303 - 49,227,363	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1303259	AgrOrtholog
BioCyc Gene	G2FUF-30693	BioCyc
BioCyc Pathway	PWY-7980 [ATP biosynthesis]	BioCyc
Ensembl Genes	ENSRNOG00000028884	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Ensembl Protein	ENSRNOP00000040969	ENTREZGENE, UniProtKB/Swiss-Prot
	ENSRNOP00000088483.1	UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000050878	ENTREZGENE, UniProtKB/Swiss-Prot
	ENSRNOT00000112312.1	UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:6918545	IMAGE-MGC_LOAD
InterPro	ATP_synth_F0_gsu_mt	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	ATP_synth_su_G_mt_met	UniProtKB/Swiss-Prot
KEGG Report	rno:300677	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:72942	IMAGE-MGC_LOAD
NCBI Gene	300677	ENTREZGENE
PANTHER	PTHR12386	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	ATP-synt_G	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Atp5mg	PhenoGen
PIRSF	ATP-synth_g_mitoch_animal	UniProtKB/Swiss-Prot
UniProt	A0A8I6A6M0_RAT	UniProtKB/TrEMBL
	ATP5L_RAT	UniProtKB/Swiss-Prot
	G3V9A9	ENTREZGENE
	Q6PDU7	ENTREZGENE
UniProt Secondary	G3V9A9	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2017-12-01	Atp5mg	ATP synthase membrane subunit g	Atp5l	ATP synthase, H+ transporting, mitochondrial Fo complex, subunit G	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2011-12-01	Atp5l	ATP synthase, H+ transporting, mitochondrial Fo complex, subunit G	Atp5l	ATP synthase, H+ transporting, mitochondrial F0 complex, subunit G	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-04-25	Atp5l	ATP synthase, H+ transporting, mitochondrial F0 complex, subunit G	MGC72942	similar to CG6105-PA	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-09-30	MGC72942				Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Annotations - KEGG (archival)